BLASTX 2.2.4 [Aug-26-2002]
Query= 385h2
         (240 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|283477|pir||A42264 membrane-associated calcium-binding protei...    31   7.9


>gi|283477|pir||A42264 membrane-associated calcium-binding protein
           Pfs40 - malaria parasite (Plasmodium falciparum)
          Length = 374

 Score = 30.8 bits (68), Expect = 7.9
 Identities = 15/32 (46%), Positives = 20/32 (61%), Gaps = 3/32 (9%)
 Frame = -2

Query: 89  HPQTSPSQLL---LYIFIYVHISFESLIYGNK 3
           HP  +P QL+   +YI++Y HI F   I GNK
Sbjct: 332 HPNKNPQQLMNYRVYIYLYKHIFFFFNIKGNK 363


  Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
    Posted date:  Aug 11, 2004 12:04 AM
  Number of letters in database: 661,712,633
  Number of sequences in database:  1,967,186

Lambda     K      H
   0.318    0.135    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 204,535,500
Number of Sequences: 1967186
Number of extensions: 2562560
Number of successful extensions: 8207
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7936
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8188
length of database: 661,712,633
effective HSP length: 55
effective length of database: 553,517,403
effective search space used: 13284417672
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

[DB home][top]