Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= B0286_5
         (954 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17531281|ref|NP_494772.1| transcription complex (48.1 kD) (2E...   561   e-159
gi|17531279|ref|NP_494773.1| transcription complex (2E664) [Caen...   561   e-159
gi|17531277|ref|NP_494774.1| transcription complex (34.7 kD) (2E...   561   e-159
gi|39595094|emb|CAE60131.1| Hypothetical protein CBG03676 [Caeno...   478   e-133
gi|49115752|gb|AAH73075.1| Unknown (protein for IMAGE:5156126) [...   194   2e-48
gi|7020899|dbj|BAA91313.1| unnamed protein product [Homo sapiens]     194   3e-48
gi|11640600|gb|AAG39297.1| MSTP046 [Homo sapiens]                     194   3e-48
gi|38649289|gb|AAH63105.1| Cnot2 protein [Mus musculus]               194   3e-48
gi|21312480|ref|NP_082358.1| CCR4-NOT transcription complex, sub...   194   3e-48
gi|34864872|ref|XP_216889.2| similar to CCR4-NOT transcription c...   194   3e-48
gi|26346971|dbj|BAC37134.1| unnamed protein product [Mus musculus]    194   3e-48
gi|46395846|sp|Q8C5L3|CNO2_MOUSE CCR4-NOT transcription complex ...   194   3e-48
gi|7657385|ref|NP_055330.1| CCR4-NOT transcription complex, subu...   194   3e-48
gi|29144934|gb|AAH43133.1| Cnot2 protein [Mus musculus]               191   2e-47
gi|47225772|emb|CAF98252.1| unnamed protein product [Tetraodon n...   189   6e-47
gi|31208601|ref|XP_313267.1| ENSANGP00000010439 [Anopheles gambi...   182   1e-44
gi|31196769|ref|XP_307332.1| ENSANGP00000013681 [Anopheles gambi...   182   1e-44
gi|34365441|emb|CAE46054.1| hypothetical protein [Homo sapiens]       174   2e-42
gi|20151531|gb|AAM11125.1| GM14102p [Drosophila melanogaster]         168   1e-40
gi|1658504|gb|AAB18342.1| Rga [Drosophila melanogaster]               167   2e-40
gi|24644318|ref|NP_524239.2| CG2161-PB [Drosophila melanogaster]...   167   2e-40
gi|24644320|ref|NP_730966.1| CG2161-PA [Drosophila melanogaster]...   167   2e-40
gi|6841484|gb|AAF29095.1| HSPC131 [Homo sapiens]                      157   4e-37
gi|11360112|pir||T46494 hypothetical protein DKFZp434M0572.1 - h...   144   4e-33
gi|49067697|ref|XP_398138.1| hypothetical protein UM00523.1 [Ust...   113   7e-24
gi|47497412|dbj|BAD19449.1| putative CCR4-NOT transcription comp...   112   9e-24
gi|50547551|ref|XP_501245.1| hypothetical protein [Yarrowia lipo...   103   6e-21
gi|18424272|ref|NP_568912.1| transcription regulator NOT2/NOT3/N...    96   1e-18
gi|25406997|pir||B86212 protein F24B9.20 [imported] - Arabidopsi...    94   6e-18
gi|39594574|emb|CAE72152.1| Hypothetical protein CBG19250 [Caeno...    91   4e-17
gi|46575971|gb|AAT01332.1| unknown protein [Oryza sativa (japoni...    89   2e-16
gi|17560922|ref|NP_505410.1| transcription complex like (56.0 kD...    89   2e-16
gi|17560920|ref|NP_505409.1| transcription complex like (5J807) ...    89   2e-16
gi|50426537|ref|XP_461865.1| unnamed protein product [Debaryomyc...    87   4e-16
gi|19075323|ref|NP_587823.1| hypothetical protein [Schizosacchar...    86   2e-15
gi|23508488|ref|NP_701157.1| hypothetical protein [Plasmodium fa...    86   2e-15
gi|32398828|emb|CAD98538.1| f24b9.20, possible [Cryptosporidium ...    85   2e-15
gi|46229290|gb|EAK90139.1| CCR4-NOT transcription complex, subun...    85   2e-15
gi|23477974|gb|EAA15186.1| Drosophila melanogaster CG15040 gene ...    84   4e-15
gi|46440728|gb|EAL00031.1| hypothetical protein CaO19.13496 [Can...    83   1e-14
gi|38103743|gb|EAA50410.1| hypothetical protein MG04169.4 [Magna...    82   2e-14
gi|46121443|ref|XP_385276.1| hypothetical protein FG05100.1 [Gib...    82   2e-14
gi|47212275|emb|CAF89507.1| unnamed protein product [Tetraodon n...    79   1e-13
gi|18390801|ref|NP_563795.1| NOT2/NOT3/NOT5 family protein [Arab...    78   3e-13
gi|19921380|ref|NP_609750.1| CG15262-PA [Drosophila melanogaster...    76   1e-12
gi|29788854|gb|AAP03400.1| putative transcriptional regulator [O...    75   2e-12
gi|50259574|gb|EAL22247.1| hypothetical protein CNBC3850 [Crypto...    73   1e-11
gi|18958723|gb|AAL82704.1| Tcc1a22.4 [Trypanosoma cruzi]               69   2e-10
gi|10801662|dbj|BAB16748.1| hypothetical protein [Macaca fascicu...    67   5e-10
gi|6320036|ref|NP_010116.1| Component of the CCR4-NOT complex, w...    67   6e-10
gi|45185537|ref|NP_983253.1| ACL151Cp [Eremothecium gossypii] >g...    67   6e-10
gi|50289927|ref|XP_447395.1| unnamed protein product [Candida gl...    66   1e-09
gi|50307273|ref|XP_453615.1| unnamed protein product [Kluyveromy...    66   1e-09
gi|24661136|ref|NP_648253.1| CG6576-PA [Drosophila melanogaster]...    65   2e-09
gi|49097150|ref|XP_410035.1| hypothetical protein AN5898.2 [Aspe...    61   3e-08
gi|32415802|ref|XP_328379.1| hypothetical protein [Neurospora cr...    55   2e-06
gi|32405122|ref|XP_323174.1| hypothetical protein [Neurospora cr...    52   3e-05
gi|38111573|gb|EAA57132.1| hypothetical protein MG08101.4 [Magna...    50   6e-05
gi|49094522|ref|XP_408722.1| hypothetical protein AN4585.2 [Aspe...    50   7e-05
gi|50257584|gb|EAL20289.1| hypothetical protein CNBF1010 [Crypto...    50   7e-05
gi|19115701|ref|NP_594789.1| putative transcriptional regulator ...    50   1e-04
gi|49081140|ref|XP_404010.1| hypothetical protein UM06395.1 [Ust...    49   1e-04
gi|50552432|ref|XP_503626.1| hypothetical protein [Yarrowia lipo...    49   2e-04
gi|31712091|gb|AAP68395.1| unknown protein [Oryza sativa (japoni...    47   6e-04
gi|33337550|gb|AAQ13426.1| unknown [Homo sapiens]                      47   6e-04
gi|50728332|ref|XP_416093.1| PREDICTED: similar to CCR4-NOT tran...    47   6e-04
gi|47221630|emb|CAF97895.1| unnamed protein product [Tetraodon n...    47   8e-04
gi|39584830|emb|CAE67725.1| Hypothetical protein CBG13300 [Caeno...    46   0.001
gi|50418265|gb|AAH77869.1| Unknown (protein for MGC:80612) [Xeno...    46   0.001
gi|17552240|ref|NP_499534.1| NOT-like, component of CCR4/NOT com...    46   0.001
gi|30424361|emb|CAD90172.1| Hypothetical protein Y56A3A.1 [Caeno...    46   0.001
gi|20818453|ref|XP_133124.1| similar to CCR4-NOT transcription c...    45   0.002
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi...    45   0.002
gi|22122717|ref|NP_666288.1| CCR4-NOT transcription complex, sub...    45   0.002
gi|34854462|ref|XP_218187.2| similar to CCR4-NOT transcription c...    45   0.002
gi|50510591|dbj|BAD32281.1| mKIAA0691 protein [Mus musculus]           45   0.002
gi|9758905|dbj|BAB09481.1| unnamed protein product [Arabidopsis ...    45   0.002
gi|13877645|gb|AAK43900.1| Unknown protein [Arabidopsis thaliana...    45   0.002
gi|18418549|ref|NP_568361.1| transcription regulator NOT2/NOT3/N...    45   0.002
gi|40788331|dbj|BAA31666.2| KIAA0691 protein [Homo sapiens]            45   0.003
gi|7657387|ref|NP_055331.1| CCR4-NOT transcription complex, subu...    45   0.003
gi|23507866|ref|NP_700536.1| hypothetical protein [Plasmodium fa...    45   0.003
gi|31238470|ref|XP_319780.1| ENSANGP00000005181 [Anopheles gambi...    44   0.004
gi|28372046|emb|CAD66421.1| putative transcriptional regulator [...    44   0.005
gi|19921660|ref|NP_610176.1| CG8426-PA [Drosophila melanogaster]...    44   0.005
gi|38000001|gb|AAR07088.1| unknown protein [Oryza sativa (japoni...    44   0.005
gi|29788870|gb|AAP03416.1| unknown protein [Oryza sativa (japoni...    44   0.005
gi|19074402|ref|NP_585908.1| hypothetical protein [Encephalitozo...    43   0.009
gi|23483044|gb|EAA18843.1| hypothetical protein [Plasmodium yoel...    43   0.009
gi|19075115|ref|NP_586716.1| GENERAL NEGATIVE REGULATOR OF TRANS...    40   0.077
gi|23502904|ref|NP_699031.1| ABC transporter, ATP-binding protei...    38   0.38
gi|17986296|ref|NP_538930.1| ABC TRANSPORTER ATP-BINDING PROTEIN...    38   0.38
gi|50292769|ref|XP_448817.1| unnamed protein product [Candida gl...    36   1.1
gi|50308279|ref|XP_454140.1| unnamed protein product [Kluyveromy...    35   2.5
gi|47211748|emb|CAF94313.1| unnamed protein product [Tetraodon n...    35   2.5
gi|50303977|ref|XP_451938.1| unnamed protein product [Kluyveromy...    35   3.2
gi|46229474|gb|EAK90292.1| regena domain protein (CCR-Not comple...    35   3.2
gi|50547389|ref|XP_501164.1| hypothetical protein [Yarrowia lipo...    34   5.5
gi|31712109|gb|AAP68413.1| hypothetical protein [Oryza sativa (j...    33   7.2
gi|6325329|ref|NP_015397.1| Subunit of the CCR4-NOT complex, whi...    33   9.5
gi|45187509|ref|NP_983732.1| ADL364Cp [Eremothecium gossypii] >g...    33   9.5


>gi|17531281|ref|NP_494772.1| transcription complex (48.1 kD) (2E664)
            [Caenorhabditis elegans]
 gi|7494836|pir||T15310 hypothetical protein B0286.4 - Caenorhabditis
            elegans
 gi|1053220|gb|AAA80691.1| Not-like (yeast ccr4/not complex component)
            protein 2, isoform a [Caenorhabditis elegans]
          Length = 444

 Score =  561 bits (1447), Expect = e-159
 Identities = 276/317 (87%), Positives = 276/317 (87%)
 Frame = -1

Query: 954  MLADDHQVDFAGPLGDCDPSRLSGISRNSQEGPMHGIITHPDGEVTNIPASMLDDQFGMA 775
            MLADDHQVDFAGPLGDCDPSRLSGISRNSQEGPMHGIITHPDGEVTNIPASMLDDQFGMA
Sbjct: 128  MLADDHQVDFAGPLGDCDPSRLSGISRNSQEGPMHGIITHPDGEVTNIPASMLDDQFGMA 187

Query: 774  GLVTYLRTVDNPSIVSLALGYDLTTLGLNLNLSERKLYMNFGGPWADSPIRAHELDVKVP 595
            GLVTYLRTVDNPSIVSLALGYDLTTLGLNLNLSERKLYMNFGGPWADSPIRAHELDVKVP
Sbjct: 188  GLVTYLRTVDNPSIVSLALGYDLTTLGLNLNLSERKLYMNFGGPWADSPIRAHELDVKVP 247

Query: 594  EEYMTHNHIRDKLPPLRLNKVSEDVLFYLFYNCPNEIYQVAAACELYAREWRFHKSEQVW 415
            EEYMTHNHIRDKLPPLRLNKVSEDVLFYLFYNCPNEIYQVAAACELYAREWRFHKSEQVW
Sbjct: 248  EEYMTHNHIRDKLPPLRLNKVSEDVLFYLFYNCPNEIYQVAAACELYAREWRFHKSEQVW 307

Query: 414  LTRSQYGGVKEQTGNYEKGHYNVFDQMQWRKIPXXXXXXXXXXEDRPKMPQSVSGQPTPY 235
            LTRSQYGGVKEQTGNYEKGHYNVFDQMQWRKIP          EDRPKMPQSVSGQPTPY
Sbjct: 308  LTRSQYGGVKEQTGNYEKGHYNVFDQMQWRKIPKELKLEYKELEDRPKMPQSVSGQPTPY 367

Query: 234  KYFFQGPQFPSGPETGLMLQMHNXXXXXXXXXXGQITPPAPXXXXXXXXXXXXXXXXXXX 55
            KYFFQGPQFPSGPETGLMLQMHN          GQITPPAP
Sbjct: 368  KYFFQGPQFPSGPETGLMLQMHNLTLGTGGGGGGQITPPAPAGLNGVMGGGGVGAAGIGG 427

Query: 54   XXVQPGAVPSAARATPN 4
              VQPGAVPSAARATPN
Sbjct: 428  INVQPGAVPSAARATPN 444


>gi|17531279|ref|NP_494773.1| transcription complex (2E664)
            [Caenorhabditis elegans]
 gi|15963714|gb|AAL11099.1| Not-like (yeast ccr4/not complex
            component) protein 2, isoform b [Caenorhabditis elegans]
          Length = 367

 Score =  561 bits (1447), Expect = e-159
 Identities = 276/317 (87%), Positives = 276/317 (87%)
 Frame = -1

Query: 954  MLADDHQVDFAGPLGDCDPSRLSGISRNSQEGPMHGIITHPDGEVTNIPASMLDDQFGMA 775
            MLADDHQVDFAGPLGDCDPSRLSGISRNSQEGPMHGIITHPDGEVTNIPASMLDDQFGMA
Sbjct: 51   MLADDHQVDFAGPLGDCDPSRLSGISRNSQEGPMHGIITHPDGEVTNIPASMLDDQFGMA 110

Query: 774  GLVTYLRTVDNPSIVSLALGYDLTTLGLNLNLSERKLYMNFGGPWADSPIRAHELDVKVP 595
            GLVTYLRTVDNPSIVSLALGYDLTTLGLNLNLSERKLYMNFGGPWADSPIRAHELDVKVP
Sbjct: 111  GLVTYLRTVDNPSIVSLALGYDLTTLGLNLNLSERKLYMNFGGPWADSPIRAHELDVKVP 170

Query: 594  EEYMTHNHIRDKLPPLRLNKVSEDVLFYLFYNCPNEIYQVAAACELYAREWRFHKSEQVW 415
            EEYMTHNHIRDKLPPLRLNKVSEDVLFYLFYNCPNEIYQVAAACELYAREWRFHKSEQVW
Sbjct: 171  EEYMTHNHIRDKLPPLRLNKVSEDVLFYLFYNCPNEIYQVAAACELYAREWRFHKSEQVW 230

Query: 414  LTRSQYGGVKEQTGNYEKGHYNVFDQMQWRKIPXXXXXXXXXXEDRPKMPQSVSGQPTPY 235
            LTRSQYGGVKEQTGNYEKGHYNVFDQMQWRKIP          EDRPKMPQSVSGQPTPY
Sbjct: 231  LTRSQYGGVKEQTGNYEKGHYNVFDQMQWRKIPKELKLEYKELEDRPKMPQSVSGQPTPY 290

Query: 234  KYFFQGPQFPSGPETGLMLQMHNXXXXXXXXXXGQITPPAPXXXXXXXXXXXXXXXXXXX 55
            KYFFQGPQFPSGPETGLMLQMHN          GQITPPAP
Sbjct: 291  KYFFQGPQFPSGPETGLMLQMHNLTLGTGGGGGGQITPPAPAGLNGVMGGGGVGAAGIGG 350

Query: 54   XXVQPGAVPSAARATPN 4
              VQPGAVPSAARATPN
Sbjct: 351  INVQPGAVPSAARATPN 367


>gi|17531277|ref|NP_494774.1| transcription complex (34.7 kD)
           (2E664) [Caenorhabditis elegans]
 gi|15963715|gb|AAL11100.1| Not-like (yeast ccr4/not complex
           component) protein 2, isoform c [Caenorhabditis elegans]
          Length = 317

 Score =  561 bits (1447), Expect = e-159
 Identities = 276/317 (87%), Positives = 276/317 (87%)
 Frame = -1

Query: 954 MLADDHQVDFAGPLGDCDPSRLSGISRNSQEGPMHGIITHPDGEVTNIPASMLDDQFGMA 775
           MLADDHQVDFAGPLGDCDPSRLSGISRNSQEGPMHGIITHPDGEVTNIPASMLDDQFGMA
Sbjct: 1   MLADDHQVDFAGPLGDCDPSRLSGISRNSQEGPMHGIITHPDGEVTNIPASMLDDQFGMA 60

Query: 774 GLVTYLRTVDNPSIVSLALGYDLTTLGLNLNLSERKLYMNFGGPWADSPIRAHELDVKVP 595
           GLVTYLRTVDNPSIVSLALGYDLTTLGLNLNLSERKLYMNFGGPWADSPIRAHELDVKVP
Sbjct: 61  GLVTYLRTVDNPSIVSLALGYDLTTLGLNLNLSERKLYMNFGGPWADSPIRAHELDVKVP 120

Query: 594 EEYMTHNHIRDKLPPLRLNKVSEDVLFYLFYNCPNEIYQVAAACELYAREWRFHKSEQVW 415
           EEYMTHNHIRDKLPPLRLNKVSEDVLFYLFYNCPNEIYQVAAACELYAREWRFHKSEQVW
Sbjct: 121 EEYMTHNHIRDKLPPLRLNKVSEDVLFYLFYNCPNEIYQVAAACELYAREWRFHKSEQVW 180

Query: 414 LTRSQYGGVKEQTGNYEKGHYNVFDQMQWRKIPXXXXXXXXXXEDRPKMPQSVSGQPTPY 235
           LTRSQYGGVKEQTGNYEKGHYNVFDQMQWRKIP          EDRPKMPQSVSGQPTPY
Sbjct: 181 LTRSQYGGVKEQTGNYEKGHYNVFDQMQWRKIPKELKLEYKELEDRPKMPQSVSGQPTPY 240

Query: 234 KYFFQGPQFPSGPETGLMLQMHNXXXXXXXXXXGQITPPAPXXXXXXXXXXXXXXXXXXX 55
           KYFFQGPQFPSGPETGLMLQMHN          GQITPPAP
Sbjct: 241 KYFFQGPQFPSGPETGLMLQMHNLTLGTGGGGGGQITPPAPAGLNGVMGGGGVGAAGIGG 300

Query: 54  XXVQPGAVPSAARATPN 4
             VQPGAVPSAARATPN
Sbjct: 301 INVQPGAVPSAARATPN 317




[DB home][top]