Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= B0284_4
(1275 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17551776|ref|NP_497884.1| putative nuclear protein family mem... 831 0.0
gi|17551780|ref|NP_497885.1| predicted CDS, putative N-myristoyl... 276 1e-72
gi|17551774|ref|NP_497882.1| putative protein family member, wit... 266 6e-70
gi|39592877|emb|CAE62491.1| Hypothetical protein CBG06596 [Caeno... 193 6e-48
gi|17505649|ref|NP_493301.1| putative N-myristoylated nuclear pr... 119 2e-25
gi|17509829|ref|NP_493290.1| predicted CDS, putative protein fam... 108 4e-22
gi|17505643|ref|NP_493296.1| putative N-myristoylated protein fa... 73 2e-11
gi|17505647|ref|NP_493300.1| predicted CDS, putative protein fam... 72 3e-11
gi|39583937|emb|CAE64027.1| Hypothetical protein CBG08622 [Caeno... 66 2e-09
gi|6320145|ref|NP_010225.1| involved intracellular protein trans... 63 1e-08
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p... 63 1e-08
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae] 63 1e-08
gi|38085013|ref|XP_132817.3| RIKEN cDNA 5730521P14 [Mus musculus] 62 2e-08
gi|677198|gb|AAB00143.1| putative 61 5e-08
gi|21744245|gb|AAM76181.1| LD08185p [Drosophila melanogaster] 61 6e-08
gi|28574920|ref|NP_648597.2| CG10971-PA [Drosophila melanogaster... 61 6e-08
gi|24663450|ref|NP_729827.1| CG10971-PB [Drosophila melanogaster... 61 6e-08
gi|27374294|gb|AAO01046.1| CG11915-PA [Drosophila pseudoobscura] 60 1e-07
gi|17505637|ref|NP_493298.1| predicted CDS, putative nuclear pro... 59 2e-07
gi|23510054|ref|NP_702720.1| hypothetical protein [Plasmodium fa... 59 3e-07
gi|50421427|ref|XP_459264.1| unnamed protein product [Debaryomyc... 58 4e-07
gi|48853927|ref|ZP_00308092.1| COG1196: Chromosome segregation A... 58 5e-07
gi|29251008|gb|EAA42494.1| GLP_587_87663_89534 [Giardia lamblia ... 57 7e-07
gi|46446033|ref|YP_007398.1| putative eucaryotic myosin heavy ch... 57 9e-07
gi|39932725|sp|Q00799|RBP2_PLAVB Reticulocyte binding protein 2 ... 57 1e-06
gi|46249876|gb|AAH68827.1| LOC414564 protein [Xenopus laevis] 57 1e-06
gi|39580127|emb|CAE56798.1| Hypothetical protein CBG24610 [Caeno... 56 2e-06
gi|7494144|pir||T18372 repeat organellar protein - Plasmodium ch... 55 3e-06
gi|437639|gb|AAA72295.1| [Plasmodium falciparum 3' end.], gene p... 55 3e-06
gi|23619293|ref|NP_705255.1| reticulocyte binding protein 2 homo... 55 3e-06
gi|13345187|gb|AAK19244.1| reticulocyte binding protein 2 homolo... 55 3e-06
gi|23484817|gb|EAA20018.1| hypothetical protein [Plasmodium yoel... 55 3e-06
gi|42660665|ref|XP_208835.4| similar to hypothetical protein FLJ... 55 3e-06
gi|16804929|ref|NP_472958.1| hypothetical protein [Plasmodium fa... 55 3e-06
gi|32698944|ref|NP_872367.1| hypothetical protein FLJ36144 [Homo... 55 4e-06
gi|50355643|dbj|BAD29962.1| Be158 [Babesia equi] 55 4e-06
gi|23509780|ref|NP_702447.1| hypothetical protein [Plasmodium fa... 55 5e-06
gi|31199853|ref|XP_308874.1| ENSANGP00000005723 [Anopheles gambi... 55 5e-06
gi|50404942|ref|YP_054034.1| hypothetical protein with coiled-co... 54 6e-06
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 54 6e-06
gi|1722855|sp|P50532|SMC4_XENLA Structural maintenance of chromo... 54 8e-06
gi|30354032|gb|AAH51911.1| Chromosome 13 open reading frame 24 [... 54 8e-06
gi|23478145|gb|EAA15312.1| hypothetical protein [Plasmodium yoel... 54 8e-06
gi|23957724|ref|NP_473180.2| hypothetical protein, conserved [Pl... 54 8e-06
gi|34858375|ref|XP_232319.2| similar to KIAA1074 protein [Rattus... 54 1e-05
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa... 54 1e-05
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 54 1e-05
gi|23479053|gb|EAA15986.1| mature-parasite-infected erythrocyte ... 54 1e-05
gi|39584984|emb|CAE64408.1| Hypothetical protein CBG09100 [Caeno... 54 1e-05
gi|23489781|gb|EAA21707.1| hypothetical protein [Plasmodium yoel... 54 1e-05
gi|38105537|gb|EAA51953.1| hypothetical protein MG03548.4 [Magna... 54 1e-05
gi|33413774|gb|AAN39445.1| normocyte binding protein 2a [Plasmod... 54 1e-05
gi|23613089|ref|NP_703411.1| hypothetical protein [Plasmodium fa... 53 1e-05
gi|21355931|ref|NP_648931.1| CG11915-PA [Drosophila melanogaster... 53 1e-05
gi|28558155|sp|Q8WXW3|PIBF_HUMAN Progesterone-induced blocking f... 53 1e-05
gi|5453890|ref|NP_006337.1| chromosome 13 open reading frame 24;... 53 1e-05
gi|34395179|dbj|BAC83565.1| plectin-like protein [Oryza sativa (... 53 1e-05
gi|13928704|ref|NP_113708.1| myosin heavy chain 10, non-muscle; ... 53 2e-05
gi|21757308|dbj|BAC05084.1| unnamed protein product [Homo sapiens] 53 2e-05
gi|29367563|gb|AAO72643.1| myosin heavy chain-like protein [Oryz... 53 2e-05
gi|28972888|dbj|BAC65860.1| mKIAA3005 protein [Mus musculus] 52 2e-05
gi|32403722|ref|XP_322474.1| hypothetical protein [Neurospora cr... 52 2e-05
gi|33598964|ref|NP_780469.1| myosin heavy chain 10, non-muscle; ... 52 2e-05
gi|42659545|ref|XP_374779.1| ankyrin repeat domain 26 [Homo sapi... 52 2e-05
gi|37604192|gb|AAH59863.1| Myh10 protein [Mus musculus] 52 2e-05
gi|40789039|dbj|BAA83026.2| KIAA1074 protein [Homo sapiens] 52 2e-05
gi|34536017|dbj|BAC87508.1| unnamed protein product [Homo sapiens] 52 2e-05
gi|50758577|ref|XP_417323.1| PREDICTED: similar to centrosomal p... 52 2e-05
gi|47228961|emb|CAG09476.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|50258602|gb|EAL21289.1| hypothetical protein CNBD3430 [Crypto... 52 2e-05
gi|18977539|ref|NP_578896.1| smc-like [Pyrococcus furiosus DSM 3... 52 3e-05
gi|41406064|ref|NP_005955.1| myosin, heavy polypeptide 10, non-m... 52 3e-05
gi|1346640|sp|P35580|MYHA_HUMAN Myosin heavy chain, nonmuscle ty... 52 3e-05
gi|47208342|emb|CAF88490.1| unnamed protein product [Tetraodon n... 52 3e-05
gi|45199155|ref|NP_986184.1| AFR637Wp [Eremothecium gossypii] >g... 52 3e-05
gi|19851917|gb|AAL99918.1| CLL-associated antigen KW-11 [Homo sa... 52 3e-05
gi|15894405|ref|NP_347754.1| Phage-related protein, YqbO B.subti... 52 3e-05
gi|40788217|dbj|BAA20794.2| KIAA0336 [Homo sapiens] 52 3e-05
gi|422615|pir||A47297 myosin heavy chain form B, nonmuscle - Afr... 52 3e-05
gi|7662062|ref|NP_055450.1| GRIP coiled-coil protein GCC185 isof... 52 3e-05
gi|31563507|ref|NP_852118.1| GRIP coiled-coil protein GCC185 iso... 52 3e-05
gi|27370644|gb|AAH37774.1| GCC2 protein [Homo sapiens] 52 3e-05
gi|23613557|ref|NP_704578.1| hypothetical protein [Plasmodium fa... 52 4e-05
gi|2352945|gb|AAB69326.1| smooth muscle myosin heavy chain SM2 [... 52 4e-05
gi|17553116|ref|NP_498427.1| putative protein, with 3 coiled coi... 52 4e-05
gi|34495237|gb|AAQ73468.1| erythrocyte binding protein 2 [Plasmo... 52 4e-05
gi|2352947|gb|AAB69327.1| smooth muscle myosin heavy chain SM1 [... 52 4e-05
gi|41150991|ref|XP_371164.1| NYD-SP11 protein [Homo sapiens] 52 4e-05
gi|6322594|ref|NP_012668.1| Protein of unknown function, require... 52 4e-05
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 52 4e-05
gi|34495238|gb|AAQ73469.1| erythrocyte binding protein 3 [Plasmo... 52 4e-05
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa... 52 4e-05
gi|48130462|ref|XP_396665.1| similar to hypothetical protein [Ap... 51 5e-05
gi|13124875|ref|NP_074035.1| smooth muscle myosin heavy chain 11... 51 5e-05
gi|50404844|ref|YP_053936.1| hypothetical protein PTMB.08c [Para... 51 5e-05
gi|34875216|ref|XP_225259.2| similar to Desmoplakin (DP) (250/21... 51 5e-05
gi|27529744|dbj|BAA74889.2| KIAA0866 protein [Homo sapiens] 51 5e-05
gi|2104553|gb|AAC31665.1| Myosin heavy chain (MHY11) (5'partial)... 51 5e-05
gi|23509190|ref|NP_701858.1| hypothetical protein [Plasmodium fa... 51 5e-05
gi|36507|emb|CAA49154.1| smooth muscle mysosin heavy chain [Homo... 51 5e-05
gi|1708493|sp|P53352|INCE_CHICK Inner centromere protein >gnl|BL... 51 5e-05
gi|13124879|ref|NP_002465.1| smooth muscle myosin heavy chain 11... 51 5e-05
gi|23478507|gb|EAA15576.1| ADA2-like protein [Plasmodium yoelii ... 51 5e-05
gi|50749502|ref|XP_421665.1| PREDICTED: similar to hypothetical ... 51 5e-05
gi|32413483|ref|XP_327221.1| predicted protein [Neurospora crass... 51 5e-05
gi|34860597|ref|XP_342346.1| similar to CENTROMERIC PROTEIN E (C... 51 7e-05
gi|23481991|gb|EAA18109.1| erythrocyte binding protein [Plasmodi... 51 7e-05
gi|7494464|pir||T09127 probable erythrocyte-binding protein MAEB... 51 7e-05
gi|34495216|gb|AAQ73456.1| erythrocyte binding protein 3 [Plasmo... 51 7e-05
gi|23508962|ref|NP_701630.1| hypothetical protein [Plasmodium fa... 51 7e-05
gi|34495215|gb|AAQ73455.1| erythrocyte binding protein 2 [Plasmo... 51 7e-05
gi|17539660|ref|NP_501873.1| myosin heavy chain (4K994) [Caenorh... 51 7e-05
gi|33413782|gb|AAN39444.1| normocyte binding protein 2a [Plasmod... 51 7e-05
gi|23099705|ref|NP_693171.1| exonuclease [Oceanobacillus iheyens... 51 7e-05
gi|23957777|ref|NP_473326.2| hypothetical protein [Plasmodium fa... 51 7e-05
gi|627059|pir||A45592 liver stage antigen LSA-1 - malaria parasi... 51 7e-05
gi|23508767|ref|NP_701435.1| hypothetical protein [Plasmodium fa... 51 7e-05
gi|7441404|pir||T16416 hypothetical protein F52B10.1 - Caenorhab... 51 7e-05
gi|25150354|ref|NP_508504.2| non-muscle myosin (nmy-1) [Caenorha... 51 7e-05
gi|23488127|gb|EAA21236.1| maebl [Plasmodium yoelii yoelii] 51 7e-05
gi|22299327|ref|NP_682574.1| ORF_ID:tll1784~hypothetical protein... 51 7e-05
gi|18978215|ref|NP_579572.1| chromosome segregation protein smc ... 50 9e-05
gi|2129174|pir||A64505 P115 homolog - Methanococcus jannaschii 50 9e-05
gi|15669839|ref|NP_248653.1| chromosome segretation protein (smc... 50 9e-05
gi|28375557|emb|CAD66602.1| SMC protein [Pyrococcus furiosus] 50 9e-05
gi|2330003|gb|AAB66717.1| glutamine rich protein [Gallus gallus] 50 9e-05
gi|30173132|sp|Q9WU62|INCE_MOUSE Inner centromere protein >gnl|B... 50 9e-05
gi|14195008|sp|Q9JI55|PLE1_CRIGR Plectin 1 (PLTN) (PCN) (300-kDa... 50 9e-05
gi|30851505|gb|AAH52414.1| Inner centromere protein [Mus musculus] 50 9e-05
gi|26349413|dbj|BAC38346.1| unnamed protein product [Mus musculu... 50 9e-05
gi|7710040|ref|NP_057901.1| inner centromere protein [Mus muscul... 50 9e-05
gi|46105599|ref|XP_380558.1| hypothetical protein FG00382.1 [Gib... 50 9e-05
gi|50728398|ref|XP_416125.1| PREDICTED: similar to KIAA1801 prot... 50 9e-05
gi|41054021|ref|NP_956195.1| myomegalin; wu:fi74c05 [Danio rerio... 50 9e-05
gi|27819643|ref|NP_777288.1| rho-associated, coiled-coil contain... 50 9e-05
gi|48096459|ref|XP_392462.1| similar to CG18255-PA [Apis mellifera] 50 9e-05
gi|23619203|ref|NP_705165.1| hypothetical malaria antigen [Plasm... 50 1e-04
gi|25149347|ref|NP_741538.1| myosin heavy chain (5G32) [Caenorha... 50 1e-04
gi|29251332|gb|EAA42814.1| GLP_574_37298_42733 [Giardia lamblia ... 50 1e-04
gi|7511194|pir||T27907 hypothetical protein ZK546.1 - Caenorhabd... 50 1e-04
gi|50417842|gb|AAH78228.1| Unknown (protein for MGC:101063) [Dan... 50 1e-04
gi|48825238|ref|ZP_00286509.1| COG1196: Chromosome segregation A... 50 1e-04
gi|46437644|gb|EAK96987.1| hypothetical protein CaO19.9760 [Cand... 50 1e-04
gi|31198813|ref|XP_308354.1| ENSANGP00000024069 [Anopheles gambi... 50 1e-04
gi|23593313|ref|NP_473064.2| hypothetical protein [Plasmodium fa... 50 1e-04
gi|50547193|ref|XP_501066.1| hypothetical protein [Yarrowia lipo... 50 1e-04
gi|28829018|gb|AAO51593.1| similar to Plasmodium falciparum (iso... 50 1e-04
gi|46226941|gb|EAK87907.1| myosin [Cryptosporidium parvum] 50 1e-04
gi|45384506|ref|NP_990661.1| class II INCENP protein; class I IN... 50 1e-04
gi|50286051|ref|XP_445454.1| unnamed protein product [Candida gl... 50 1e-04
gi|7494310|pir||B71609 hypothetical protein PFB0680w - malaria p... 50 1e-04
gi|4761084|gb|AAD29247.1| intermediate filament macrolin [Hirudo... 50 1e-04
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 50 1e-04
gi|48857430|ref|ZP_00311434.1| COG1196: Chromosome segregation A... 50 1e-04
gi|31198815|ref|XP_308355.1| ENSANGP00000009410 [Anopheles gambi... 50 1e-04
gi|23509114|ref|NP_701782.1| hypothetical protein [Plasmodium fa... 50 1e-04
gi|38073613|ref|XP_127084.3| thyroid hormone receptor interactor... 49 2e-04
gi|212449|gb|AAA48985.1| nonmuscle myosin heavy chain 49 2e-04
gi|50751893|ref|XP_422565.1| PREDICTED: similar to glutamine ric... 49 2e-04
gi|8247352|emb|CAB92974.1| CLIP-170 [Rattus norvegicus] 49 2e-04
gi|38505168|ref|NP_113933.2| restin; restin (Reed-Steinberg cell... 49 2e-04
gi|32404542|ref|XP_322884.1| hypothetical protein [Neurospora cr... 49 2e-04
gi|45382679|ref|NP_990805.1| nonmuscle myosin heavy chain [Gallu... 49 2e-04
gi|3435244|gb|AAC32373.1| centriole associated protein CEP110 [H... 49 2e-04
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster... 49 2e-04
gi|23491382|gb|EAA22927.1| hypothetical protein [Plasmodium yoel... 49 2e-04
gi|31198993|ref|XP_308444.1| ENSANGP00000017898 [Anopheles gambi... 49 2e-04
gi|6319994|ref|NP_010074.1| Cytoplasmic nucleoporin required for... 49 2e-04
gi|23478426|gb|EAA15516.1| hypothetical protein [Plasmodium yoel... 49 2e-04
gi|38158018|ref|NP_008949.3| centrosomal protein 1; centriole as... 49 2e-04
gi|18070853|emb|CAD20123.1| bA165P4.2 (centrosomal protein 1) [H... 49 2e-04
gi|212451|gb|AAA48987.1| nonmuscle myosin heavy chain 49 2e-04
gi|18676506|dbj|BAB84905.1| FLJ00150 protein [Homo sapiens] 49 2e-04
gi|212450|gb|AAA48986.1| nonmuscle myosin heavy chain 49 2e-04
gi|23508409|ref|NP_701078.1| hypothetical protein [Plasmodium fa... 49 2e-04
gi|4249697|gb|AAD13770.1| myosin heavy chain [Rana catesbeiana] 49 3e-04
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 49 3e-04
gi|23479124|gb|EAA16038.1| repeat organellar protein-related [Pl... 49 3e-04
gi|32352206|dbj|BAC78596.1| hypothetical protein [Oryza sativa (... 49 3e-04
gi|30794192|ref|NP_084069.1| golgi autoantigen, golgin subfamily... 49 3e-04
gi|33413776|gb|AAN39446.1| normocyte binding protein 2a [Plasmod... 49 3e-04
gi|31419368|gb|AAH53068.1| Golga1 protein [Mus musculus] 49 3e-04
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 49 3e-04
gi|30230642|gb|AAP21063.1| autotransporter/adhesin Aae [Actinoba... 49 3e-04
gi|39581970|emb|CAE73832.1| Hypothetical protein CBG21399 [Caeno... 49 3e-04
gi|42733675|gb|AAO50853.2| similar to Dictyostelium discoideum (... 49 3e-04
gi|23613316|ref|NP_703638.1| hypothetical protein [Plasmodium fa... 49 3e-04
gi|46226679|gb|EAK87658.1| Low complexity protein with large Glu... 49 3e-04
gi|23593319|ref|NP_703169.1| hypothetical protein [Plasmodium fa... 49 3e-04
gi|13508049|ref|NP_109998.1| Cytadherence High Molecular Weight ... 49 3e-04
gi|23613241|ref|NP_703563.1| hypothetical protein [Plasmodium fa... 49 3e-04
gi|46228860|gb|EAK89730.1| uncharacterized protein with several ... 49 3e-04
gi|34485652|gb|AAQ73211.1| M protein [Streptococcus pyogenes] 49 3e-04
gi|7494317|pir||E71606 hypothetical protein PFB0765w - malaria p... 49 3e-04
gi|37534452|ref|NP_921528.1| putative centromere protein [Oryza ... 49 3e-04
gi|6066428|emb|CAB58295.1| hypothetical protein L2581.09 [Leishm... 49 3e-04
gi|17221648|dbj|BAB78478.1| preproMP73 [Cucurbita maxima] 49 3e-04
gi|48096461|ref|XP_394696.1| similar to CG18255-PA [Apis mellifera] 49 3e-04
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 49 3e-04
gi|39590935|emb|CAE58715.1| Hypothetical protein CBG01900 [Caeno... 48 4e-04
gi|23510071|ref|NP_702737.1| hypothetical protein [Plasmodium fa... 48 4e-04
gi|23612385|ref|NP_703965.1| hypothetical protein [Plasmodium fa... 48 4e-04
gi|45430245|gb|AAS60254.1| Zygote defective: embryonic lethal pr... 48 4e-04
gi|45430244|gb|AAS60253.1| Zygote defective: embryonic lethal pr... 48 4e-04
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 48 4e-04
gi|47214961|emb|CAG10783.1| unnamed protein product [Tetraodon n... 48 4e-04
gi|42569129|ref|NP_179444.2| cupin family protein [Arabidopsis t... 48 4e-04
gi|25411878|pir||E84565 hypothetical protein At2g18540 [imported... 48 4e-04
gi|50428109|ref|XP_457607.1| unnamed protein product [Debaryomyc... 48 4e-04
gi|50729004|ref|XP_416384.1| PREDICTED: similar to Rab6-interact... 48 4e-04
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 48 4e-04
gi|46434724|gb|EAK94126.1| hypothetical protein CaO19.2410 [Cand... 48 4e-04
gi|32564627|ref|NP_494911.2| NuDiX hydrolase (84.3 kD) (ndx-3) [... 48 4e-04
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ... 48 4e-04
gi|23509080|ref|NP_701748.1| hypothetical protein [Plasmodium fa... 48 4e-04
gi|46434778|gb|EAK94179.1| hypothetical protein CaO19.9948 [Cand... 48 4e-04
gi|50728478|ref|XP_416138.1| PREDICTED: similar to Early endosom... 48 6e-04
gi|15922434|ref|NP_378103.1| 882aa long hypothetical purine NTPa... 48 6e-04
gi|23509391|ref|NP_702058.1| hypothetical protein [Plasmodium fa... 48 6e-04
gi|1263021|gb|AAA96959.1| M protein 48 6e-04
gi|32412236|ref|XP_326598.1| predicted protein [Neurospora crass... 48 6e-04
gi|32565059|ref|NP_741024.2| M protein repeat containing protein... 48 6e-04
gi|39592202|emb|CAE75423.1| Hypothetical protein CBG23416 [Caeno... 48 6e-04
gi|39582082|emb|CAE63725.1| Hypothetical protein CBG08250 [Caeno... 48 6e-04
gi|15829164|ref|NP_326524.1| MEMBRANE NUCLEASE, LIPOPROTEIN [Myc... 48 6e-04
gi|41688754|sp|Q23529|ZY12_CAEEL Zygote defective protein 12 48 6e-04
gi|39591036|emb|CAE58816.1| Hypothetical protein CBG02025 [Caeno... 48 6e-04
gi|23508790|ref|NP_701458.1| Zinc finger transcription factor (k... 48 6e-04
gi|20978622|sp|Q96YR5|RA50_SULTO DNA double-strand break repair ... 48 6e-04
gi|10803363|emb|CAC13107.1| nuclear lamin L1 beta [Urochordate s... 48 6e-04
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo... 48 6e-04
gi|23508812|ref|NP_701480.1| hypothetical protein [Plasmodium fa... 48 6e-04
gi|39976481|gb|AAR32790.1| centrosome attachment protein A [Caen... 48 6e-04
gi|46139391|ref|XP_391386.1| hypothetical protein FG11210.1 [Gib... 48 6e-04
gi|7494129|pir||T18296 myosin heavy chain - Entamoeba histolytic... 48 6e-04
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 48 6e-04
gi|50738301|ref|XP_419285.1| PREDICTED: hypothetical protein XP_... 48 6e-04
gi|25149965|ref|NP_741023.1| M protein repeat containing protein... 48 6e-04
gi|47222611|emb|CAG02976.1| unnamed protein product [Tetraodon n... 48 6e-04
gi|47230009|emb|CAG10423.1| unnamed protein product [Tetraodon n... 48 6e-04
gi|10803361|emb|CAC13106.1| nuclear lamin L1 alpha [Urochordate ... 48 6e-04
gi|8393804|ref|NP_058935.1| myosin heavy chain, polypeptide 6; m... 47 7e-04
gi|22138113|gb|AAL07517.1| CAST1 [Rattus norvegicus] 47 7e-04
gi|41322912|ref|NP_958780.1| plectin 1 isoform 2; hemidesmosomal... 47 7e-04
gi|41322916|ref|NP_958782.1| plectin 1 isoform 6; hemidesmosomal... 47 7e-04
gi|7496266|pir||T34107 hypothetical protein C18C4.5 - Caenorhabd... 47 7e-04
gi|29436380|gb|AAH49849.1| MYH9 protein [Homo sapiens] 47 7e-04
gi|14195007|sp|Q15149|PLE1_HUMAN Plectin 1 (PLTN) (PCN) (Hemides... 47 7e-04
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n... 47 7e-04
gi|553596|gb|AAA59888.1| cellular myosin heavy chain 47 7e-04
gi|1828|emb|CAA35992.1| trichohyalin [Ovis sp.] 47 7e-04
gi|47607492|ref|NP_000436.2| plectin 1 isoform 1; hemidesmosomal... 47 7e-04
gi|7442004|pir||G02520 plectin - human >gnl|BL_ORD_ID|215627 gi|... 47 7e-04
gi|41322919|ref|NP_958784.1| plectin 1 isoform 8; hemidesmosomal... 47 7e-04
gi|41322923|ref|NP_958786.1| plectin 1 isoform 11; hemidesmosoma... 47 7e-04
gi|33620941|gb|AAM29663.2| Hypothetical protein C18C4.5b [Caenor... 47 7e-04
gi|23507975|ref|NP_700645.1| hypothetical protein [Plasmodium fa... 47 7e-04
gi|19115763|ref|NP_594851.1| hypothetical protein; sequence orph... 47 7e-04
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [... 47 7e-04
gi|45199221|ref|NP_986250.1| AFR702Wp [Eremothecium gossypii] >g... 47 7e-04
gi|23612484|ref|NP_704045.1| hypothetical protein [Plasmodium fa... 47 7e-04
gi|41322914|ref|NP_958785.1| plectin 1 isoform 10; hemidesmosoma... 47 7e-04
gi|27227572|emb|CAD59403.1| SMC1 protein [Anopheles gambiae] 47 7e-04
gi|30262170|ref|NP_844547.1| conserved domain protein [Bacillus ... 47 7e-04
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 47 7e-04
gi|23481897|gb|EAA18039.1| hypothetical protein [Plasmodium yoel... 47 7e-04
gi|28571201|ref|NP_788907.1| CG33206-PA [Drosophila melanogaster... 47 7e-04
gi|6093461|sp|P79293|MYH7_PIG Myosin heavy chain, cardiac muscle... 47 7e-04
gi|50308363|ref|XP_454183.1| unnamed protein product [Kluyveromy... 47 7e-04
gi|48894044|ref|ZP_00327242.1| COG0419: ATPase involved in DNA r... 47 7e-04
gi|28828099|gb|AAO50782.1| similar to Dictyostelium discoideum (... 47 7e-04
gi|12667788|ref|NP_002464.1| myosin, heavy polypeptide 9, non-mu... 47 7e-04
gi|41322908|ref|NP_958781.1| plectin 1 isoform 3; hemidesmosomal... 47 7e-04
gi|9631517|ref|NP_048117.1| ORF MSV046 hypothetical protein [Mel... 47 7e-04
gi|28571203|ref|NP_788908.1| CG33206-PB [Drosophila melanogaster... 47 7e-04
gi|41322910|ref|NP_958783.1| plectin 1 isoform 7; hemidesmosomal... 47 7e-04
gi|3986194|dbj|BAA34954.1| myosin heavy chain [Dugesia japonica] 47 7e-04
gi|45358904|ref|NP_988461.1| DNA double-strand break repair rad5... 47 7e-04
gi|47214148|emb|CAG07925.1| unnamed protein product [Tetraodon n... 47 7e-04
gi|17933552|ref|NP_525064.1| CG6450-PC [Drosophila melanogaster]... 47 0.001
gi|32564492|ref|NP_497577.2| C.Elegans Homeobox (71.0 kD) (ceh-4... 47 0.001
gi|34485704|gb|AAQ73237.1| M protein [Streptococcus pyogenes] 47 0.001
gi|2253417|gb|AAD09135.1| Trip230 [Homo sapiens] 47 0.001
gi|42476299|ref|NP_056390.2| trinucleotide repeat containing 15;... 47 0.001
gi|31873894|emb|CAD97881.1| hypothetical protein [Homo sapiens] 47 0.001
gi|47223023|emb|CAG07110.1| unnamed protein product [Tetraodon n... 47 0.001
gi|34365399|emb|CAE46015.1| hypothetical protein [Homo sapiens] 47 0.001
gi|7549210|gb|AAF63787.1| 200 kDa antigen p200 [Babesia bigemina] 47 0.001
gi|20521117|dbj|BAA31617.2| KIAA0642 protein [Homo sapiens] 47 0.001
gi|39597982|emb|CAE68674.1| Hypothetical protein CBG14578 [Caeno... 47 0.001
gi|34485676|gb|AAQ73223.1| M protein [Streptococcus pyogenes] 47 0.001
gi|15223730|ref|NP_177804.1| expressed protein [Arabidopsis thal... 47 0.001
gi|7513109|pir||T00377 KIAA0642 protein - human (fragment) 47 0.001
gi|19879404|gb|AAK85118.1| non-muscle myosin II heavy chain [Lol... 47 0.001
gi|50290531|ref|XP_447697.1| unnamed protein product [Candida gl... 47 0.001
gi|34222508|sp|Q15075|EEA1_HUMAN Early endosome antigen 1 (Endos... 47 0.001
gi|41386711|ref|NP_777152.1| myosin, heavy polypeptide 7, cardia... 47 0.001
gi|34485678|gb|AAQ73224.1| M protein [Streptococcus pyogenes] 47 0.001
gi|23509035|ref|NP_701703.1| hypothetical protein [Plasmodium fa... 47 0.001
gi|32564490|ref|NP_497575.2| C.Elegans Homeobox (ceh-44) [Caenor... 47 0.001
gi|34485656|gb|AAQ73213.1| M protein [Streptococcus pyogenes] 47 0.001
gi|39580539|emb|CAE74671.1| Hypothetical protein CBG22473 [Caeno... 47 0.001
gi|10863905|ref|NP_004230.1| thyroid hormone receptor interactor... 47 0.001
gi|37595274|gb|AAQ94522.1| M protein [Streptococcus pyogenes] 47 0.001
gi|7023190|dbj|BAA91873.1| unnamed protein product [Homo sapiens] 47 0.001
gi|13925868|gb|AAK49449.1| chloroquine resistance marker protein... 47 0.001
gi|9858781|gb|AAG01128.1| BAC19.13 [Lycopersicon esculentum] 47 0.001
gi|40849892|gb|AAR95658.1| plectin 4 [Rattus norvegicus] >gnl|BL... 47 0.001
gi|48894043|ref|ZP_00327241.1| COG0419: ATPase involved in DNA r... 47 0.001
gi|40849886|gb|AAR95655.1| plectin 1 [Rattus norvegicus] 47 0.001
gi|46431250|gb|EAK90848.1| hypothetical protein CaO19.2629 [Cand... 47 0.001
gi|50548765|ref|XP_501852.1| hypothetical protein [Yarrowia lipo... 47 0.001
gi|45384404|ref|NP_990273.1| restin [Gallus gallus] >gnl|BL_ORD_... 47 0.001
gi|48868119|ref|ZP_00321500.1| COG3264: Small-conductance mechan... 47 0.001
gi|27468347|ref|NP_764984.1| FmtB protein [Staphylococcus epider... 47 0.001
gi|47223930|emb|CAG06107.1| unnamed protein product [Tetraodon n... 47 0.001
gi|547974|sp|P35417|MYSP_ECHGR Paramyosin >gnl|BL_ORD_ID|365607 ... 47 0.001
gi|625305|pir||A61231 myosin heavy chain nonmuscle form A - human 47 0.001
gi|34365255|emb|CAE45965.1| hypothetical protein [Homo sapiens] 47 0.001
gi|28872861|ref|NP_055987.1| HBxAg transactivated protein 2 [Hom... 47 0.001
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 47 0.001
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628... 47 0.001
gi|50284899|ref|XP_444877.1| unnamed protein product [Candida gl... 47 0.001
gi|24308155|ref|NP_060473.1| uveal autoantigen with coiled-coil ... 47 0.001
gi|20521940|dbj|BAB13387.2| KIAA1561 protein [Homo sapiens] 47 0.001
gi|39596479|emb|CAE63098.1| Hypothetical protein CBG07389 [Caeno... 47 0.001
gi|15606061|ref|NP_213438.1| chromosome assembly protein homolog... 47 0.001
gi|40849890|gb|AAR95657.1| plectin 3 [Rattus norvegicus] 47 0.001
gi|42761515|gb|AAS45333.1| similar to coiled-coil protein involv... 47 0.001
gi|40849904|gb|AAR95664.1| plectin 10 [Rattus norvegicus] 47 0.001
gi|40849896|gb|AAR95660.1| plectin 6 [Rattus norvegicus] 47 0.001
gi|280512|pir||B42771 reticulocyte-binding protein 2 - Plasmodiu... 47 0.001
gi|12240158|gb|AAG49576.1| uveal autoantigen [Bos taurus] 47 0.001
gi|189036|gb|AAA36349.1| nonmuscle myosin heavy chain (NMHC) 47 0.001
gi|40849888|gb|AAR95656.1| plectin 2 [Rattus norvegicus] 47 0.001
gi|46852193|ref|NP_083596.2| progesterone-induced blocking facto... 47 0.001
gi|23613480|ref|NP_703324.1| glutamic acid-rich protein (garp) [... 47 0.001
gi|40849898|gb|AAR95661.1| plectin 7 [Rattus norvegicus] 47 0.001
gi|1168461|sp|P21249|ANT1_ONCVO MAJOR ANTIGEN >gnl|BL_ORD_ID|167... 47 0.001
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 47 0.001
gi|19112308|ref|NP_595516.1| hypothetical protein [Schizosacchar... 47 0.001
gi|23613070|ref|NP_703392.1| hypothetical protein [Plasmodium fa... 47 0.001
gi|40849906|gb|AAR95665.1| plectin 11 [Rattus norvegicus] 47 0.001
gi|40849900|gb|AAR95662.1| plectin 8 [Rattus norvegicus] 47 0.001
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738... 47 0.001
gi|49483684|ref|YP_040908.1| hypothetical phage protein [Staphyl... 47 0.001
gi|7512169|pir||T14156 kinesin-related protein - African clawed ... 46 0.002
gi|15208041|dbj|BAB63045.1| hypothetical protein [Macaca fascicu... 46 0.002
gi|13897506|gb|AAK48418.1| chloroquine resistance marker protein... 46 0.002
gi|15644749|ref|NP_206919.1| hypothetical protein HP0119 [Helico... 46 0.002
gi|191622|gb|AAA37161.1| alpha cardiac myosin heavy chain 46 0.002
gi|191618|gb|AAA37159.1| alpha cardiac myosin heavy chain 46 0.002
gi|28972331|dbj|BAC65619.1| mKIAA0642 protein [Mus musculus] 46 0.002
gi|6754774|ref|NP_034986.1| myosin, heavy polypeptide 6, cardiac... 46 0.002
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp... 46 0.002
gi|48133166|ref|XP_393334.1| similar to myosin heavy chain 2, mu... 46 0.002
gi|34365797|ref|NP_666224.2| Grb10 interacting GYF protein 2 [Mu... 46 0.002
gi|7498955|pir||T34418 hypothetical protein F12F3.3 - Caenorhabd... 46 0.002
gi|25149352|ref|NP_741539.1| myosin heavy chain (5G32) [Caenorha... 46 0.002
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans] 46 0.002
gi|23129471|ref|ZP_00111298.1| COG0419: ATPase involved in DNA r... 46 0.002
gi|23509685|ref|NP_702352.1| chloroquine resistance marker prote... 46 0.002
gi|17559578|ref|NP_504584.1| immunoglobulin-like and fibronectin... 46 0.002
gi|50730414|ref|XP_416892.1| PREDICTED: similar to cp431 [Gallus... 46 0.002
gi|48106337|ref|XP_396089.1| similar to CG5020-PB [Apis mellifera] 46 0.002
gi|50407251|ref|XP_456697.1| unnamed protein product [Debaryomyc... 46 0.002
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697... 46 0.002
gi|50557322|ref|XP_506069.1| hypothetical protein [Yarrowia lipo... 46 0.002
gi|50288085|ref|XP_446471.1| unnamed protein product [Candida gl... 46 0.002
gi|15207873|dbj|BAB62961.1| hypothetical protein [Macaca fascicu... 46 0.002
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans] 46 0.002
gi|50256044|gb|EAL18771.1| hypothetical protein CNBI0320 [Crypto... 46 0.002
gi|111999|pir||S21801 myosin heavy chain, neuronal [similarity] ... 46 0.002
gi|46138911|ref|XP_391146.1| hypothetical protein FG10970.1 [Gib... 46 0.002
gi|39581964|emb|CAE73826.1| Hypothetical protein CBG21388 [Caeno... 46 0.002
gi|5817598|gb|AAD52842.1| myosin heavy chain [Pecten maximus] 46 0.002
gi|13925866|gb|AAK49448.1| chloroquine resistance marker protein... 46 0.002
gi|7305145|ref|NP_038580.1| hyaluronan mediated motility recepto... 46 0.002
gi|47606316|sp|Q9LME2|YCO2_ARATH Hypothetical protein At1g22260 ... 46 0.002
gi|2135413|pir||JC5016 hyaluronan receptor - human 46 0.002
gi|1657698|gb|AAC52049.1| hyaluronan receptor [Homo sapiens] 46 0.002
gi|31874811|emb|CAD98095.1| hypothetical protein [Homo sapiens] 46 0.002
gi|1495187|emb|CAA45849.1| HA receptor for hyaluronic acid [Mus ... 46 0.002
gi|50555962|ref|XP_505389.1| hypothetical protein [Yarrowia lipo... 46 0.002
gi|23482863|gb|EAA18721.1| glutamine-asparagine rich protein [Pl... 46 0.002
gi|41322921|ref|NP_958788.1| plectin 1 isoform 3 [Mus musculus] ... 46 0.002
gi|32408291|ref|XP_324627.1| hypothetical protein [Neurospora cr... 46 0.002
gi|7108351|ref|NP_036617.1| hyaluronan-mediated motility recepto... 46 0.002
gi|30687788|ref|NP_173645.2| expressed protein [Arabidopsis thal... 46 0.002
gi|7511962|pir||T13030 microtubule binding protein D-CLIP-190 - ... 46 0.002
gi|2506984|sp|P12957|CALD_CHICK Caldesmon (CDM) >gnl|BL_ORD_ID|7... 46 0.002
gi|41322941|ref|NP_958796.1| plectin 1 isoform 11 [Mus musculus]... 46 0.002
gi|41322935|ref|NP_958793.1| plectin 1 isoform 8 [Mus musculus] ... 46 0.002
gi|45185754|ref|NP_983470.1| ACR068Wp [Eremothecium gossypii] >g... 46 0.002
gi|7108349|ref|NP_036616.1| hyaluronan-mediated motility recepto... 46 0.002
gi|41322931|ref|NP_958791.1| plectin 1 isoform 6 [Mus musculus] ... 46 0.002
gi|14272316|emb|CAC39624.1| bA555G22.2 (PIBF1 protein) [Homo sap... 46 0.002
gi|39590030|emb|CAE61028.1| Hypothetical protein CBG04771 [Caeno... 46 0.002
gi|12060489|dbj|BAB20630.1| myosin heavy chain slow isoform [Sus... 46 0.002
gi|41322933|ref|NP_958792.1| plectin 1 isoform 7 [Mus musculus] ... 46 0.002
gi|41322939|ref|NP_958795.1| plectin 1 isoform 10 [Mus musculus]... 46 0.002
gi|23124291|ref|ZP_00106289.1| COG1196: Chromosome segregation A... 46 0.002
gi|1495186|emb|CAA45848.1| HA receptor for hyaluronic acid [Mus ... 46 0.002
gi|17507323|ref|NP_492340.1| microfibrillar-associated protein 1... 46 0.002
gi|41322904|ref|NP_035247.1| plectin 1 isoform 1 [Mus musculus] ... 46 0.002
gi|41322925|ref|NP_958787.1| plectin 1 isoform 2 [Mus musculus] ... 46 0.002
gi|38077811|ref|XP_128277.4| similar to plectin [Mus musculus] 46 0.002
gi|41322927|ref|NP_958789.1| plectin 1 isoform 4 [Mus musculus] ... 46 0.002
gi|127774|sp|P08799|MYS2_DICDI Myosin II heavy chain, non muscle... 46 0.002
gi|49092680|ref|XP_407801.1| hypothetical protein AN3664.2 [Aspe... 46 0.002
gi|50405259|ref|YP_054351.1| Guanylate nucleotide binding protei... 46 0.002
gi|46228298|gb|EAK89197.1| hypothetical protein with signal pept... 46 0.002
gi|47210347|emb|CAF90604.1| unnamed protein product [Tetraodon n... 46 0.002
gi|21283119|ref|NP_646207.1| hypothetical protein [Staphylococcu... 46 0.002
gi|21359767|gb|AAM49603.1| phi12 tail fiber protein-like protein... 46 0.002
gi|29028657|ref|NP_803346.1| tail fiber protein [Staphylococcus ... 46 0.002
gi|3041706|sp|P13533|MYH6_HUMAN Myosin heavy chain, cardiac musc... 45 0.003
gi|27764861|ref|NP_002462.1| myosin heavy chain 6; myosin heavy ... 45 0.003
gi|50744526|ref|XP_419763.1| PREDICTED: similar to chromosome 6 ... 45 0.003
gi|46309352|ref|YP_006242.1| ORF102 [Agrotis segetum granuloviru... 45 0.003
gi|46437637|gb|EAK96980.1| hypothetical protein CaO19.9753 [Cand... 45 0.003
gi|37515173|gb|AAQ91890.1| Hypothetical protein ZC8.4d [Caenorha... 45 0.003
gi|38081072|ref|XP_359049.1| similar to myosin heavy chain [Mus ... 45 0.003
gi|37722427|gb|AAN72832.1| LOK-like protein kinase [Schistosoma ... 45 0.003
gi|24640147|ref|NP_572325.1| CG3950-PA [Drosophila melanogaster]... 45 0.003
gi|4165079|gb|AAD08670.1| hyaluronan receptor RHAMMV5 [Mus muscu... 45 0.003
gi|2137408|pir||JC4298 hyaluronan receptor - mouse 45 0.003
gi|39585816|emb|CAE61229.1| Hypothetical protein CBG05028 [Caeno... 45 0.003
gi|47226425|emb|CAG08441.1| unnamed protein product [Tetraodon n... 45 0.003
gi|24643074|ref|NP_573311.1| CG15040-PA [Drosophila melanogaster... 45 0.003
gi|50289285|ref|XP_447073.1| unnamed protein product [Candida gl... 45 0.003
gi|17556164|ref|NP_497576.1| C.Elegans Homeobox (ceh-44) [Caenor... 45 0.003
gi|13540714|ref|NP_071796.1| plectin [Rattus norvegicus] >gnl|BL... 45 0.003
gi|17532007|ref|NP_495360.1| CD2-binding protein, GYF (2G981) [C... 45 0.003
gi|47222386|emb|CAG05135.1| unnamed protein product [Tetraodon n... 45 0.003
gi|46228483|gb|EAK89353.1| hypothetical protein cgd8_1380 [Crypt... 45 0.003
gi|22328978|ref|NP_680744.1| protein transport protein-related [... 45 0.003
gi|7510855|pir||T29999 hypothetical protein ZC8.4 - Caenorhabdit... 45 0.003
gi|31979233|gb|AAP60023.1| T-lymphocyte triggering factor [Trypa... 45 0.003
gi|24583666|ref|NP_524993.2| CG6392-PA [Drosophila melanogaster]... 45 0.003
gi|17570563|ref|NP_508847.1| major antigen like (XF611) [Caenorh... 45 0.003
gi|38079956|ref|XP_356900.1| similar to KIAA1000 protein [Mus mu... 45 0.003
gi|25151529|ref|NP_508848.2| major antigen like (273.8 kD) (XF61... 45 0.003
gi|23509474|ref|NP_702141.1| hypothetical protein [Plasmodium fa... 45 0.003
gi|39939179|ref|NP_950945.1| chromosome segregation ATPase homol... 45 0.003
gi|17558914|ref|NP_506120.1| predicted CDS, filamentous hemagglu... 45 0.003
gi|15673882|ref|NP_268057.1| hypothetical protein L150593 [Lacto... 45 0.003
gi|17945313|gb|AAL48713.1| RE15724p [Drosophila melanogaster] 45 0.003
gi|21428694|gb|AAM50007.1| SD02391p [Drosophila melanogaster] 45 0.003
gi|24649646|ref|NP_651250.2| CG17785-PA [Drosophila melanogaster... 45 0.003
gi|3915779|sp|P13539|MYH6_MESAU Myosin heavy chain, cardiac musc... 45 0.004
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 45 0.004
gi|23509493|ref|NP_702160.1| hypothetical protein [Plasmodium fa... 45 0.004
gi|50550759|ref|XP_502852.1| hypothetical protein [Yarrowia lipo... 45 0.004
gi|17555886|ref|NP_499742.1| kinesin-like protein (123.1 kD) (kl... 45 0.004
gi|32423201|ref|XP_332038.1| predicted protein [Neurospora crass... 45 0.004
gi|32405360|ref|XP_323293.1| hypothetical protein [Neurospora cr... 45 0.004
gi|39584348|emb|CAE65512.1| Hypothetical protein CBG10486 [Caeno... 45 0.004
gi|23612343|ref|NP_703923.1| hypothetical protein [Plasmodium fa... 45 0.004
gi|23508287|ref|NP_700956.1| hypothetical protein [Plasmodium fa... 45 0.004
gi|34876633|ref|XP_237176.2| similar to tripin [Rattus norvegicus] 45 0.004
gi|47227314|emb|CAF96863.1| unnamed protein product [Tetraodon n... 45 0.004
gi|48893180|ref|ZP_00326449.1| COG1196: Chromosome segregation A... 45 0.004
gi|45199215|ref|NP_986244.1| AFR696Cp [Eremothecium gossypii] >g... 45 0.004
gi|1076872|pir||S51622 cut3 protein - fission yeast (Schizosacch... 45 0.004
gi|19112184|ref|NP_595392.1| chromosome segregation protein cut3... 45 0.004
gi|47211645|emb|CAF92169.1| unnamed protein product [Tetraodon n... 45 0.004
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut... 45 0.004
gi|382658|prf||1819485A CENP-E protein 45 0.004
gi|32129448|sp|Q9BE52|C5P2_MACFA CDK5 regulatory subunit associa... 45 0.004
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor... 45 0.004
gi|6325152|ref|NP_015220.1| Hypothetical ORF; Ypl105cp [Saccharo... 45 0.004
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 45 0.004
gi|4503469|ref|NP_003557.1| early endosome antigen 1, 162kD; ear... 45 0.005
gi|46447657|ref|YP_009022.1| hypothetical protein pc2023 [Parach... 45 0.005
gi|42520333|ref|NP_966248.1| hypothetical protein WD0462 [Wolbac... 45 0.005
gi|21389475|ref|NP_653244.1| hypothetical protein FLJ30655 [Homo... 45 0.005
gi|11276951|pir||A59287 myosin heavy chain - fluke (Schistosoma ... 45 0.005
gi|46229708|gb|EAK90526.1| protein with similarity to Gle1l prot... 45 0.005
gi|34909558|ref|NP_916126.1| P0046E05.10 [Oryza sativa (japonica... 45 0.005
gi|46118844|ref|ZP_00175702.2| COG1196: Chromosome segregation A... 45 0.005
gi|386970|gb|AAA60385.1| myosin heavy chain beta-subunit 45 0.005
gi|42567462|ref|NP_195370.2| trichohyalin-related [Arabidopsis t... 45 0.005
gi|33114142|gb|AAP94699.1| putative cointegrate resolution prote... 45 0.005
gi|50419075|ref|XP_458060.1| unnamed protein product [Debaryomyc... 45 0.005
gi|188986|gb|AAA36343.1| myosin heavy chain >gnl|BL_ORD_ID|11917... 45 0.005
gi|47550961|ref|NP_999654.1| myosin VI [Strongylocentrotus purpu... 45 0.005
gi|34785442|gb|AAH57524.1| LOC402861 protein [Danio rerio] 45 0.005
gi|39585444|emb|CAE70527.1| Hypothetical protein CBG17156 [Caeno... 45 0.005
gi|28828361|gb|AAO51011.1| similar to Homo sapiens (Human). Hypo... 45 0.005
gi|42518195|ref|NP_964125.1| hypothetical protein LJ0109 [Lactob... 45 0.005
gi|23508432|ref|NP_701101.1| hypothetical protein [Plasmodium fa... 45 0.005
gi|47207894|emb|CAF96614.1| unnamed protein product [Tetraodon n... 45 0.005
gi|19115027|ref|NP_594115.1| coiled coil protein [Schizosaccharo... 45 0.005
gi|47229656|emb|CAG06852.1| unnamed protein product [Tetraodon n... 45 0.005
gi|25407733|pir||B85431 trichohyalin like protein [imported] - A... 45 0.005
gi|21398428|ref|NP_654413.1| ERM, Ezrin/radixin/moesin family [B... 45 0.005
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 45 0.005
gi|30260639|ref|NP_843016.1| prophage LambdaBa04, tape measure p... 45 0.005
gi|42561539|ref|NP_975990.1| Conserved hypothetical protein [Myc... 45 0.005
>gi|17551776|ref|NP_497884.1| putative nuclear protein family member,
with 3 coiled coil-4 domains (3F473) [Caenorhabditis
elegans]
gi|630585|pir||S43560 coiled coil protein B0284.4 - Caenorhabditis
elegans
gi|3873686|emb|CAA83223.1| Hypothetical protein B0284.2
[Caenorhabditis elegans]
Length = 424
Score = 831 bits (2147), Expect = 0.0
Identities = 424/424 (100%), Positives = 424/424 (100%)
Frame = +1
Query: 1 MSGGNSADKKAIADDLRQNAIEDENRRRRQIEAFQAIEDRQKNASAEIRLKQMESVVAIQ 180
MSGGNSADKKAIADDLRQNAIEDENRRRRQIEAFQAIEDRQKNASAEIRLKQMESVVAIQ
Sbjct: 1 MSGGNSADKKAIADDLRQNAIEDENRRRRQIEAFQAIEDRQKNASAEIRLKQMESVVAIQ 60
Query: 181 KQQDEARNRMLEQNQKILTESRTREDSIRAQQEQNERDTISHENDLIDRQRTVNLSEITK 360
KQQDEARNRMLEQNQKILTESRTREDSIRAQQEQNERDTISHENDLIDRQRTVNLSEITK
Sbjct: 61 KQQDEARNRMLEQNQKILTESRTREDSIRAQQEQNERDTISHENDLIDRQRTVNLSEITK 120
Query: 361 RFTNHQNLMTREQGRLAETEIRNEKNLVDMKNQLAETQDNLNEDKKAYHEEKIQKSAENA 540
RFTNHQNLMTREQGRLAETEIRNEKNLVDMKNQLAETQDNLNEDKKAYHEEKIQKSAENA
Sbjct: 121 RFTNHQNLMTREQGRLAETEIRNEKNLVDMKNQLAETQDNLNEDKKAYHEEKIQKSAENA 180
Query: 541 SQLEVLVSETNELIIQKDKNVLLQKETLMRIEKNAIENKGKVLIARGDDDNEQNFIDAVN 720
SQLEVLVSETNELIIQKDKNVLLQKETLMRIEKNAIENKGKVLIARGDDDNEQNFIDAVN
Sbjct: 181 SQLEVLVSETNELIIQKDKNVLLQKETLMRIEKNAIENKGKVLIARGDDDNEQNFIDAVN 240
Query: 721 SIRQKGYAVSDIISRLGEHAYCLHKGHSVHSVKNDVFKCSKALGQAKLKLGQLRDDVNHL 900
SIRQKGYAVSDIISRLGEHAYCLHKGHSVHSVKNDVFKCSKALGQAKLKLGQLRDDVNHL
Sbjct: 241 SIRQKGYAVSDIISRLGEHAYCLHKGHSVHSVKNDVFKCSKALGQAKLKLGQLRDDVNHL 300
Query: 901 LGHQESRNSGVPVCHDAARQIEEAIKELETSLNKFKGSLNGKNSIELYENVLEKNKNLTG 1080
LGHQESRNSGVPVCHDAARQIEEAIKELETSLNKFKGSLNGKNSIELYENVLEKNKNLTG
Sbjct: 301 LGHQESRNSGVPVCHDAARQIEEAIKELETSLNKFKGSLNGKNSIELYENVLEKNKNLTG 360
Query: 1081 KIHGLPSLVKSNYTLNAIQNGFQSICAVNGNHVASLEQTTTLALQEKKHGNRETSEHCPD 1260
KIHGLPSLVKSNYTLNAIQNGFQSICAVNGNHVASLEQTTTLALQEKKHGNRETSEHCPD
Sbjct: 361 KIHGLPSLVKSNYTLNAIQNGFQSICAVNGNHVASLEQTTTLALQEKKHGNRETSEHCPD 420
Query: 1261 DPKN 1272
DPKN
Sbjct: 421 DPKN 424