Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= 305b4
(376 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17542418|ref|NP_501739.1| MSP-domain protein like family memb... 210 5e-54
gi|17542092|ref|NP_501782.1| Sperm-Specific family, class P SSP-... 208 2e-53
gi|39592211|emb|CAE75432.1| Hypothetical protein CBG23425 [Caeno... 152 1e-36
gi|17544490|ref|NP_501989.1| MSP-domain protein like family memb... 152 2e-36
gi|39581884|emb|CAE60778.1| Hypothetical protein CBG04467 [Caeno... 151 3e-36
gi|17508753|ref|NP_493318.1| Sperm-Specific family, class P SSP-... 151 3e-36
gi|34810947|pdb|1M1S|A Chain A, Structure Of Wr4, A C.Elegans Ms... 150 7e-36
gi|17561434|ref|NP_506076.1| major sperm protein, member of a la... 148 3e-35
gi|17562962|ref|NP_506630.1| MSP-domain protein like family memb... 147 5e-35
gi|39589662|emb|CAE66897.1| Hypothetical protein CBG12279 [Caeno... 139 1e-32
gi|50511749|gb|AAT77424.1| MSP-domain protein 1 variant [Ascaris... 111 3e-24
gi|50511753|gb|AAT77426.1| MSP-domain protein 1 variant [Ascaris... 109 1e-23
gi|50511751|gb|AAT77425.1| MSP-domain protein 1 variant [Ascaris... 109 1e-23
gi|50511755|gb|AAT77427.1| MSP-domain protein 1 variant [Ascaris... 109 1e-23
gi|50511745|gb|AAT77422.1| MSP-domain protein 1 variant [Ascaris... 109 1e-23
gi|49121580|gb|AAN08879.2| MSP-domain protein 1 [Ascaris suum] 109 1e-23
gi|33114622|gb|AAP94884.1| MFP1-alpha [Ascaris suum] 108 2e-23
gi|23169000|gb|AAN08881.1| MSP-domain protein 3 [Ascaris suum] >... 107 6e-23
gi|33114624|gb|AAP94885.1| MFP1-beta [Ascaris suum] 106 9e-23
gi|39591169|emb|CAE73222.1| Hypothetical protein CBG20628 [Caeno... 102 1e-21
gi|17540424|ref|NP_501808.1| MSP-domain protein like family memb... 102 1e-21
gi|17542088|ref|NP_501767.1| MSP-domain protein like family memb... 101 3e-21
gi|17542086|ref|NP_500697.1| Sperm-Specific family, class P SSP-... 101 3e-21
gi|39591164|emb|CAE73217.1| Hypothetical protein CBG20623 [Caeno... 101 3e-21
gi|39594026|emb|CAE70136.1| Hypothetical protein CBG16598 [Caeno... 101 4e-21
gi|39596794|emb|CAE59021.1| Hypothetical protein CBG02298 [Caeno... 101 4e-21
gi|39582951|emb|CAE73016.1| Hypothetical protein CBG20377 [Caeno... 100 5e-21
gi|17508749|ref|NP_491762.1| Sperm-Specific family, class P SSP-... 100 5e-21
gi|17508751|ref|NP_491000.1| Sperm-Specific family, class P SSP-... 100 1e-20
gi|39592311|emb|CAE63388.1| Hypothetical protein CBG07809 [Caeno... 91 7e-18
gi|39595357|emb|CAE60394.1| Hypothetical protein CBG03996 [Caeno... 77 1e-13
gi|39593130|emb|CAE64599.1| Hypothetical protein CBG09354 [Caeno... 73 2e-12
gi|39591509|emb|CAE73563.1| Hypothetical protein CBG21033 [Caeno... 66 2e-10
gi|17562648|ref|NP_504485.1| MSP-domain protein like family memb... 65 2e-10
gi|17557470|ref|NP_506723.1| MSP-domain protein like family memb... 65 3e-10
gi|39582189|emb|CAE71521.1| Hypothetical protein CBG18456 [Caeno... 65 4e-10
gi|17541248|ref|NP_501765.1| predicted CDS, MSP-domain protein l... 64 5e-10
gi|17538127|ref|NP_496078.1| predicted CDS, MSP-domain protein l... 64 5e-10
gi|17560600|ref|NP_507182.1| MSP-domain protein like family memb... 62 2e-09
gi|17560040|ref|NP_507098.1| MSP-domain protein like family memb... 62 2e-09
gi|17558192|ref|NP_506701.1| MSP-domain protein like family memb... 62 4e-09
gi|17558194|ref|NP_506702.1| MSP-domain protein like family memb... 62 4e-09
gi|17507523|ref|NP_492407.1| MSP-domain protein like family memb... 61 5e-09
gi|17538125|ref|NP_496079.1| predicted CDS, MSP-domain protein l... 61 6e-09
gi|17558208|ref|NP_506700.1| MSP-domain protein like family memb... 61 6e-09
gi|39594899|emb|CAE70767.1| Hypothetical protein CBG17518 [Caeno... 60 1e-08
gi|23169006|gb|AAN08882.1| MSP-domain protein 4 [Ascaris suum] >... 59 3e-08
gi|17568285|ref|NP_509840.1| predicted CDS, MSP-domain protein l... 59 3e-08
gi|39589763|emb|CAE66998.1| Hypothetical protein CBG12397 [Caeno... 58 4e-08
gi|17559594|ref|NP_507136.1| MSP-domain protein like (32.2 kD) (... 58 4e-08
gi|17560900|ref|NP_506264.1| predicted CDS, MSP-domain protein 1... 57 7e-08
gi|39586114|emb|CAE69190.1| Hypothetical protein CBG15225 [Caeno... 57 9e-08
gi|23169009|gb|AAN08883.1| MSP-domain protein 5 [Ascaris suum] >... 57 9e-08
gi|17539024|ref|NP_501124.1| major sperm protein with N myristoy... 57 1e-07
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 55 3e-07
gi|17505881|ref|NP_492824.1| vamp-associated protein like family... 54 7e-07
gi|17509493|ref|NP_493185.1| MSP-domain protein 1 like precursor... 54 1e-06
gi|39594090|emb|CAE70200.1| Hypothetical protein CBG16675 [Caeno... 52 2e-06
gi|17552806|ref|NP_498780.1| MSP-domain protein like family memb... 52 3e-06
gi|39579370|emb|CAE56171.1| Hypothetical protein CBG23791 [Caeno... 51 6e-06
gi|39589204|emb|CAE57937.1| Hypothetical protein CBG00991 [Caeno... 44 0.001
gi|39582088|emb|CAE63731.1| Hypothetical protein CBG08258 [Caeno... 42 0.002
gi|17540380|ref|NP_501472.1| MSP-domain protein like family memb... 42 0.004
gi|17563008|ref|NP_506815.1| predicted CDS, major sperm protein ... 40 0.011
gi|17505564|ref|NP_491434.1| MSP-domain protein like (19.5 kD) (... 40 0.011
gi|39586995|emb|CAE62930.1| Hypothetical protein CBG07136 [Caeno... 39 0.024
gi|39583643|emb|CAE65747.1| Hypothetical protein CBG10833 [Caeno... 38 0.041
gi|17542484|ref|NP_502216.1| MSP-domain protein 2 like family me... 37 0.071
gi|23483569|gb|EAA19198.1| hypothetical protein [Plasmodium yoel... 37 0.071
gi|7496307|pir||T15562 hypothetical protein C18F10.2 - Caenorhab... 37 0.071
gi|25152845|ref|NP_741183.1| predicted CDS, major sperm protein ... 37 0.071
gi|23509599|ref|NP_702266.1| vesicle-associated membrane protein... 37 0.092
gi|39595447|emb|CAE60485.1| Hypothetical protein CBG04099 [Caeno... 37 0.092
gi|25407055|pir||B86220 protein F22O13.31 [imported] - Arabidops... 37 0.12
gi|30680831|ref|NP_172359.2| vesicle-associated membrane family ... 37 0.12
gi|7485994|pir||T00738 hypothetical protein F22O13.33 - Arabidop... 37 0.12
gi|39591787|emb|CAE71365.1| Hypothetical protein CBG18269 [Caeno... 36 0.16
gi|17554100|ref|NP_499837.1| predicted CDS, major sperm protein ... 35 0.27
gi|17509511|ref|NP_491051.1| MSP-domain protein like family memb... 35 0.27
gi|33328907|gb|AAQ09860.1| CG7919 [Drosophila yakuba] 35 0.46
gi|26554377|ref|NP_758311.1| tRNA pseudouridine 5S synthase [Myc... 34 0.60
gi|33300172|emb|CAE17819.1| Hypothetical protein F52F12.8 [Caeno... 34 0.60
gi|15224067|ref|NP_179963.1| vesicle-associated membrane protein... 34 0.60
gi|39591543|emb|CAE71119.1| Hypothetical protein CBG17972 [Caeno... 34 0.78
gi|45200815|ref|NP_986385.1| AGL282Wp [Eremothecium gossypii] >g... 34 0.78
gi|39595208|emb|CAE60245.1| Hypothetical protein CBG03818 [Caeno... 33 1.3
gi|24660611|ref|NP_524657.2| CG7919-PA [Drosophila melanogaster]... 33 1.3
gi|23121006|ref|ZP_00103449.1| COG1932: Phosphoserine aminotrans... 33 1.7
gi|49328137|gb|AAT58835.1| 'unknown protein, contains major sper... 33 1.7
gi|49069870|ref|XP_399224.1| hypothetical protein UM01609.1 [Ust... 33 1.7
gi|15895288|ref|NP_348637.1| Aldehyde:ferredoxin oxidoreductase ... 32 2.3
gi|39583249|emb|CAE60041.1| Hypothetical protein CBG03552 [Caeno... 32 2.3
gi|23168994|gb|AAN08880.1| MSP-domain protein 2 [Ascaris suum] >... 32 3.0
gi|21554053|gb|AAM63134.1| putative VAMP-associated protein [Ara... 32 3.9
gi|11288305|pir||T47871 hypothetical protein T4C21.10 - Arabidop... 32 3.9
gi|17557067|ref|NP_498721.1| MSP-domain protein 2 like family me... 32 3.9
gi|48845150|ref|ZP_00299437.1| COG3670: Lignostilbene-alpha,beta... 32 3.9
gi|6323022|ref|NP_013094.1| Hypothetical ORF; Yll007cp [Saccharo... 32 3.9
gi|18411661|ref|NP_567101.1| vesicle-associated membrane protein... 32 3.9
gi|46137715|ref|XP_390549.1| hypothetical protein FG10373.1 [Gib... 32 3.9
gi|15223792|ref|NP_175538.1| vesicle-associated membrane protein... 31 5.1
gi|50255293|gb|EAL18028.1| hypothetical protein CNBK0490 [Crypto... 31 5.1
gi|17558002|ref|NP_506565.1| predicted CDS, MSP-domain protein 2... 31 5.1
gi|49094164|ref|XP_408543.1| hypothetical protein AN4406.2 [Aspe... 31 5.1
gi|25405451|pir||E96550 hypothetical protein F11M15.13 [imported... 31 5.1
gi|28898404|ref|NP_798009.1| putative calcium-binding outer memb... 31 6.6
gi|34907216|ref|NP_914955.1| P0504E02.2 [Oryza sativa (japonica ... 31 6.6
gi|50428123|ref|XP_457850.1| unnamed protein product [Debaryomyc... 31 6.6
gi|19113546|ref|NP_596754.1| vesicle associated membrane protein... 30 8.7
gi|41614897|ref|NP_963395.1| NEQ100 [Nanoarchaeum equitans Kin4-... 30 8.7
gi|48855865|ref|ZP_00310023.1| COG5295: Autotransporter adhesin ... 30 8.7
gi|17533927|ref|NP_494271.1| major sperm protein domain and Zn-... 30 8.7
>gi|17542418|ref|NP_501739.1| MSP-domain protein like family member
(4K528) [Caenorhabditis elegans]
gi|7507784|pir||T24886 hypothetical protein T13F2.12 -
Caenorhabditis elegans
gi|3879839|emb|CAB03363.1| Hypothetical protein T13F2.12
[Caenorhabditis elegans]
Length = 107
Score = 210 bits (535), Expect = 5e-54
Identities = 106/107 (99%), Positives = 106/107 (99%)
Frame = -2
Query: 363 MLTIEXPSATFPASGGSSTHTITSVNESRMAFKVKSSNNEHYRVRPVYGFVEARGKMKFE 184
MLTIE PSATFPASGGSSTHTITSVNESRMAFKVKSSNNEHYRVRPVYGFVEARGKMKFE
Sbjct: 1 MLTIEPPSATFPASGGSSTHTITSVNESRMAFKVKSSNNEHYRVRPVYGFVEARGKMKFE 60
Query: 183 IIRLEGPVKDDKIMLQYAEVPADETDAQAPFKAGAQQGDVTILLKTT 43
IIRLEGPVKDDKIMLQYAEVPADETDAQAPFKAGAQQGDVTILLKTT
Sbjct: 61 IIRLEGPVKDDKIMLQYAEVPADETDAQAPFKAGAQQGDVTILLKTT 107