Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= B0222_8
(885 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17557278|ref|NP_505375.1| COLlagen structural gene (28.8 kD) ... 260 2e-68
gi|39594543|emb|CAE72121.1| Hypothetical protein CBG19217 [Caeno... 248 1e-64
gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [... 240 3e-62
gi|17540620|ref|NP_502115.1| COLlagen structural gene (col-126) ... 237 2e-61
gi|17540622|ref|NP_502116.1| predicted CDS, COLlagen structural ... 237 2e-61
gi|39593742|emb|CAE62035.1| Hypothetical protein CBG06051 [Caeno... 236 5e-61
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno... 234 1e-60
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ... 232 9e-60
gi|39590997|emb|CAE58777.1| Hypothetical protein CBG01972 [Caeno... 180 3e-44
gi|17570601|ref|NP_509692.1| COLlagen structural gene (28.7 kD) ... 180 4e-44
gi|7494765|pir||T29837 hypothetical protein B0222.6 - Caenorhabd... 174 3e-42
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno... 172 7e-42
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ... 171 2e-41
gi|17557220|ref|NP_505647.1| COLlagen structural gene (col-150) ... 153 4e-36
gi|39593314|emb|CAE64784.1| Hypothetical protein CBG09577 [Caeno... 150 3e-35
gi|17557828|ref|NP_505635.1| COLlagen structural gene (col-148) ... 143 6e-33
gi|17557218|ref|NP_505646.1| COLlagen structural gene (30.6 kD) ... 143 6e-33
gi|39593313|emb|CAE64783.1| Hypothetical protein CBG09576 [Caeno... 141 2e-32
gi|39583705|emb|CAE63809.1| Hypothetical protein CBG08355 [Caeno... 131 2e-29
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno... 127 4e-28
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder... 108 1e-22
gi|39582788|emb|CAE74251.1| Hypothetical protein CBG21938 [Caeno... 105 1e-21
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder... 101 3e-20
gi|17505428|ref|NP_492035.1| COLlagen structural gene (col-61) [... 99 1e-19
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida] 97 6e-19
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita] 93 7e-18
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (... 87 5e-16
gi|17542298|ref|NP_501532.1| COLlagen structural gene (col-118) ... 80 5e-14
gi|687634|gb|AAA62504.1| collagen 75 3e-12
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 73 1e-11
gi|39589826|emb|CAE67061.1| Hypothetical protein CBG12469 [Caeno... 72 1e-11
gi|39593739|emb|CAE62032.1| Hypothetical protein CBG06046 [Caeno... 61 3e-08
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 57 5e-07
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 53 1e-05
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 52 1e-05
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 52 2e-05
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 52 2e-05
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 52 2e-05
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ... 51 3e-05
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno... 51 4e-05
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand... 51 4e-05
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand... 51 4e-05
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 50 5e-05
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno... 49 1e-04
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 47 7e-04
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 47 7e-04
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 46 0.001
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 46 0.001
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 46 0.001
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 46 0.001
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ... 45 0.002
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 45 0.002
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 45 0.002
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd... 45 0.002
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 44 0.004
gi|48870343|ref|ZP_00323067.1| COG4932: Predicted outer membrane... 44 0.005
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno... 44 0.005
gi|786136|gb|AAA99499.1| polymorphic immunodominant molecule 44 0.006
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 44 0.006
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 44 0.006
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno... 44 0.006
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 43 0.008
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 43 0.011
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ... 42 0.014
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 42 0.014
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno... 42 0.014
gi|39596361|emb|CAE69999.1| Hypothetical protein CBG16406 [Caeno... 42 0.014
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 42 0.014
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri... 42 0.018
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >... 42 0.018
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 42 0.018
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno... 42 0.018
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ... 42 0.024
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 41 0.040
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis] 41 0.040
gi|49121568|ref|XP_412424.1| hypothetical protein AN8287.2 [Aspe... 41 0.040
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno... 41 0.040
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno... 41 0.040
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 40 0.053
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ... 40 0.053
gi|11467826|ref|NP_050877.1| hypothetical chloroplast RF2 [Nephr... 40 0.053
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 40 0.053
gi|50306211|ref|XP_453068.1| unnamed protein product [Kluyveromy... 40 0.053
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 40 0.053
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 40 0.069
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 40 0.069
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha... 40 0.069
gi|42660863|ref|XP_064152.5| sarcalumenin [Homo sapiens] 40 0.090
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 40 0.090
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 40 0.090
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 40 0.090
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec... 39 0.12
gi|14718306|gb|AAK72884.1| hypothetical protein [Oryza sativa] 39 0.20
gi|37680163|ref|NP_934772.1| hypothetical protein VV1979 [Vibrio... 39 0.20
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ... 39 0.20
gi|34897110|ref|NP_909901.1| hypothetical protein [Oryza sativa ... 39 0.20
gi|49092454|ref|XP_407688.1| hypothetical protein AN3551.2 [Aspe... 39 0.20
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA... 38 0.26
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 38 0.26
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ... 38 0.26
gi|46123749|ref|XP_386428.1| hypothetical protein FG06252.1 [Gib... 38 0.26
gi|46442947|gb|EAL02232.1| hypothetical protein CaO19.8420 [Cand... 38 0.26
gi|39979119|emb|CAE85494.1| putative protein [Neurospora crassa] 38 0.26
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 38 0.26
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 31 0.33
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 38 0.34
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 38 0.34
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 38 0.34
gi|23508380|ref|NP_701049.1| hypothetical protein [Plasmodium fa... 38 0.34
gi|19112576|ref|NP_595784.1| hypothetical coiled-coil protein [S... 37 0.45
gi|22324231|emb|CAD44395.1| hypothetical protein [Enterococcus f... 37 0.45
gi|39594923|emb|CAE70791.1| Hypothetical protein CBG17547 [Caeno... 37 0.45
gi|50286801|ref|XP_445830.1| unnamed protein product [Candida gl... 37 0.45
gi|48824054|ref|ZP_00285484.1| hypothetical protein Efae03002600... 37 0.45
gi|32421759|ref|XP_331323.1| hypothetical protein [Neurospora cr... 37 0.45
gi|18495789|emb|CAC87892.1| surface protein [Theileria annulata] 37 0.58
gi|755081|gb|AAB00073.1| schizont/sporozoite surface protein >gn... 37 0.58
gi|46125761|ref|XP_387434.1| hypothetical protein FG07258.1 [Gib... 37 0.58
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 37 0.58
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno... 37 0.76
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 37 0.76
gi|19923672|ref|NP_036922.2| dentin sailophosphoprotein; Dentin ... 36 0.99
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 36 0.99
gi|50546519|ref|XP_500729.1| hypothetical protein [Yarrowia lipo... 36 0.99
gi|34864360|ref|XP_217193.2| similar to senescence downregulated... 36 0.99
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno... 36 0.99
gi|23612979|ref|NP_704518.1| hypothetical protein [Plasmodium fa... 36 0.99
gi|42783920|ref|NP_981167.1| spore germination protein GerHA [Ba... 36 0.99
gi|17566482|ref|NP_507901.1| plasmodium falciparum trophozoite a... 36 0.99
gi|79960|pir||JH0204 hypothetical 30.5K protein precursor - Ente... 36 0.99
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno... 36 0.99
gi|34327950|dbj|BAA20761.2| KIAA0301 [Homo sapiens] 36 1.3
gi|46431600|gb|EAK91144.1| hypothetical protein CaO19.5198 [Cand... 36 1.3
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g... 36 1.3
gi|24415404|ref|NP_055426.1| MDN1, midasin homolog [Homo sapiens... 36 1.3
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 36 1.3
gi|50545265|ref|XP_500170.1| hypothetical protein [Yarrowia lipo... 36 1.3
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 36 1.3
gi|18495763|emb|CAC87579.1| surface protein [Theileria annulata] 36 1.3
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm... 35 1.7
gi|24654027|ref|NP_725526.1| CG8421-PD [Drosophila melanogaster]... 35 1.7
gi|16768468|gb|AAL28453.1| GM05229p [Drosophila melanogaster] 35 1.7
gi|24654024|ref|NP_725525.1| CG8421-PA [Drosophila melanogaster]... 35 1.7
gi|17647175|ref|NP_523757.1| CG8421-PB [Drosophila melanogaster]... 35 1.7
gi|27503844|gb|AAH42232.1| MGC52607 protein [Xenopus laevis] 35 1.7
gi|104205|pir||S17196 transcription factor UBF2 - African clawed... 35 1.7
gi|32422567|ref|XP_331727.1| hypothetical protein [Neurospora cr... 35 1.7
gi|65265|emb|CAA42523.1| a xenopus upstream binding factor [Xeno... 35 1.7
gi|18495767|emb|CAC87581.1| SP protein [Theileria annulata] 35 1.7
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [... 35 1.7
gi|17865451|sp|Q62598|DSPP_RAT Dentin sialophosphoprotein precur... 35 1.7
gi|17550712|ref|NP_510630.1| COLlagen structural gene (col-187) ... 35 1.7
gi|46440896|gb|EAL00197.1| hypothetical protein CaO19.5530 [Cand... 35 1.7
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 35 1.7
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo... 35 1.7
gi|42519751|ref|NP_965681.1| hypothetical protein LJ0574 [Lactob... 35 1.7
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna... 35 1.7
gi|23396860|sp|P70663|SPL1_MOUSE SPARC-like protein 1 precursor ... 35 1.7
gi|31982800|ref|NP_034227.2| SPARC-like 1 (mast9, hevin); extrac... 35 1.7
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 35 1.7
gi|12407623|gb|AAG53596.1| differentially expressed nucleolar TG... 35 2.2
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 35 2.2
gi|26251191|ref|NP_757231.1| Hypothetical protein [Escherichia c... 35 2.2
gi|24654914|ref|NP_728554.1| CG32479-PA [Drosophila melanogaster... 35 2.2
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 35 2.2
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (... 35 2.2
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 35 2.2
gi|16264658|ref|NP_437450.1| hypothetical exported glutamine-ric... 35 2.2
gi|23481077|gb|EAA17463.1| Leishmania major ppg3 [Plasmodium yoe... 35 2.2
gi|33303426|gb|AAQ02289.1| dentin matrix protein 1 [Xenomys nels... 35 2.2
gi|15235717|ref|NP_195495.1| expressed protein [Arabidopsis thal... 35 2.2
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 35 2.2
gi|3970876|dbj|BAA34802.1| HRIHFB2216 [Homo sapiens] 35 2.2
gi|28377801|ref|NP_784693.1| lipoprotein precursor [Lactobacillu... 35 2.2
gi|538593|pir||A45596 trypomastigote-specific surface antigen pr... 35 2.2
gi|84059|pir||A24154 85K major surface antigen - Trypanosoma cru... 35 2.2
gi|23491461|gb|EAA22989.1| hypothetical protein [Plasmodium yoel... 35 2.2
gi|16306757|gb|AAH01566.1| Unknown (protein for IMAGE:3451980) [... 35 2.2
gi|26000384|gb|AAN75474.1| dentin matrix protein 1 [Pteronotus p... 35 2.2
gi|17542824|ref|NP_501756.1| COLlagen structural gene (col-123) ... 35 2.2
gi|1522691|gb|AAC52774.1| dentin phosphoprotein precursor 35 2.2
gi|11545835|ref|NP_071400.1| cutaneous T-cell lymphoma-associate... 35 2.2
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno... 35 2.2
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 35 2.2
gi|26247122|ref|NP_753162.1| Hypothetical protein [Escherichia c... 35 2.2
gi|32422107|ref|XP_331497.1| predicted protein [Neurospora crass... 35 2.2
gi|37676035|ref|NP_936431.1| TPR repeat containing protein [Vibr... 35 2.2
gi|1498641|gb|AAB06444.1| extracellular matrix associated protei... 35 2.2
gi|27367908|ref|NP_763435.1| TPR repeat containing protein [Vibr... 35 2.2
gi|39586987|emb|CAE62922.1| Hypothetical protein CBG07120 [Caeno... 35 2.9
gi|18495753|emb|CAC87574.1| surface protein [Theileria annulata] 35 2.9
gi|39595235|emb|CAE60272.1| Hypothetical protein CBG03851 [Caeno... 35 2.9
gi|9507649|ref|NP_052980.1| coupling protein TraD [Plasmid R100]... 35 2.9
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ... 35 2.9
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 35 2.9
gi|30910887|gb|AAP37002.1| surface protein [Theileria lestoquardi] 35 2.9
gi|18495769|emb|CAC87570.1| surface protein [Theileria annulata] 35 2.9
gi|18495765|emb|CAC87580.1| surface protein [Theileria annulata]... 35 2.9
gi|46444759|gb|EAL04032.1| hypothetical protein CaO19.4697 [Cand... 35 2.9
gi|34881305|ref|XP_228502.2| similar to hypothetical protein FLJ... 35 2.9
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 35 2.9
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 35 2.9
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 35 2.9
gi|47219357|emb|CAG10986.1| unnamed protein product [Tetraodon n... 35 2.9
gi|26000388|gb|AAN75484.1| dentin matrix protein 1 [Plecotus tow... 35 2.9
gi|18495761|emb|CAC87578.1| surface protein [Theileria annulata] 35 2.9
gi|18495779|emb|CAC87478.1| surface protein [Theileria annulata] 35 2.9
gi|24645646|ref|NP_649988.1| CG3996-PA [Drosophila melanogaster]... 35 2.9
gi|46444915|gb|EAL04187.1| hypothetical protein CaO19.12167 [Can... 35 2.9
gi|18495757|emb|CAC87576.1| surface protein [Theileria annulata] 35 2.9
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot... 35 2.9
gi|46433489|gb|EAK92927.1| hypothetical protein CaO19.13986 [Can... 35 2.9
gi|49237347|ref|YP_031628.1| unknown [Frog virus 3] >gnl|BL_ORD_... 35 2.9
gi|28829810|gb|AAO52312.1| similar to Dictyostelium discoideum (... 35 2.9
gi|7512088|pir||T30282 calcium-binding protein - sea urchin (Str... 34 3.8
gi|422259|pir||B46203 mating type A alpha 3 Z3 polypeptide - bra... 34 3.8
gi|7271901|gb|AAF44681.1| collagen IV a1 chain [Gallus gallus] 34 3.8
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 34 3.8
gi|23308603|ref|NP_056275.1| myosin VIIA and Rab interacting pro... 34 3.8
gi|25009677|gb|AAN71015.1| AT02321p [Drosophila melanogaster] 34 3.8
gi|21221416|ref|NP_627195.1| putative secreted protein [Streptom... 34 3.8
gi|50292711|ref|XP_448788.1| unnamed protein product [Candida gl... 34 3.8
gi|46441019|gb|EAL00319.1| hypothetical protein CaO19.12976 [Can... 34 3.8
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 34 3.8
gi|50730534|ref|XP_416951.1| PREDICTED: similar to collagen IV a... 34 3.8
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 34 3.8
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 34 3.8
gi|585459|sp|P37937|MAZ3_SCHCO Mating-type protein A-alpha Z3 >g... 34 3.8
gi|39581822|emb|CAE60715.1| Hypothetical protein CBG04386 [Caeno... 34 3.8
gi|49087804|ref|XP_405797.1| hypothetical protein AN1660.2 [Aspe... 34 3.8
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil... 34 3.8
gi|1223914|gb|AAB47214.1| endo16 [Strongylocentrotus purpuratus] 34 3.8
gi|26000366|gb|AAN75481.1| dentin matrix protein 1 [Desmodus rot... 34 4.9
gi|31213353|ref|XP_315620.1| ENSANGP00000017827 [Anopheles gambi... 34 4.9
gi|18495791|emb|CAC87893.1| surface protein [Theileria annulata] 34 4.9
gi|49483044|ref|YP_040268.1| clumping factor [Staphylococcus aur... 34 4.9
gi|33303420|gb|AAQ02286.1| dentin matrix protein 1 [Neotoma albi... 34 4.9
gi|33303422|gb|AAQ02287.1| dentin matrix protein 1 [Neotoma cine... 34 4.9
gi|19921992|ref|NP_610608.1| CG12340-PA [Drosophila melanogaster... 34 4.9
gi|462434|sp|P34099|KAPC_DICDI cAMP-dependent protein kinase cat... 34 4.9
gi|241277|gb|AAB20716.1| serine/threonine protein kinase [Dictyo... 34 4.9
gi|46916933|emb|CAG23696.1| conserved hypothetical protein [Phot... 34 4.9
gi|50551869|ref|XP_503409.1| hypothetical protein [Yarrowia lipo... 34 4.9
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno... 34 4.9
gi|18495771|emb|CAC87571.1| surface protein [Theileria annulata]... 34 4.9
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 34 4.9
gi|16445033|ref|NP_443189.1| ACRC protein; putative nuclear prot... 34 4.9
gi|16078410|ref|NP_389229.1| ykrI [Bacillus subtilis subsp. subt... 34 4.9
gi|47223062|emb|CAG07149.1| unnamed protein product [Tetraodon n... 34 4.9
gi|24664419|ref|NP_648738.1| CG13461-PA [Drosophila melanogaster... 34 4.9
gi|49484827|ref|YP_042051.1| fibrinogen and keratin-10 binding s... 34 4.9
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 34 4.9
gi|38374134|gb|AAR19270.1| latent membrane protein 1 [Human herp... 34 4.9
gi|34860163|ref|XP_219354.2| similar to RIKEN cDNA 9330199A09 ge... 34 4.9
gi|46116384|ref|XP_384210.1| hypothetical protein FG04034.1 [Gib... 34 4.9
gi|28377133|ref|NP_784025.1| cell surface protein precursor [Lac... 33 6.4
gi|8101005|gb|AAF72509.1| putative cell-surface adhesin SdrF [St... 33 6.4
gi|34879634|ref|XP_214400.2| similar to collagen alpha 1(IV) cha... 33 6.4
gi|50260382|gb|EAL23041.1| hypothetical protein CNBA8080 [Crypto... 33 6.4
gi|225874|prf||1402236A collagen alpha1(IV) 33 6.4
gi|27371263|gb|AAH41238.1| Mfap2-prov protein [Xenopus laevis] 33 6.4
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi... 33 6.4
gi|12314281|emb|CAC13153.1| bA472K17.2 (collagen type IV alpha 1... 33 6.4
gi|44885910|dbj|BAD12056.1| low molecular weight glutenin subuni... 33 6.4
gi|29134971|ref|NP_803601.1| ORF035 [Pseudomonas phage phiKZ] >g... 33 6.4
gi|46321517|ref|ZP_00221893.1| hypothetical protein Bucepa020033... 33 6.4
gi|27469313|ref|NP_765950.1| Ser-Asp rich fibrinogen-binding,bon... 33 6.4
gi|30067|emb|CAA29075.1| unnamed protein product [Homo sapiens] 33 6.4
gi|29549|emb|CAA68698.1| unnamed protein product [Homo sapiens] 33 6.4
gi|46109630|ref|XP_381873.1| hypothetical protein FG01697.1 [Gib... 33 6.4
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [... 33 6.4
gi|50308177|ref|XP_454089.1| unnamed protein product [Kluyveromy... 33 6.4
gi|7656985|ref|NP_001836.1| alpha 1 type IV collagen preproprote... 33 6.4
gi|32419593|ref|XP_330240.1| predicted protein [Neurospora crass... 33 6.4
gi|33859528|ref|NP_034061.1| procollagen, type IV, alpha 1 [Mus ... 33 6.4
gi|14388513|dbj|BAB60783.1| hypothetical protein [Macaca fascicu... 33 6.4
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ... 33 6.4
gi|13365913|dbj|BAB39330.1| hypothetical protein [Macaca fascicu... 33 6.4
gi|49482791|ref|YP_040015.1| putative surface anchored protein [... 33 6.4
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 33 6.4
gi|49117309|gb|AAH72650.1| Col4a1 protein [Mus musculus] 33 6.4
gi|23509223|ref|NP_701891.1| erythrocyte membrane protein 1 (PfE... 33 6.4
gi|8132107|gb|AAF73220.1| glutamine/glutamic acid-rich protein B... 33 8.4
gi|7470965|pir||T28679 fibrinogen-binding protein homolog - Stap... 33 8.4
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 33 8.4
gi|22026916|ref|NP_611592.2| CG10080-PA [Drosophila melanogaster... 33 8.4
gi|33303424|gb|AAQ02288.1| dentin matrix protein 1 [Neotoma mexi... 33 8.4
gi|50801766|ref|XP_424186.1| PREDICTED: similar to hTGN48 [Gallu... 33 8.4
gi|49901196|gb|AAH76308.1| Unknown (protein for IMAGE:7116684) [... 33 8.4
gi|22779206|dbj|BAC15555.1| Slp homologue lacking C2 domains-c [... 33 8.4
gi|46440639|gb|EAK99943.1| hypothetical protein CaO19.6260 [Cand... 33 8.4
gi|39580382|emb|CAE71742.1| Hypothetical protein CBG18726 [Caeno... 33 8.4
gi|46437429|gb|EAK96776.1| hypothetical protein CaO19.2859 [Cand... 33 8.4
gi|32414429|ref|XP_327694.1| hypothetical protein ( (AF361225) 6... 33 8.4
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno... 33 8.4
gi|2133752|pir||S65687 (A+T)-stretch-binding protein - flesh fly... 33 8.4
gi|283629|pir||S27770 hypothetical protein 1 - African malaria m... 33 8.4
gi|50289021|ref|XP_446940.1| unnamed protein product [Candida gl... 33 8.4
gi|628967|pir||S45091 hypothetical protein iota - Streptococcus ... 33 8.4
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 33 8.4
>gi|17557278|ref|NP_505375.1| COLlagen structural gene (28.8 kD)
(col-145) [Caenorhabditis elegans]
gi|7494766|pir||T29838 hypothetical protein B0222.7 -
Caenorhabditis elegans
gi|1226315|gb|AAA92324.1| Collagen protein 145 [Caenorhabditis
elegans]
Length = 294
Score = 260 bits (665), Expect = 2e-68
Identities = 158/294 (53%), Positives = 158/294 (53%)
Frame = -1
Query: 885 MEKILVTFSTGAASIAVLAVLFTVPSLYNTINEVHDQVLDGVSVFRVETDSAWTEMMDIQ 706
MEKILVTFSTGAASIAVLAVLFTVPSLYNTINEVHDQVLDGVSVFRVETDSAWTEMMDIQ
Sbjct: 1 MEKILVTFSTGAASIAVLAVLFTVPSLYNTINEVHDQVLDGVSVFRVETDSAWTEMMDIQ 60
Query: 705 ITVTPPTKPRVNPFNSVFRQKRQTFSGLPAWCQCEXXXXXXXXXXXXXXXXXXXXXXXXX 526
ITVTPPTKPRVNPFNSVFRQKRQTFSGLPAWCQCE
Sbjct: 61 ITVTPPTKPRVNPFNSVFRQKRQTFSGLPAWCQCEPTKPTCPPGPPGPPGQPGAPGTPGA 120
Query: 525 XXXXGDDNTATFAPLTCAQVSQDCVKCXXXXXXXXXXXXXXXXXXXXXXXXXXXQRXXXX 346
GDDNTATFAPLTCAQVSQDCVKC QR
Sbjct: 121 PGPKGDDNTATFAPLTCAQVSQDCVKCPQGPAGPAGPSGPAGPAGPDGQPGFPGQRGNDG 180
Query: 345 XXXXXXXXXXXXXXGTPGQDGFPGQPGADGQRGSXXXXXXXXXXXXXXXXXXXXXXXXXX 166
GTPGQDGFPGQPGADGQRGS
Sbjct: 181 FPGAPGAPGDNGQPGTPGQDGFPGQPGADGQRGSGAPGAPGAPGNAGPAGPAGQDGFPGQ 240
Query: 165 XXXXXXXXXXXXXXXXGNXXXXXXXXXXXXXXXXXXXXAYCACPPRSAVFLSRH 4
GN AYCACPPRSAVFLSRH
Sbjct: 241 DGAPGPAGPAGQDGFPGNAGSDGQPGAPGGPGLPGNDAAYCACPPRSAVFLSRH 294