Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= B0222_9
         (885 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [...   227   3e-58
gi|39594543|emb|CAE72121.1| Hypothetical protein CBG19217 [Caeno...   219   5e-56
gi|17557278|ref|NP_505375.1| COLlagen structural gene (28.8 kD) ...   218   1e-55
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno...   217   3e-55
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ...   212   8e-54
gi|39593742|emb|CAE62035.1| Hypothetical protein CBG06051 [Caeno...   205   9e-52
gi|17540620|ref|NP_502115.1| COLlagen structural gene (col-126) ...   203   5e-51
gi|17540622|ref|NP_502116.1| predicted CDS, COLlagen structural ...   203   5e-51
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ...   179   7e-44
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno...   175   1e-42
gi|39590997|emb|CAE58777.1| Hypothetical protein CBG01972 [Caeno...   172   7e-42
gi|17570601|ref|NP_509692.1| COLlagen structural gene (28.7 kD) ...   170   4e-41
gi|7494765|pir||T29837 hypothetical protein B0222.6 - Caenorhabd...   155   1e-36
gi|17557220|ref|NP_505647.1| COLlagen structural gene (col-150) ...   150   4e-35
gi|39593314|emb|CAE64784.1| Hypothetical protein CBG09577 [Caeno...   148   1e-34
gi|17557828|ref|NP_505635.1| COLlagen structural gene (col-148) ...   144   3e-33
gi|17557218|ref|NP_505646.1| COLlagen structural gene (30.6 kD) ...   142   8e-33
gi|39593313|emb|CAE64783.1| Hypothetical protein CBG09576 [Caeno...   139   8e-32
gi|39583705|emb|CAE63809.1| Hypothetical protein CBG08355 [Caeno...   131   2e-29
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno...   122   1e-26
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder...   108   2e-22
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder...   100   3e-20
gi|39582788|emb|CAE74251.1| Hypothetical protein CBG21938 [Caeno...    97   6e-19
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida]                96   8e-19
gi|17505428|ref|NP_492035.1| COLlagen structural gene (col-61) [...    93   7e-18
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita]    92   1e-17
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (...    87   5e-16
gi|39589826|emb|CAE67061.1| Hypothetical protein CBG12469 [Caeno...    76   1e-12
gi|17542298|ref|NP_501532.1| COLlagen structural gene (col-118) ...    74   3e-12
gi|687634|gb|AAA62504.1| collagen                                      74   3e-12
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [...    72   1e-11
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel...    60   5e-08
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand...    57   4e-07
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand...    57   4e-07
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans]             55   2e-06
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ...    55   2e-06
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno...    55   3e-06
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ...    54   4e-06
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno...    54   4e-06
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ...    53   1e-05
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno...    53   1e-05
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno...    52   2e-05
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8]                  50   5e-05
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno...    50   5e-05
gi|22324231|emb|CAD44395.1| hypothetical protein [Enterococcus f...    50   7e-05
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [...    50   7e-05
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p...    49   1e-04
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno...    49   1e-04
gi|79960|pir||JH0204 hypothetical 30.5K protein precursor - Ente...    49   1e-04
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp...    49   1e-04
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno...    48   3e-04
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi...    48   3e-04
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ...    47   4e-04
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ...    47   6e-04
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ...    47   6e-04
gi|21221416|ref|NP_627195.1| putative secreted protein [Streptom...    47   7e-04
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd...    47   7e-04
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ...    47   7e-04
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv...    46   0.001
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre...    46   0.001
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno...    46   0.001
gi|28377133|ref|NP_784025.1| cell surface protein precursor [Lac...    45   0.002
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno...    45   0.002
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri...    45   0.002
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ...    45   0.002
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno...    45   0.002
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ...    45   0.003
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno...    45   0.003
gi|18766204|gb|AAL78899.1| merozoite surface protein-9 precursor...    44   0.004
gi|112674|sp|P13813|110K_PLAKN 110 kDa antigen (PK110) >gnl|BL_O...    44   0.004
gi|628967|pir||S45091 hypothetical protein iota - Streptococcus ...    44   0.004
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8]                 44   0.005
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ...    44   0.005
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ...    43   0.008
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno...    43   0.008
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc...    43   0.008
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami...    43   0.008
gi|2367429|gb|AAB69643.1| Nlj21 [Lotus japonicus]                      43   0.011
gi|11467826|ref|NP_050877.1| hypothetical chloroplast RF2 [Nephr...    43   0.011
gi|12957024|emb|CAC29194.1| hypothetical protein [Enterococcus f...    43   0.011
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno...    42   0.014
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec...    42   0.014
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >...    42   0.014
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA...    42   0.018
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [...    42   0.018
gi|34394194|dbj|BAC84646.1| hypothetical protein [Oryza sativa (...    42   0.018
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno...    42   0.018
gi|39596361|emb|CAE69999.1| Hypothetical protein CBG16406 [Caeno...    42   0.018
gi|38049260|gb|AAR10431.1| hypothetical protein [Enterococcus fa...    42   0.018
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ...    42   0.018
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha...    42   0.024
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ...    42   0.024
gi|23486663|gb|EAA20861.1| strong similarity to unknown protein-...    42   0.024
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ...    41   0.031
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno...    41   0.031
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel...    41   0.031
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa...    41   0.031
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc...    41   0.040
gi|50547961|ref|XP_501450.1| hypothetical protein [Yarrowia lipo...    40   0.053
gi|32033879|ref|ZP_00134150.1| COG0810: Periplasmic protein TonB...    40   0.069
gi|50546519|ref|XP_500729.1| hypothetical protein [Yarrowia lipo...    40   0.069
gi|23479961|gb|EAA16652.1| SPRY domain, putative [Plasmodium yoe...    40   0.069
gi|17545426|ref|NP_518828.1| PROBABLE PROTEIN WITH PROLINE-ALANI...    40   0.090
gi|23509556|ref|NP_702223.1| NAD(P)H-dependent glutamate synthas...    40   0.090
gi|16803176|ref|NP_464661.1| similar to internalin, putative pep...    40   0.090
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno...    40   0.090
gi|34864589|ref|XP_345933.1| similar to transmembrane protease, ...    40   0.090
gi|50545265|ref|XP_500170.1| hypothetical protein [Yarrowia lipo...    40   0.090
gi|17533675|ref|NP_496739.1| mature parasite-infected erythrocyt...    39   0.12
gi|42519751|ref|NP_965681.1| hypothetical protein LJ0574 [Lactob...    39   0.12
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her...    39   0.12
gi|50419727|ref|XP_458392.1| unnamed protein product [Debaryomyc...    39   0.15
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ...    39   0.15
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ...    39   0.15
gi|19553788|ref|NP_601790.1| predicted extracellular nuclease [C...    39   0.20
gi|34854626|ref|XP_218226.2| similar to mKIAA0287 protein [Rattu...    39   0.20
gi|37528750|gb|AAQ92320.1| elafin [Ovis aries]                         39   0.20
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno...    39   0.20
gi|7494171|pir||T28635 glutamate synthase (NADH2) (EC 1.4.1.14) ...    39   0.20
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno...    39   0.20
gi|23613415|ref|NP_703259.1| asparagine-rich antigen Pfa35-2 [Pl...    39   0.20
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ...    38   0.26
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno...    38   0.26
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis]         38   0.34
gi|23481405|gb|EAA17693.1| hypothetical protein [Plasmodium yoel...    38   0.34
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ...    38   0.34
gi|49121568|ref|XP_412424.1| hypothetical protein AN8287.2 [Aspe...    38   0.34
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati...    38   0.34
gi|8101005|gb|AAF72509.1| putative cell-surface adhesin SdrF [St...    37   0.45
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-...    37   0.45
gi|19112576|ref|NP_595784.1| hypothetical coiled-coil protein [S...    37   0.45
gi|32422567|ref|XP_331727.1| hypothetical protein [Neurospora cr...    37   0.45
gi|23957728|ref|NP_473185.2| hypothetical protein, conserved [Pl...    37   0.45
gi|42662517|ref|XP_377721.1| similar to Hypothetical protein CBG...    37   0.45
gi|27469313|ref|NP_765950.1| Ser-Asp rich fibrinogen-binding,bon...    37   0.45
gi|23619548|ref|NP_705510.1| hypothetical protein [Plasmodium fa...    37   0.45
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano...    37   0.45
gi|47217427|emb|CAG00787.1| unnamed protein product [Tetraodon n...    37   0.45
gi|23510031|ref|NP_702697.1| hypothetical protein [Plasmodium fa...    37   0.45
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno...    37   0.58
gi|47094978|ref|ZP_00232591.1| cell wall surface anchor family p...    37   0.58
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g...    37   0.58
gi|23483514|gb|EAA19159.1| hypothetical protein [Plasmodium yoel...    37   0.58
gi|46249455|gb|AAH68622.1| LOC414671 protein [Xenopus laevis]          37   0.58
gi|28829619|gb|AAO52136.1| similar to Dictyostelium. Serine/thre...    37   0.58
gi|50306211|ref|XP_453068.1| unnamed protein product [Kluyveromy...    37   0.58
gi|37680163|ref|NP_934772.1| hypothetical protein VV1979 [Vibrio...    37   0.58
gi|42734015|gb|AAS38898.1| similar to putative TFIIF-interacting...    37   0.58
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno...    37   0.58
gi|39979119|emb|CAE85494.1| putative protein [Neurospora crassa]       37   0.58
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa...    37   0.76
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_...    37   0.76
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus)       37   0.76
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para...    37   0.76
gi|22750437|gb|AAN05466.1| polygalacturonase [Phytophthora cinna...    36   0.99
gi|15673632|ref|NP_267806.1| hypothetical protein L98109 [Lactoc...    36   0.99
gi|27371263|gb|AAH41238.1| Mfap2-prov protein [Xenopus laevis]         36   0.99
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno...    36   0.99
gi|477562|pir||A49206 exo-beta-D-fructosidase - Streptococcus mu...    36   0.99
gi|24378602|ref|NP_720557.1| fructan hydrolase; exo-beta-D-fruct...    36   0.99
gi|28829317|gb|AAO51859.1| similar to Homo sapiens (Human). Muci...    36   0.99
gi|24641644|ref|NP_727652.1| CG32644-PB [Drosophila melanogaster...    36   0.99
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ...    36   0.99
gi|7489927|pir||T31426 cellulase (EC 3.2.1.4) CelD - rumen fungu...    36   0.99
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc...    36   0.99
gi|50419303|ref|XP_458176.1| unnamed protein product [Debaryomyc...    36   1.3
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa...    36   1.3
gi|26251191|ref|NP_757231.1| Hypothetical protein [Escherichia c...    36   1.3
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi...    36   1.3
gi|23480798|gb|EAA17260.1| hypothetical protein [Plasmodium yoel...    36   1.3
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno...    36   1.3
gi|38086517|ref|XP_141978.4| similar to gene_id:K5K13.11~unknown...    36   1.3
gi|34878571|ref|XP_223518.2| similar to RIKEN cDNA 4921513E08 [R...    36   1.3
gi|29827234|ref|NP_821868.1| hypothetical protein SAV693 [Strept...    36   1.3
gi|17550712|ref|NP_510630.1| COLlagen structural gene (col-187) ...    36   1.3
gi|18780281|ref|NP_570117.1| mucosal vascular addressin cell adh...    36   1.3
gi|26247122|ref|NP_753162.1| Hypothetical protein [Escherichia c...    36   1.3
gi|34854792|ref|XP_218287.2| similar to putative odorant recepto...    35   1.7
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu...    35   1.7
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-...    35   1.7
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno...    35   1.7
gi|459931|gb|AAA40971.1| contiguous repeat polypeptide [Rattus n...    35   1.7
gi|46048571|ref|NP_976077.1| hypothetical gene supported by M310...    35   1.7
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib...    35   1.7
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr...    35   1.7
gi|29377906|ref|NP_817032.1| surface protein PrgC [Enterococcus ...    35   1.7
gi|39593739|emb|CAE62032.1| Hypothetical protein CBG06046 [Caeno...    35   1.7
gi|786136|gb|AAA99499.1| polymorphic immunodominant molecule           35   2.2
gi|50294998|ref|XP_449910.1| unnamed protein product [Candida gl...    35   2.2
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli...    35   2.2
gi|28850391|gb|AAO53165.1| similar to midasin, a large protein w...    35   2.2
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C...    35   2.2
gi|46439237|gb|EAK98557.1| hypothetical protein CaO19.12525 [Can...    35   2.2
gi|38603523|dbj|BAD02898.1| bacteriolytic enzyme [Bacillus clausii]    35   2.2
gi|548937|sp|Q06852|SLP1_CLOTM CELL SURFACE GLYCOPROTEIN 1 PRECU...    35   2.2
gi|50555291|ref|XP_505054.1| hypothetical protein [Yarrowia lipo...    35   2.2
gi|2116688|dbj|BAA11178.1| deltaEF1 [Gallus gallus]                    35   2.2
gi|45384096|ref|NP_990462.1| deltaEF1 [Gallus gallus] >gnl|BL_OR...    35   2.2
gi|23480977|gb|EAA17393.1| hypothetical protein [Plasmodium yoel...    35   2.2
gi|46440639|gb|EAK99943.1| hypothetical protein CaO19.6260 [Cand...    35   2.2
gi|46439313|gb|EAK98632.1| hypothetical protein CaO19.5058 [Cand...    35   2.2
gi|48858286|ref|ZP_00312245.1| hypothetical protein Chte02002468...    35   2.2
gi|729317|sp|P39653|DEXT_STRDO Dextranase precursor (Alpha-1,6-g...    35   2.2
gi|12053779|emb|CAC20094.1| Nahoda protein [Drosophila melanogas...    35   2.2
gi|41688571|sp|Q13477|MACA_HUMAN Mucosal addressin cell adhesion...    35   2.2
gi|97901|pir||A41826 probable pheromone-responsive protein C pre...    35   2.2
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc...    35   2.2
gi|50255862|gb|EAL18593.1| hypothetical protein CNBJ0190 [Crypto...    35   2.9
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa...    35   2.9
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi...    35   2.9
gi|21282461|ref|NP_645549.1| conserved hypothetical protein [Sta...    35   2.9
gi|15923760|ref|NP_371294.1| conserved hypothetical protein [Sta...    35   2.9
gi|23612979|ref|NP_704518.1| hypothetical protein [Plasmodium fa...    35   2.9
gi|24639970|ref|NP_572262.1| CG3108-PA [Drosophila melanogaster]...    35   2.9
gi|17542824|ref|NP_501756.1| COLlagen structural gene (col-123) ...    35   2.9
gi|33866099|ref|NP_897658.1| conserved hypothetical protein [Syn...    35   2.9
gi|2262205|gb|AAC48752.1| neuroendocrine secretory protein 55 [B...    35   2.9
gi|31544697|ref|NP_853275.1| Rnc [Mycoplasma gallisepticum R] >g...    35   2.9
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno...    35   2.9
gi|2980984|gb|AAC06197.1| CMC-xylanase [Fibrobacter succinogenes...    35   2.9
gi|17986031|ref|NP_523441.1| CG3696-PA [Drosophila melanogaster]...    34   3.8
gi|22750439|gb|AAN05467.1| polygalacturonase [Phytophthora cinna...    34   3.8
gi|627056|pir||A54641 interspersed repeat antigen precursor - ma...    34   3.8
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ...    34   3.8
gi|6322796|ref|NP_012869.1| RNAPII degradation factor, forms a c...    34   3.8
gi|38109301|gb|EAA55193.1| hypothetical protein MG06850.4 [Magna...    34   3.8
gi|23098767|ref|NP_692233.1| hypothetical protein OB1312 [Oceano...    34   3.8
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (...    34   3.8
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo...    34   3.8
gi|39597161|emb|CAE59388.1| Hypothetical protein CBG02745 [Caeno...    34   3.8
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [...    34   3.8
gi|23508382|ref|NP_701051.1| hypothetical protein [Plasmodium fa...    34   3.8
gi|33569302|gb|AAQ21594.1| elafin [Ovis aries]                         34   3.8
gi|50758913|ref|XP_417476.1| PREDICTED: similar to Hypothetical ...    34   3.8
gi|49092454|ref|XP_407688.1| hypothetical protein AN3551.2 [Aspe...    34   3.8
gi|17548216|ref|NP_508416.1| putative endoplasmic reticulum prot...    34   3.8
gi|23508069|ref|NP_700739.1| hypothetical protein [Plasmodium fa...    34   3.8
gi|28828092|gb|AAO50775.1| similar to Dictyostelium discoideum (...    34   4.9
gi|42784532|ref|NP_981779.1| LPXTG-motif cell wall anchor domain...    34   4.9
gi|13878207|ref|NP_113559.1| testis expressed gene 16 [Mus muscu...    34   4.9
gi|48780895|ref|ZP_00277558.1| COG1530: Ribonucleases G and E [B...    34   4.9
gi|24650473|ref|NP_651520.1| CG6296-PA [Drosophila melanogaster]...    34   4.9
gi|28210238|ref|NP_781182.1| putative S-layer protein/N-acetylmu...    34   4.9
gi|6321316|ref|NP_011393.1| nuclear polyadenylated RNA binding p...    34   4.9
gi|23481077|gb|EAA17463.1| Leishmania major ppg3 [Plasmodium yoe...    34   4.9
gi|24654024|ref|NP_725525.1| CG8421-PA [Drosophila melanogaster]...    34   4.9
gi|17647175|ref|NP_523757.1| CG8421-PB [Drosophila melanogaster]...    34   4.9
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ...    34   4.9
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [...    34   4.9
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno...    34   4.9
gi|16445033|ref|NP_443189.1| ACRC protein; putative nuclear prot...    34   4.9
gi|47219357|emb|CAG10986.1| unnamed protein product [Tetraodon n...    34   4.9
gi|22135477|gb|AAM93219.1| methyl binding domain protein MBD109 ...    34   4.9
gi|39583324|emb|CAE66298.1| Hypothetical protein CBG11547 [Caeno...    34   4.9
gi|15828629|ref|NP_325989.1| LIPOPROTEIN [Mycoplasma pulmonis UA...    34   4.9
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil...    34   4.9
gi|23619064|ref|NP_705026.1| hypothetical protein [Plasmodium fa...    34   4.9
gi|46436702|gb|EAK96060.1| hypothetical protein CaO19.11847 [Can...    34   4.9
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [...    34   4.9
gi|11968243|ref|NP_072030.1| cell wall anchoring protein [Entero...    33   6.4
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ...    33   6.4
gi|42660863|ref|XP_064152.5| sarcalumenin [Homo sapiens]               33   6.4
gi|16768468|gb|AAL28453.1| GM05229p [Drosophila melanogaster]          33   6.4
gi|39595235|emb|CAE60272.1| Hypothetical protein CBG03851 [Caeno...    33   6.4
gi|21703896|ref|NP_663424.1| ISG12 [Mus musculus] >gnl|BL_ORD_ID...    33   6.4
gi|462434|sp|P34099|KAPC_DICDI cAMP-dependent protein kinase cat...    33   6.4
gi|49076272|ref|XP_402132.1| hypothetical protein UM04517.1 [Ust...    33   6.4
gi|14591205|ref|NP_143281.1| hypothetical protein PH1409 [Pyroco...    33   6.4
gi|241277|gb|AAB20716.1| serine/threonine protein kinase [Dictyo...    33   6.4
gi|46441019|gb|EAL00319.1| hypothetical protein CaO19.12976 [Can...    33   6.4
gi|28829482|gb|AAL92370.2| similar to Dictyostelium discoideum (...    33   6.4
gi|25149706|ref|NP_501185.2| protein kinase (4I207) [Caenorhabdi...    33   6.4
gi|21693269|gb|AAM75216.1| EF0010 [Enterococcus faecalis]              33   6.4
gi|29375118|ref|NP_814271.1| cell wall surface anchor family pro...    33   6.4
gi|50312251|ref|XP_456157.1| unnamed protein product [Kluyveromy...    33   6.4
gi|7494971|pir||T29253 hypothetical protein B0496.3 - Caenorhabd...    33   6.4
gi|25149709|ref|NP_501186.2| protein kinase (4I207) [Caenorhabdi...    33   6.4
gi|9454386|gb|AAF87782.1| p76 membrane protein precursor [Mycopl...    33   6.4
gi|49068514|ref|XP_398546.1| hypothetical protein UM00931.1 [Ust...    33   6.4
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ...    33   6.4
gi|24658804|ref|NP_523815.2| CG12781-PA [Drosophila melanogaster...    33   6.4
gi|1223914|gb|AAB47214.1| endo16 [Strongylocentrotus purpuratus]       33   6.4
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD...    33   6.4
gi|45201169|ref|NP_986739.1| AGR074Cp [Eremothecium gossypii] >g...    33   6.4
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno...    33   6.4
gi|28201845|sp|Q99PG2|OGFR_MOUSE Opioid growth factor receptor (...    33   8.4
gi|31982604|ref|NP_113550.2| opioid growth factor receptor [Mus ...    33   8.4
gi|15237067|ref|NP_195287.1| cyclin 2b (CYC2b) [Arabidopsis thal...    33   8.4
gi|23478367|gb|EAA15475.1| immediate early protein homolog [Plas...    33   8.4
gi|758803|gb|AAB70878.1| peritrophin-95 precursor [Lucilia cuprina]    33   8.4
gi|23507944|ref|NP_700614.1| hypothetical protein [Plasmodium fa...    33   8.4
gi|22788865|ref|NP_690550.1| DNA polymerase I [Heliothis zea vir...    33   8.4
gi|47229853|emb|CAG07049.1| unnamed protein product [Tetraodon n...    33   8.4
gi|2350960|dbj|BAA22007.1| serine rich 25 kD antigen protein [En...    33   8.4
gi|32566278|ref|NP_500256.2| predicted CDS, putative membrane pr...    33   8.4
gi|984808|gb|AAA92532.1| peritrophin-95 precursor                      33   8.4
gi|17535069|ref|NP_496535.1| COLlagen structural gene (col-84) [...    33   8.4
gi|30023824|ref|NP_835229.1| similar to delta 5 fatty acid desat...    33   8.4
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal...    33   8.4
gi|323142|pir||A45559 sporozoite surface protein 2 - Plasmodium ...    33   8.4
gi|34881305|ref|XP_228502.2| similar to hypothetical protein FLJ...    33   8.4
gi|23619502|ref|NP_705464.1| hypothetical protein [Plasmodium fa...    33   8.4
gi|15611543|ref|NP_223194.1| cag island protein [Helicobacter py...    33   8.4
gi|48862277|ref|ZP_00316174.1| COG3979: Uncharacterized protein ...    33   8.4
gi|39581822|emb|CAE60715.1| Hypothetical protein CBG04386 [Caeno...    33   8.4
gi|50545257|ref|XP_500166.1| hypothetical protein [Yarrowia lipo...    33   8.4
gi|42734064|gb|AAS38936.1| similar to Plasmodium falciparum (iso...    33   8.4
gi|48763005|ref|ZP_00267562.1| hypothetical protein Rrub02003719...    33   8.4
gi|46437526|gb|EAK96871.1| hypothetical protein CaO19.448 [Candi...    33   8.4
gi|7513468|pir||JE0257 trappin-11 - hippopotamus >gnl|BL_ORD_ID|...    33   8.4
gi|15227656|ref|NP_181183.1| expressed protein [Arabidopsis thal...    33   8.4
gi|19551977|ref|NP_599979.1| hypothetical protein NCgl0717 [Cory...    33   8.4
gi|45645179|sp|Q01443|SSP2_PLAYO Sporozoite surface protein 2 pr...    33   8.4
gi|50307991|ref|XP_453995.1| unnamed protein product [Kluyveromy...    33   8.4


>gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10)
           [Caenorhabditis elegans]
 gi|7494767|pir||T29839 hypothetical protein B0222.8 -
           Caenorhabditis elegans
 gi|1226316|gb|AAA92325.1| Collagen protein 10 [Caenorhabditis
           elegans]
          Length = 294

 Score =  227 bits (578), Expect = 3e-58
 Identities = 118/147 (80%), Positives = 118/147 (80%)
 Frame = -1

Query: 885 MEKFLVTLSTGAASIAVLAVLFTVPSLYNTINEVHDEVLDGVSVFRVETDSAWTEMMDIQ 706
           MEKFLVTLSTGAASIAVLAVLFTVPSLYNTINEVHDEVLDGVSVFRVETDSAWTEMMDIQ
Sbjct: 1   MEKFLVTLSTGAASIAVLAVLFTVPSLYNTINEVHDEVLDGVSVFRVETDSAWTEMMDIQ 60

Query: 705 ITVTPPTKPRVNPFNSIFRQKRQTFSGLPAWCQCEXXXXXXXXXXXXXXXXXXXXXXXXX 526
           ITVTPPTKPRVNPFNSIFRQKRQTFSGLPAWCQCE
Sbjct: 61  ITVTPPTKPRVNPFNSIFRQKRQTFSGLPAWCQCEPTKPTCPPGPPGPPGQPGAPGTPGA 120

Query: 525 XXXXGDDNTATFAPLTCAPVSQDCVKC 445
               GDDNTATFAPLTCAPVSQDCVKC
Sbjct: 121 PGPKGDDNTATFAPLTCAPVSQDCVKC 147



 Score = 38.1 bits (87), Expect = 0.26
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = -1

Query: 48  YCACPPRSAVFVSRH 4
           YCACPPRSAVFVSRH
Sbjct: 280 YCACPPRSAVFVSRH 294




[DB home][top]