Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= 357e6
         (373 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17558110|ref|NP_507437.1| ubiquitin interacting motif (5S5C) ...   130   6e-30
gi|33300422|emb|CAB07255.2| Hypothetical protein K10G4.5 [Caenor...    74   7e-13
gi|17562494|ref|NP_507379.1| cyclin-like F-box and Protein of un...    74   7e-13
gi|17560784|ref|NP_507340.1| cyclin-like F-box and Protein of un...    67   8e-11
gi|32567140|ref|NP_503905.2| predicted CDS, cyclin-like F-box an...    44   8e-04
gi|7508625|pir||T28991 hypothetical protein T28A11.21 - Caenorha...    44   8e-04
gi|17558050|ref|NP_503929.1| cyclin-like F-box and Protein of un...    40   0.011
gi|7495522|pir||T19004 hypothetical protein C06C3.9 - Caenorhabd...    34   0.60
gi|17556717|ref|NP_497376.1| predicted CDS, cyclin-like F-box an...    33   1.0
gi|17556626|ref|NP_497399.1| predicted CDS, cyclin-like F-box fa...    33   1.8
gi|10719880|sp|O86131|ARCA_BACLI Arginine deiminase (ADI) (Argin...    32   2.3
gi|17556590|ref|NP_497383.1| predicted CDS, cyclin-like F-box an...    32   3.0
gi|47497038|dbj|BAD19091.1| putative H+-exporting ATPase [Oryza ...    32   3.0
gi|20302441|emb|CAD29312.1| plasma membrane H+-ATPase [Oryza sat...    32   3.0
gi|39582868|emb|CAE71644.1| Hypothetical protein CBG18615 [Caeno...    32   3.0
gi|7436350|pir||T02083 H+-exporting ATPase (EC 3.6.3.6) Mha1 - m...    32   3.0
gi|17555026|ref|NP_497304.1| cyclin-like F-box and Protein of un...    32   3.0
gi|20302433|emb|CAD29295.1| plasma membrane H+ ATPase [Oryza sat...    32   3.0
gi|7436354|pir||T03846 probable plasma membrane H+-ATPase - rice...    32   3.0
gi|497242|gb|AAA20601.1| plasma-membrane H+ ATPase                     32   3.0
gi|497240|gb|AAA20600.1| plasma-membrane H+ ATPase                     32   3.0
gi|50284731|ref|XP_444793.1| unnamed protein product [Candida gl...    32   3.9
gi|38176015|gb|AAC68786.2| Hypothetical protein F54D10.6 [Caenor...    32   3.9
gi|17556588|ref|NP_497384.1| cyclin-like F-box and Protein of un...    32   3.9
gi|34856160|ref|XP_218638.2| similar to RIKEN cDNA 4933405K07 [R...    31   5.1
gi|28209917|ref|NP_780861.1| thiol:disulfide interchange protein...    31   5.1
gi|39587355|emb|CAE75009.1| Hypothetical protein CBG22910 [Caeno...    31   6.7
gi|7495580|pir||T19028 hypothetical protein C06H5.1 - Caenorhabd...    31   6.7
gi|46430479|dbj|BAD16686.1| plasma membrane H+-ATPase [Daucus ca...    31   6.7
gi|25290694|pir||T52414 H+-exporting ATPase (EC 3.6.3.6), plasma...    31   6.7
gi|14530343|emb|CAB07161.2| Hypothetical protein C06H5.1 [Caenor...    31   6.7
gi|39582410|emb|CAE74794.1| Hypothetical protein CBG22625 [Caeno...    31   6.7
gi|30692952|ref|NP_190378.2| ATPase, plasma membrane-type, putat...    31   6.7
gi|12230481|sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type ...    31   6.7
gi|17557722|ref|NP_507510.1| predicted CDS, cyclin-like F-box an...    31   6.7
gi|46444705|gb|EAL03978.1| hypothetical protein CaO19.4643 [Cand...    30   8.7
gi|553114|gb|AAA34099.1| plasma membrane H+ ATPase                     30   8.7
gi|46226450|gb|EAK87450.1| B-box zinc finger domain containing p...    30   8.7
gi|39587357|emb|CAE75011.1| Hypothetical protein CBG22913 [Caeno...    30   8.7
gi|46444861|gb|EAL04133.1| hypothetical protein CaO19.12113 [Can...    30   8.7
gi|31580855|dbj|BAC77532.1| plasma membrane H+-ATPase [Sesbania ...    30   8.7
gi|584795|sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 (Proton ...    30   8.7
gi|12697496|emb|CAC28224.1| p-type H+-ATPase [Sesbania rostrata]       30   8.7
gi|12697490|emb|CAC28221.1| p-type H+-ATPase [Sesbania rostrata]       30   8.7
gi|40445321|ref|NP_954781.1| putative thiol-disulfide isomerase ...    30   8.7


>gi|17558110|ref|NP_507437.1| ubiquitin interacting motif (5S5C)
           [Caenorhabditis elegans]
 gi|7496279|pir||T19397 hypothetical protein C18D4.1 -
           Caenorhabditis elegans
 gi|3874463|emb|CAB03907.1| Hypothetical protein C18D4.1
           [Caenorhabditis elegans]
 gi|3878207|emb|CAB04562.1| Hypothetical protein C18D4.1
           [Caenorhabditis elegans]
          Length = 1304

 Score =  130 bits (327), Expect = 6e-30
 Identities = 63/64 (98%), Positives = 63/64 (98%)
 Frame = +3

Query: 180 MENQEFIDVLITDLELLLNEVSDRLDEFNVTFRWCGVXQVDLAHLQNVYDQLTLITSHKK 359
           MENQEFIDVLITDLELLLNEVSDRLDEFNVTFRWCGV QVDLAHLQNVYDQLTLITSHKK
Sbjct: 1   MENQEFIDVLITDLELLLNEVSDRLDEFNVTFRWCGVEQVDLAHLQNVYDQLTLITSHKK 60

Query: 360 INAC 371
           INAC
Sbjct: 61  INAC 64




[DB home][top]