Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= 4R79_1
(389 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539758|ref|NP_503119.1| glucocerebrosidase (4S421) [Caenorh... 264 3e-70
gi|17539756|ref|NP_503118.1| glucocerebrosidase (59.1 kD) (4S421... 247 4e-65
gi|39585225|emb|CAE57468.1| Hypothetical protein CBG00434 [Caeno... 245 2e-64
gi|30585263|gb|AAP36904.1| Homo sapiens glucosidase, beta; acid ... 122 2e-27
gi|183022|gb|AAA35877.1| lysosomal glucocerebrosidase precursor ... 122 2e-27
gi|183012|gb|AAC63056.1| glucocerebrosidase [Homo sapiens] >gnl|... 122 2e-27
gi|38503165|sp|Q9BDT0|GLCM_PANTR Glucosylceramidase precursor (B... 122 2e-27
gi|33357737|pdb|1OGS|A Chain A, Human Acid-Beta-Glucosidase >gnl... 121 4e-27
gi|183008|gb|AAA35873.1| glucocerebrosidase precursor (5' end pu... 121 4e-27
gi|2144479|pir||EUHUGC glucosylceramidase (EC 3.2.1.45) precurso... 121 4e-27
gi|4503935|ref|NP_000148.1| glucosidase, beta; acid (includes gl... 121 4e-27
gi|6679955|ref|NP_032120.1| glucosidase, beta, acid; acid beta g... 120 5e-27
gi|34787133|emb|CAE06498.1| putative lysosomal glucocerebrosidas... 119 2e-26
gi|45551953|ref|NP_732892.2| CG31414-PA [Drosophila melanogaster... 116 9e-26
gi|21355305|ref|NP_651172.1| CG31148-PA [Drosophila melanogaster... 113 8e-25
gi|25151335|ref|NP_741501.1| glucocerebrosidase (4S421) [Caenorh... 105 3e-22
gi|48118835|ref|XP_393207.1| similar to Glucosylceramidase precu... 104 5e-22
gi|31242033|ref|XP_321447.1| ENSANGP00000022145 [Anopheles gambi... 99 2e-20
gi|48118838|ref|XP_393208.1| similar to glucocerebrosidase famil... 96 2e-19
gi|47225360|emb|CAG11843.1| unnamed protein product [Tetraodon n... 96 2e-19
gi|13346476|gb|AAK19754.1| beta-glucosidase/xylosidase [Phytopht... 94 8e-19
gi|17542884|ref|NP_500785.1| glucocerebrosidase family member (5... 91 7e-18
gi|7510067|pir||T34017 hypothetical protein Y4C6B.6 - Caenorhabd... 91 7e-18
gi|39588375|emb|CAE72726.1| Hypothetical protein CBG19964 [Caeno... 88 4e-17
gi|553300|gb|AAA35876.1| D-glucosyl-N-acylsphingosine glucohydro... 85 3e-16
gi|7496897|pir||T31964 hypothetical protein C33C12.3 - Caenorhab... 82 3e-15
gi|17532261|ref|NP_494207.1| glucocerebrosidase precursor family... 82 3e-15
gi|39580499|emb|CAE70469.1| Hypothetical protein CBG17056 [Caeno... 80 1e-14
gi|17532271|ref|NP_494208.1| glucocerebrosidase family member (2... 79 3e-14
gi|39580494|emb|CAE70464.1| Hypothetical protein CBG17050 [Caeno... 78 4e-14
gi|21230535|ref|NP_636452.1| glycosyl hydrolase [Xanthomonas cam... 77 8e-14
gi|33875338|gb|AAH00349.2| GBA protein [Homo sapiens] 75 3e-13
gi|42656121|ref|XP_375810.1| similar to glucocerebrosidase [Homo... 75 3e-13
gi|21241930|ref|NP_641512.1| glycosyl hydrolase [Xanthomonas axo... 69 2e-11
gi|20808714|ref|NP_623885.1| O-Glycosyl hydrolase family 30 [The... 67 6e-11
gi|16767672|ref|NP_463287.1| lysosomal glucosyl ceramidase-like ... 61 4e-09
gi|20808715|ref|NP_623886.1| O-Glycosyl hydrolase family 30 [The... 44 0.001
gi|16126001|ref|NP_420565.1| glycosyl hydrolase, family 30 [Caul... 42 0.002
gi|29348721|ref|NP_812224.1| glucosylceramidase precursor [Bacte... 41 0.005
gi|48862316|ref|ZP_00316213.1| COG5520: O-Glycosyl hydrolase [Mi... 36 0.15
gi|16125583|ref|NP_420147.1| electrotransfer ubiquinone oxidored... 34 0.59
gi|2136964|pir||I46489 cysteine-rich hair keratin associated pro... 34 0.77
gi|18401167|ref|NP_566551.1| DegP protease, putative [Arabidopsi... 33 1.3
gi|9279653|dbj|BAB01153.1| unnamed protein product [Arabidopsis ... 33 1.7
gi|13386164|ref|NP_081083.1| RIKEN cDNA 1110033F04 [Mus musculus... 32 2.2
gi|36958739|gb|AAQ87207.1| Electron transfer flavoprotein-ubiqui... 32 2.9
gi|23024523|ref|ZP_00063731.1| COG0366: Glycosidases [Leuconosto... 32 2.9
gi|15964786|ref|NP_385139.1| PROBABLE ELECTRON TRANSFER FLAVOPRO... 32 2.9
gi|15888337|ref|NP_354018.1| AGR_C_1825p [Agrobacterium tumefaci... 32 2.9
gi|20913093|ref|XP_147602.1| RIKEN cDNA 1110054P19 [Mus musculus] 32 2.9
gi|13386198|ref|NP_081363.1| RIKEN cDNA 2300006N05 [Mus musculus... 32 2.9
gi|50755687|ref|XP_414854.1| PREDICTED: similar to polycystin 1;... 32 3.8
gi|18076084|emb|CAC80492.1| P2 protein [Hypocrea lixii] 31 5.0
gi|23119224|ref|ZP_00102399.1| COG1114: Branched-chain amino aci... 31 6.5
gi|13476354|ref|NP_107924.1| two component histidine sensor kina... 30 8.5
gi|25411795|pir||G84552 probable retroelement pol polyprotein [i... 30 8.5
gi|21539647|ref|NP_083889.1| RIKEN cDNA 2310037K05 [Mus musculus... 30 8.5
gi|16118225|ref|NP_149445.2| keratin associated protein 4-5; ker... 30 8.5
>gi|17539758|ref|NP_503119.1| glucocerebrosidase (4S421)
[Caenorhabditis elegans]
gi|7435492|pir||T18583 glucosylceramidase (EC 3.2.1.45) precursor -
Caenorhabditis elegans
gi|3924673|emb|CAA20283.1| Hypothetical protein F11E6.1a
[Caenorhabditis elegans]
gi|3924727|emb|CAB02924.1| Hypothetical protein F11E6.1a
[Caenorhabditis elegans]
Length = 522
Score = 264 bits (675), Expect = 3e-70
Identities = 128/128 (100%), Positives = 128/128 (100%)
Frame = +3
Query: 3 NHHVTGWTDWNLCLDETGGPNWAYNVVDSPIIVNRTAQEFYKQPMFYALGHFSKFLPRGS 182
NHHVTGWTDWNLCLDETGGPNWAYNVVDSPIIVNRTAQEFYKQPMFYALGHFSKFLPRGS
Sbjct: 395 NHHVTGWTDWNLCLDETGGPNWAYNVVDSPIIVNRTAQEFYKQPMFYALGHFSKFLPRGS 454
Query: 183 TRVFTKIEGNLAVSATSVVIEGGRRATVILSKASNSLLTRIVDSSTGFSIVLNLPPRSIH 362
TRVFTKIEGNLAVSATSVVIEGGRRATVILSKASNSLLTRIVDSSTGFSIVLNLPPRSIH
Sbjct: 455 TRVFTKIEGNLAVSATSVVIEGGRRATVILSKASNSLLTRIVDSSTGFSIVLNLPPRSIH 514
Query: 363 TVIWKKRK 386
TVIWKKRK
Sbjct: 515 TVIWKKRK 522