Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= 41d10
(360 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|30794584|gb|AAP40519.1| Hypothetical protein T25B6.2b [Caenor... 213 7e-55
gi|17570047|ref|NP_509528.1| neprilysin (88.5 kD) (XJ655) [Caeno... 213 7e-55
gi|39588059|emb|CAE57291.1| Hypothetical protein CBG00200 [Caeno... 199 8e-51
gi|13518042|gb|AAG29103.2| zinc metallopeptidase 1 [Ancylostoma ... 154 4e-37
gi|34577159|gb|AAQ75757.1| zinc metallopeptidase 7 [Ancylostoma ... 148 2e-35
gi|34577157|gb|AAQ75756.1| zinc metallopeptidase 6 [Ancylostoma ... 145 2e-34
gi|3415005|gb|AAC31568.1| putative zinc metallopeptidase [Haemon... 136 9e-32
gi|2905790|gb|AAC03561.1| putative zinc metallopeptidase precurs... 127 7e-29
gi|1483338|emb|CAA99352.1| zinc metallopeptidase [Haemonchus con... 127 7e-29
gi|11078596|gb|AAG29106.1| zinc metallopeptidase 3 MEP3 [Ancylos... 100 1e-20
gi|13359138|dbj|BAB33300.1| neutral endopeptidase 24.11 [Bombyx ... 81 4e-15
gi|25395478|pir||C88099 protein F18A12.8 [imported] - Caenorhabd... 80 1e-14
gi|17533333|ref|NP_494538.1| neprilysin family member (2D712) [C... 80 1e-14
gi|39580402|emb|CAE70962.1| Hypothetical protein CBG17774 [Caeno... 79 2e-14
gi|17564342|ref|NP_506520.1| neprilysin-like zinc metallo-peptid... 77 1e-13
gi|39590003|emb|CAE61001.1| Hypothetical protein CBG04739 [Caeno... 77 1e-13
gi|27733413|gb|AAO21504.1| zinc metalloprotease [Manduca sexta] 76 1e-13
gi|11265773|pir||JC7265 neprilysin (EC 3.4.24.11) II - rat 76 1e-13
gi|11093966|gb|AAG29510.1| zinc metallopeptidase 4 [Ancylostoma ... 76 2e-13
gi|17537801|ref|NP_496490.1| neprilysin-like zinc metallo-peptid... 75 2e-13
gi|39597229|emb|CAE59457.1| Hypothetical protein CBG02837 [Caeno... 75 3e-13
gi|31241693|ref|XP_321277.1| ENSANGP00000008439 [Anopheles gambi... 75 4e-13
gi|7305477|ref|NP_038811.1| mel transforming oncogene-like 1; NE... 74 5e-13
gi|7769083|gb|AAF69247.1| neprilysin-like metallopeptidase 1 [Mu... 74 5e-13
gi|10505364|gb|AAG18448.1| neprilysin-like peptidase gamma [Mus ... 74 5e-13
gi|6467401|gb|AAF13153.1| soluble secreted endopeptidase delta [... 74 5e-13
gi|10505360|gb|AAG18446.1| neprilysin-like peptidase alpha [Mus ... 74 5e-13
gi|17737761|ref|NP_524227.1| CG9761-PA [Drosophila melanogaster]... 74 9e-13
gi|16768064|gb|AAL28251.1| GH14576p [Drosophila melanogaster] 72 3e-12
gi|15991813|ref|NP_258428.1| membrane metallo-endopeptidase-like... 72 3e-12
gi|24650487|ref|NP_733186.1| CG6265-PB [Drosophila melanogaster]... 72 3e-12
gi|17533479|ref|NP_494857.1| endothelin-converting (2F66) [Caeno... 71 6e-12
gi|34365966|gb|AAK31503.2| Hypothetical protein F26G1.6 [Caenorh... 71 6e-12
gi|34872982|ref|XP_233712.2| similar to neprilysin (EC 3.4.24.11... 70 8e-12
gi|7529553|emb|CAB86601.1| xce [Homo sapiens] >gnl|BL_ORD_ID|135... 70 8e-12
gi|31207075|ref|XP_312504.1| ENSANGP00000001161 [Anopheles gambi... 70 1e-11
gi|48097695|ref|XP_393860.1| similar to neutral endopeptidase 24... 69 2e-11
gi|39591154|emb|CAE73207.1| Hypothetical protein CBG20611 [Caeno... 69 2e-11
gi|49072038|ref|XP_400308.1| hypothetical protein UM02693.1 [Ust... 69 2e-11
gi|30794312|ref|NP_851352.1| endothelin converting enzyme 1 [Bos... 67 7e-11
gi|37182964|gb|AAQ89282.1| ECEL1 [Homo sapiens] 67 9e-11
gi|11120734|ref|NP_068544.1| metallopeptidase; damage-induced ne... 67 9e-11
gi|20137989|sp|Q9JMI0|ECEL_MOUSE Endothelin-converting enzyme-li... 67 9e-11
gi|4758232|ref|NP_004817.1| endothelin converting enzyme-like 1;... 67 9e-11
gi|40254536|ref|NP_067281.2| damage-induced neuronal endopeptida... 67 9e-11
gi|45382641|ref|NP_990048.1| endothelin converting enzyme-1 [Gal... 66 2e-10
gi|1169464|sp|P42891|ECE1_BOVIN Endothelin-converting enzyme 1 (... 65 3e-10
gi|688290|gb|AAB32062.1| endothelin converting enzyme; ECE [Bos ... 65 3e-10
gi|2499916|sp|P97739|ECE1_CAVPO Endothelin-converting enzyme 1 (... 65 3e-10
gi|38078992|ref|XP_357400.1| similar to endothelin converting en... 65 4e-10
gi|48102239|ref|XP_395313.1| similar to ENSANGP00000008439 [Apis... 65 4e-10
gi|40556286|ref|NP_955011.1| endothelin converting enzyme 1 [Mus... 65 4e-10
gi|24643425|ref|NP_523417.2| CG9565-PA [Drosophila melanogaster]... 64 6e-10
gi|20177067|gb|AAM12295.1| RE48040p [Drosophila melanogaster] 64 6e-10
gi|3287157|emb|CAA19767.1| dJ329E20.2 (endothelin converting enz... 64 7e-10
gi|45550777|ref|NP_650904.3| CG4058-PA [Drosophila melanogaster]... 64 7e-10
gi|4503443|ref|NP_001388.1| endothelin converting enzyme 1 [Homo... 64 7e-10
gi|47940700|gb|AAH72504.1| Endothelin converting enzyme 1 [Rattu... 64 7e-10
gi|5821116|dbj|BAA83687.1| endothelin-converting enzyme-1c [Homo... 64 7e-10
gi|16758380|ref|NP_446048.1| endothelin converting enzyme 1; End... 64 7e-10
gi|1082351|pir||JC2521 endothelin converting enzyme (EC 3.4.24.-... 64 7e-10
gi|1706564|sp|P42893|ECE1_RAT Endothelin-converting enzyme 1 (EC... 64 7e-10
gi|535182|emb|CAA84548.1| endothelin-converting-enzyme 1 [Homo s... 64 7e-10
gi|45551938|ref|NP_732540.2| CG4058-PB [Drosophila melanogaster]... 64 7e-10
gi|47216526|emb|CAG02177.1| unnamed protein product [Tetraodon n... 64 9e-10
gi|1843531|gb|AAB47750.1| Pex protein [Mus musculus] 63 2e-09
gi|6755050|ref|NP_035207.1| phosphate regulating gene with homol... 63 2e-09
gi|40788300|dbj|BAA25530.2| KIAA0604 protein [Homo sapiens] 62 2e-09
gi|21780271|gb|AAM77664.1| endothelin-converting enzyme-2C [Homo... 62 2e-09
gi|41281433|ref|NP_055508.2| endothelin converting enzyme 2 [Hom... 62 2e-09
gi|3386480|gb|AAC28366.1| neprilysin [Perca flavescens] 62 2e-09
gi|11065940|gb|AAG28399.1| endothelin-converting enzyme 2B [Homo... 62 2e-09
gi|16903015|gb|AAL30387.1| endothelin converting enzyme-2B [Homo... 62 2e-09
gi|37183124|gb|AAQ89362.1| ECE2 [Homo sapiens] 62 2e-09
gi|28302167|gb|AAH46653.1| Ece1-prov protein [Xenopus laevis] 62 4e-09
gi|47207866|emb|CAF91668.1| unnamed protein product [Tetraodon n... 62 4e-09
gi|25290006|pir||D88082 protein T05A8.4 [imported] - Caenorhabdi... 62 4e-09
gi|47229835|emb|CAG07031.1| unnamed protein product [Tetraodon n... 62 4e-09
gi|25148650|ref|NP_494343.2| neprilysin-like zinc metallo-peptid... 62 4e-09
gi|29150238|gb|AAO72359.1| endothelin-converting enzyme 2b-2 [Mu... 61 5e-09
gi|21314840|ref|NP_647454.1| endothelin converting enzyme 2 isof... 61 5e-09
gi|50657408|ref|NP_001002815.1| endothelin-converting enzyme 2 [... 61 5e-09
gi|20893704|ref|XP_155862.1| similar to endothelin-converting en... 61 5e-09
gi|50752564|ref|XP_422833.1| PREDICTED: similar to Neprilysin (N... 61 5e-09
gi|39584653|emb|CAE72406.1| Hypothetical protein CBG19565 [Caeno... 61 5e-09
gi|29150234|gb|AAO72357.1| endothelin-converting enzyme 2a-2 [Mu... 61 5e-09
gi|29150236|gb|AAO72358.1| endothelin-converting enzyme 2b-1 [Mu... 61 5e-09
gi|29150232|gb|AAO72356.1| endothelin-converting enzyme 2a-1 [Mu... 61 5e-09
gi|25245872|gb|AAN73018.1| endothelin-converting enzyme [Locusta... 61 5e-09
gi|6981356|ref|NP_037136.1| phosphate regulating gene with homol... 60 8e-09
gi|50752341|ref|XP_422744.1| PREDICTED: similar to Damage-induce... 60 8e-09
gi|47221126|emb|CAG05447.1| unnamed protein product [Tetraodon n... 60 1e-08
gi|50260040|gb|EAL22703.1| hypothetical protein CNBB1520 [Crypto... 60 1e-08
gi|31207647|ref|XP_312790.1| ENSANGP00000003181 [Anopheles gambi... 60 1e-08
gi|11078593|gb|AAG29105.1| zinc metallopeptidase 2 MEP2 [Ancylos... 60 1e-08
gi|27806649|ref|NP_776471.1| endothelin converting enzyme 2 isof... 59 2e-08
gi|29336087|ref|NP_808871.1| endothelin converting enzyme 2 isof... 59 2e-08
gi|29336085|ref|NP_808872.1| endothelin converting enzyme 2 isof... 59 2e-08
gi|2136744|pir||I46078 endothelin converting enzyme (EC 3.4.24.-... 59 2e-08
gi|29336089|ref|NP_808873.1| endothelin converting enzyme 2 isof... 59 2e-08
gi|17534401|ref|NP_496842.1| zinc metallopeptidase 2 MEP2 precur... 59 3e-08
gi|31233489|ref|XP_318885.1| ENSANGP00000015756 [Anopheles gambi... 59 3e-08
gi|6981210|ref|NP_036740.1| membrane metallo endopeptidase; memb... 59 3e-08
gi|31543255|ref|NP_032630.2| membrane metallo endopeptidase; nep... 59 3e-08
gi|2499915|sp|Q61391|NEP_MOUSE Neprilysin (Neutral endopeptidase... 59 3e-08
gi|45219834|gb|AAH66840.1| Mme protein [Mus musculus] 59 3e-08
gi|34758|emb|CAA30157.1| unnamed protein product [Homo sapiens] 58 4e-08
gi|12084341|pdb|1DMT|A Chain A, Structure Of Human Neutral Endop... 58 4e-08
gi|4505203|ref|NP_000893.1| membrane metallo-endopeptidase; nepr... 58 4e-08
gi|128062|sp|P08473|NEP_HUMAN Neprilysin (Neutral endopeptidase)... 58 4e-08
gi|2499917|sp|P78562|PEX_HUMAN Phosphate regulating neutral endo... 58 4e-08
gi|11093964|gb|AAG29509.1| zinc metallopeptidase 3 [Ancylostoma ... 58 5e-08
gi|11093960|gb|AAG29507.1| zinc metallopeptidase 5 [Ancylostoma ... 58 5e-08
gi|48096703|ref|XP_392502.1| similar to ENSANGP00000015756 [Apis... 58 5e-08
gi|5771408|gb|AAD51382.1| neutral endopeptidase [Aplysia califor... 57 7e-08
gi|48098331|ref|XP_392043.1| similar to endothelin-converting en... 57 7e-08
gi|40254424|ref|NP_000435.2| X-linked phosphate regulating endop... 57 7e-08
gi|67701|pir||HYRBN neprilysin (EC 3.4.24.11) - rabbit 57 9e-08
gi|48099137|ref|XP_394870.1| similar to ENSANGP00000003181 [Apis... 57 9e-08
gi|128064|sp|P08049|NEP_RABIT Neprilysin (Neutral endopeptidase)... 57 9e-08
gi|19568929|gb|AAL91975.1| neprilysin-like protein [Venturia can... 57 1e-07
gi|11093962|gb|AAG29508.1| zinc metallopeptidase 2 [Ancylostoma ... 57 1e-07
gi|24375333|ref|NP_719376.1| peptidase, M13 family [Shewanella o... 55 3e-07
gi|47224958|emb|CAF97373.1| unnamed protein product [Tetraodon n... 55 4e-07
gi|24640050|ref|NP_511056.2| CG5905-PA [Drosophila melanogaster]... 54 6e-07
gi|48097888|ref|XP_393916.1| similar to Ece1-prov protein [Apis ... 54 6e-07
gi|46143595|ref|ZP_00134915.2| COG3590: Predicted metalloendopep... 54 6e-07
gi|11078659|gb|AAG29137.1| zinc metallopeptidase 1 MEP1 [Ancylos... 54 7e-07
gi|50843361|ref|YP_056588.1| metalloprotease (peptidase family M... 54 7e-07
gi|47224807|emb|CAG06377.1| unnamed protein product [Tetraodon n... 54 7e-07
gi|31226455|ref|XP_317711.1| ENSANGP00000010035 [Anopheles gambi... 54 1e-06
gi|17534885|ref|NP_494297.1| endothelin converting family member... 54 1e-06
gi|50729479|ref|XP_416529.1| PREDICTED: similar to Kell protein ... 54 1e-06
gi|7505183|pir||T32020 hypothetical protein K02F6.9 - Caenorhabd... 54 1e-06
gi|21358001|ref|NP_651646.1| CG14526-PA [Drosophila melanogaster... 53 1e-06
gi|34499760|ref|NP_903975.1| probable metallopeptidase [Chromoba... 53 2e-06
gi|49091534|ref|XP_407228.1| hypothetical protein AN3091.2 [Aspe... 53 2e-06
gi|39591284|emb|CAE73337.1| Hypothetical protein CBG20766 [Caeno... 52 2e-06
gi|14211538|ref|NP_115929.1| Kell blood group; Kell protein [Mus... 52 4e-06
gi|48096878|ref|XP_394794.1| similar to ENSANGP00000001161 [Apis... 52 4e-06
gi|17538015|ref|NP_496214.1| neprilysin-like zinc metallo-peptid... 51 5e-06
gi|18478322|gb|AAL73125.1| neutral endopeptidase-like protein [D... 51 5e-06
gi|46111733|ref|XP_382924.1| hypothetical protein FG02748.1 [Gib... 51 5e-06
gi|37619803|emb|CAA88892.3| Hypothetical protein ZK970.1a [Caeno... 51 5e-06
gi|24650889|ref|NP_651645.1| CG14527-PA [Drosophila melanogaster... 51 5e-06
gi|37619802|emb|CAE48845.1| Hypothetical protein ZK970.1b [Caeno... 51 5e-06
gi|7511440|pir||T28132 hypothetical protein ZK970.1 - Caenorhabd... 51 5e-06
gi|50759351|ref|XP_425737.1| PREDICTED: similar to membrane meta... 51 6e-06
gi|21232006|ref|NP_637923.1| metallopeptidase [Xanthomonas campe... 51 6e-06
gi|48095696|ref|XP_394512.1| similar to neprilysin-like peptidas... 50 8e-06
gi|47572442|ref|ZP_00242486.1| COG3590: Predicted metalloendopep... 50 1e-05
gi|39580641|emb|CAE72917.1| Hypothetical protein CBG20236 [Caeno... 50 1e-05
gi|23118060|ref|ZP_00101790.1| COG3590: Predicted metalloendopep... 49 2e-05
gi|46364197|ref|ZP_00226834.1| COG3590: Predicted metalloendopep... 49 3e-05
gi|33151441|ref|NP_872794.1| metallopeptidase [Haemophilus ducre... 49 3e-05
gi|32475678|ref|NP_868672.1| probable zinc metalloproteinase [Pi... 49 3e-05
gi|24583940|ref|NP_609577.1| CG15485-PA [Drosophila melanogaster... 48 4e-05
gi|24372024|ref|NP_716066.1| peptidase, M13 family [Shewanella o... 48 5e-05
gi|39583141|emb|CAE60681.1| Hypothetical protein CBG04334 [Caeno... 47 7e-05
gi|34855598|ref|XP_216130.2| similar to Kell protein [Rattus nor... 47 1e-04
gi|21233100|ref|NP_639017.1| metallopeptidase [Xanthomonas campe... 46 2e-04
gi|38109062|gb|EAA54986.1| hypothetical protein MG06643.4 [Magna... 46 2e-04
gi|17532485|ref|NP_494679.1| endothelin converting enzyme family... 46 2e-04
gi|7497659|pir||T31991 hypothetical protein C49D10.10 - Caenorha... 46 2e-04
gi|21243473|ref|NP_643055.1| metallopeptidase [Xanthomonas axono... 46 2e-04
gi|4469350|gb|AAD21221.1| endothelin converting enzyme-1 [Homo s... 45 3e-04
gi|67702|pir||HYHUK Kell blood group protein (EC 3.4.24.-) - human 45 5e-04
gi|4557691|ref|NP_000411.1| Kell blood group antigen [Homo sapie... 45 5e-04
gi|21243474|ref|NP_643056.1| metallopeptidase [Xanthomonas axono... 44 8e-04
gi|16183012|gb|AAL13611.1| GH14621p [Drosophila melanogaster] 44 8e-04
gi|20129275|ref|NP_609022.1| CG9507-PA [Drosophila melanogaster]... 44 8e-04
gi|32563993|ref|NP_871928.1| neprilysin family member (2D712) [C... 44 0.001
gi|24650765|ref|NP_651603.1| CG5527-PA [Drosophila melanogaster]... 44 0.001
gi|21232005|ref|NP_637922.1| metallopeptidase [Xanthomonas campe... 44 0.001
gi|21232007|ref|NP_637924.1| metallopeptidase [Xanthomonas campe... 43 0.001
gi|42524899|ref|NP_970279.1| metallopeptidase [Bdellovibrio bact... 43 0.001
gi|21243472|ref|NP_643054.1| metallopeptidase [Xanthomonas axono... 43 0.001
gi|17533329|ref|NP_494532.1| neutral endopeptidase 24.11 like fa... 43 0.002
gi|17533319|ref|NP_494537.1| metallopeptidase family member (2D7... 43 0.002
gi|15828409|ref|NP_302672.1| probable zinc metalloprotease [Myco... 42 0.002
gi|25026708|ref|NP_736762.1| putative endopeptidase [Corynebacte... 42 0.003
gi|48095957|ref|XP_394570.1| similar to zinc metalloprotease [Ap... 42 0.004
gi|21231483|ref|NP_637400.1| metallopeptidase [Xanthomonas campe... 42 0.004
gi|48095938|ref|XP_392366.1| similar to PC2-like prohormone conv... 42 0.004
gi|20090849|ref|NP_616924.1| endothelin converting enzyme homolo... 41 0.005
gi|24372085|ref|NP_716127.1| peptidase, M13 family [Shewanella o... 40 0.009
gi|50590145|ref|ZP_00331565.1| COG3590: Predicted metalloendopep... 40 0.009
gi|31195785|ref|XP_306840.1| ENSANGP00000000184 [Anopheles gambi... 40 0.011
gi|17533323|ref|NP_494534.1| endothelin-converting enzyme ECE-1a... 40 0.011
gi|19551404|ref|NP_599406.1| predicted metalloendopeptidase [Cor... 40 0.015
gi|21322918|dbj|BAB97547.1| Predicted metalloendopeptidase [Cory... 40 0.015
gi|48865575|ref|ZP_00319434.1| COG3590: Predicted metalloendopep... 40 0.015
gi|23121016|ref|ZP_00103455.1| COG3590: Predicted metalloendopep... 39 0.019
gi|34540021|ref|NP_904500.1| endopeptidase PepO [Porphyromonas g... 39 0.019
gi|2804580|dbj|BAA24495.1| PepO [Porphyromonas gingivalis] 39 0.025
gi|22995227|ref|ZP_00039707.1| COG3590: Predicted metalloendopep... 39 0.032
gi|28199449|ref|NP_779763.1| metallopeptidase [Xylella fastidios... 39 0.032
gi|15837178|ref|NP_297866.1| metallopeptidase [Xylella fastidios... 39 0.032
gi|24649145|ref|NP_651096.1| CG4725-PA [Drosophila melanogaster]... 38 0.042
gi|48837504|ref|ZP_00294491.1| COG3590: Predicted metalloendopep... 38 0.042
gi|21232141|ref|NP_638058.1| metallopeptidase [Xanthomonas campe... 38 0.042
gi|17544412|ref|NP_503005.1| neutral endopeptidase family member... 38 0.055
gi|21243599|ref|NP_643181.1| metallopeptidase [Xanthomonas axono... 38 0.055
gi|38232779|ref|NP_938546.1| Putative endopeptidase [Corynebacte... 37 0.094
gi|22996373|ref|ZP_00040631.1| COG3590: Predicted metalloendopep... 37 0.094
gi|29349219|ref|NP_812722.1| putative endothelin-converting enzy... 36 0.16
gi|24650885|ref|NP_651643.1| CG14528-PA [Drosophila melanogaster... 36 0.21
gi|21429176|gb|AAM50307.1| RE71324p [Drosophila melanogaster] 36 0.21
gi|24641622|ref|NP_572831.2| CG3775-PA [Drosophila melanogaster]... 35 0.36
gi|15010472|gb|AAK77284.1| GH06227p [Drosophila melanogaster] 35 0.36
gi|17544410|ref|NP_503004.1| endothelin converting enzyme 2 fami... 35 0.47
gi|39580409|emb|CAE70969.1| Hypothetical protein CBG17783 [Caeno... 34 0.61
gi|48852283|ref|ZP_00306472.1| COG3590: Predicted metalloendopep... 34 0.61
gi|24380377|ref|NP_722332.1| putative peptidase [Streptococcus m... 34 0.61
gi|42519194|ref|NP_965124.1| neutral endopeptidase [Lactobacillu... 34 0.80
gi|1334560|emb|CAA38805.1| Dod COII i2 grp IA protein [Podospora... 33 1.0
gi|12408619|ref|NP_074952.1| orf471 [Podospora anserina] 33 1.0
gi|39580407|emb|CAE70967.1| Hypothetical protein CBG17780 [Caeno... 33 1.0
gi|83818|pir||S09140 coII intron protein 2 - Podospora anserina ... 33 1.0
gi|48851549|ref|ZP_00305760.1| COG3590: Predicted metalloendopep... 33 1.0
gi|22538028|ref|NP_688879.1| endopeptidase O [Streptococcus agal... 33 1.4
gi|23023925|ref|ZP_00063153.1| COG3590: Predicted metalloendopep... 33 1.8
gi|48478126|ref|YP_023832.1| zinc metalloprotease [Picrophilus t... 32 3.0
gi|23002216|ref|ZP_00045894.1| COG3590: Predicted metalloendopep... 32 3.0
gi|15675851|ref|NP_270025.1| putative endopeptidase O [Streptoco... 32 3.0
gi|19746966|ref|NP_608102.1| putative endopeptidase O [Streptoco... 32 3.0
gi|28570190|ref|NP_788269.1| Na+ dependent glucose transporter 1... 31 5.2
gi|20858407|ref|XP_125582.1| RIKEN cDNA 2010001E11 [Mus musculus] 31 5.2
gi|34852874|ref|XP_228270.2| similar to KIAA1919 protein [Rattus... 31 5.2
gi|34852872|ref|XP_228271.2| similar to Na+ dependent glucose tr... 31 5.2
gi|48826034|ref|ZP_00287262.1| COG3590: Predicted metalloendopep... 31 5.2
gi|21450199|ref|NP_659070.1| expressed sequence AI317395 [Mus mu... 31 5.2
gi|33417000|gb|AAH55789.1| E130309B19Rik protein [Mus musculus] 31 6.8
gi|39930383|ref|NP_064447.1| BarH-like 2; BarH (Drosophila)-like... 31 6.8
gi|12621136|ref|NP_075245.1| BarH-class homeodomain transcriptio... 31 6.8
gi|28519039|ref|XP_144466.2| similar to BarH-class homeodomain t... 31 6.8
gi|28379770|ref|NP_786662.1| endopeptidase PepO [Lactobacillus p... 31 6.8
gi|18478358|gb|AAL73136.1| endopeptidase O2 [Lactobacillus helve... 31 6.8
gi|8216980|emb|CAB92440.1| BarHl2 protein [Homo sapiens] 31 6.8
gi|48870186|ref|ZP_00322914.1| COG3590: Predicted metalloendopep... 31 6.8
>gi|30794584|gb|AAP40519.1| Hypothetical protein T25B6.2b
[Caenorhabditis elegans]
Length = 606
Score = 213 bits (542), Expect = 7e-55
Identities = 97/107 (90%), Positives = 98/107 (90%)
Frame = -2
Query: 359 GGXQXAYRSYSQXVATTREGVEEDRLPGLENYTPNQIFWITYGYSWCMKQSDANLVHQLL 180
GG Q AYRSY Q VATTR+GVEEDRLPGLENYTPNQIFWITYGYSWCMKQSDANLVHQLL
Sbjct: 500 GGQQAAYRSYRQYVATTRKGVEEDRLPGLENYTPNQIFWITYGYSWCMKQSDANLVHQLL 559
Query: 179 TXPHSPXQCRTXQVMQDIPEFGXDFGCVRGSPMYPEPSXRCKVWVGQ 39
T PHSP QCRT QVMQDIPEFG DFGCVRGSPMYPEPS RCKVWVGQ
Sbjct: 560 TNPHSPAQCRTNQVMQDIPEFGKDFGCVRGSPMYPEPSGRCKVWVGQ 606
>gi|17570047|ref|NP_509528.1| neprilysin (88.5 kD) (XJ655)
[Caenorhabditis elegans]
gi|7508414|pir||T28906 hypothetical protein T25B6.2 - Caenorhabditis
elegans
gi|2914127|gb|AAC48223.1| Hypothetical protein T25B6.2a
[Caenorhabditis elegans]
Length = 798
Score = 213 bits (542), Expect = 7e-55
Identities = 97/107 (90%), Positives = 98/107 (90%)
Frame = -2
Query: 359 GGXQXAYRSYSQXVATTREGVEEDRLPGLENYTPNQIFWITYGYSWCMKQSDANLVHQLL 180
GG Q AYRSY Q VATTR+GVEEDRLPGLENYTPNQIFWITYGYSWCMKQSDANLVHQLL
Sbjct: 692 GGQQAAYRSYRQYVATTRKGVEEDRLPGLENYTPNQIFWITYGYSWCMKQSDANLVHQLL 751
Query: 179 TXPHSPXQCRTXQVMQDIPEFGXDFGCVRGSPMYPEPSXRCKVWVGQ 39
T PHSP QCRT QVMQDIPEFG DFGCVRGSPMYPEPS RCKVWVGQ
Sbjct: 752 TNPHSPAQCRTNQVMQDIPEFGKDFGCVRGSPMYPEPSGRCKVWVGQ 798