Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= B0286_6
         (693 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|25149118|ref|NP_494776.2| putative nuclear protein, with a co...   384   e-105
gi|39595095|emb|CAE60132.1| Hypothetical protein CBG03677 [Caeno...   173   3e-42
gi|7452515|pir||T15312 hypothetical protein B0286.1 - Caenorhabd...   155   7e-37
gi|46444334|gb|EAL03609.1| hypothetical protein CaO19.9028 [Cand...    39   0.076
gi|34864963|ref|XP_345816.1| similar to RIKEN cDNA 4921537D05 [R...    38   0.17
gi|48102198|ref|XP_392753.1| similar to CG8069-PB [Apis mellifera]     38   0.17
gi|41054239|ref|NP_956084.1| Similar to RIKEN cDNA 2610015J01 ge...    38   0.17
gi|23482863|gb|EAA18721.1| glutamine-asparagine rich protein [Pl...    38   0.22
gi|23619017|ref|NP_704979.1| hypothetical protein [Plasmodium fa...    38   0.22
gi|50423813|ref|XP_460491.1| unnamed protein product [Debaryomyc...    37   0.29
gi|26325282|dbj|BAC26395.1| unnamed protein product [Mus musculus]     37   0.49
gi|23509300|ref|NP_701967.1| hypothetical protein [Plasmodium fa...    37   0.49
gi|34861086|ref|XP_342606.1| similar to neural zinc finger prote...    36   0.64
gi|5257484|gb|AAD41357.1| hsp82 heat shock protein [Tetrahymena ...    36   0.64
gi|41017406|sp|Q9DBR7|MPT1_MOUSE Protein phosphatase 1 regulator...    36   0.84
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor...    36   0.84
gi|41017251|sp|Q10728|MPT1_RAT Protein phosphatase 1 regulatory ...    36   0.84
gi|25742846|ref|NP_446342.1| myosin phosphatase, target subunit ...    36   0.84
gi|23619067|ref|NP_705029.1| hypothetical protein [Plasmodium fa...    36   0.84
gi|39592962|emb|CAE62576.1| Hypothetical protein CBG06689 [Caeno...    36   0.84
gi|38090710|ref|XP_137239.3| protein phosphatase 1, regulatory (...    36   0.84
gi|23486190|gb|EAA20743.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [...    35   1.1
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl...    35   1.1
gi|33413786|gb|AAN39450.1| normocyte binding protein 2b [Plasmod...    35   1.1
gi|33413780|gb|AAN39449.1| normocyte binding protein 2b [Plasmod...    35   1.1
gi|47565158|ref|ZP_00236201.1| spore germination protein IA [Bac...    35   1.1
gi|23480083|gb|EAA16740.1| GYF domain, putative [Plasmodium yoel...    35   1.1
gi|3929670|emb|CAA77177.1| drosocrystallin [Drosophila melanogas...    35   1.1
gi|7500635|pir||T21861 hypothetical protein F36F2.3 - Caenorhabd...    35   1.1
gi|14571694|emb|CAC42777.1| myosin heavy chain like protein [Tak...    35   1.1
gi|33413774|gb|AAN39445.1| normocyte binding protein 2a [Plasmod...    35   1.1
gi|23508138|ref|NP_700808.1| hypothetical protein [Plasmodium fa...    35   1.1
gi|2143944|pir||S68418 protein phosphatase 1M chain M110 isoform...    35   1.4
gi|23619293|ref|NP_705255.1| reticulocyte binding protein 2 homo...    35   1.4
gi|13345187|gb|AAK19244.1| reticulocyte binding protein 2 homolo...    35   1.4
gi|32490804|ref|NP_871058.1| fliK [Wigglesworthia glossinidia en...    35   1.4
gi|50290531|ref|XP_447697.1| unnamed protein product [Candida gl...    35   1.4
gi|39587947|emb|CAE67966.1| Hypothetical protein CBG13570 [Caeno...    35   1.4
gi|32422107|ref|XP_331497.1| predicted protein [Neurospora crass...    35   1.4
gi|17025966|dbj|BAB72094.1| histone acetyltransferase MORF [Maca...    35   1.4
gi|46136705|ref|XP_390044.1| hypothetical protein FG09868.1 [Gib...    35   1.9
gi|627059|pir||A45592 liver stage antigen LSA-1 - malaria parasi...    35   1.9
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her...    35   1.9
gi|38014725|gb|AAH60393.1| MGC68481 protein [Xenopus laevis]           35   1.9
gi|23486696|gb|EAA20872.1| hypothetical protein [Plasmodium yoel...    34   2.4
gi|46226433|gb|EAK87433.1| putative Sec14d [Cryptosporidium parvum]    34   2.4
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D...    34   2.4
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster...    34   2.4
gi|465434|sp|P33473|VNS2_BTV17 NONSTRUCTURAL PROTEIN NS2 >gnl|BL...    34   2.4
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul...    34   2.4
gi|39584611|emb|CAE72364.1| Hypothetical protein CBG19514 [Caeno...    34   2.4
gi|50553250|ref|XP_504035.1| hypothetical protein [Yarrowia lipo...    34   2.4
gi|7158835|gb|AAF37556.1| p101/acidic basic repeat antigen [Plas...    34   2.4
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster...    34   2.4
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster...    34   2.4
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me...    34   2.4
gi|50289331|ref|XP_447096.1| unnamed protein product [Candida gl...    34   3.2
gi|6002694|gb|AAF00099.1| histone acetyltransferase MORF alpha [...    34   3.2
gi|46431687|gb|EAK91221.1| hypothetical protein CaO19.1915 [Cand...    34   3.2
gi|18032212|gb|AAL56647.1| histone acetyltransferase MOZ2 [Homo ...    34   3.2
gi|47216644|emb|CAG04842.1| unnamed protein product [Tetraodon n...    34   3.2
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto...    34   3.2
gi|15224877|ref|NP_181971.1| DNA-binding bromodomain-containing ...    34   3.2
gi|18311089|ref|NP_563023.1| hypothetical protein CPE2107 [Clost...    34   3.2
gi|28804517|dbj|BAC57964.1| calreticulin [Bombyx mori]                 34   3.2
gi|31559109|gb|AAP50845.1| calreticulin [Bombyx mori]                  34   3.2
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno...    34   3.2
gi|17136792|ref|NP_476906.1| CG16963-PA [Drosophila melanogaster...    34   3.2
gi|29825369|gb|AAO92278.1| calreticulin [Dermacentor variabilis]       34   3.2
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat...    34   3.2
gi|7705839|ref|NP_057206.1| NY-REN-58 antigen [Homo sapiens] >gn...    34   3.2
gi|34860597|ref|XP_342346.1| similar to CENTROMERIC PROTEIN E (C...    34   3.2
gi|6912512|ref|NP_036462.1| MYST histone acetyltransferase (mono...    34   3.2
gi|42733836|gb|AAS38754.1| hypothetical protein [Dictyostelium d...    34   3.2
gi|2119757|pir||S60453 glucose starvation-induced protein precur...    34   3.2
gi|6002686|gb|AAF00095.1| histone acetyltransferase MORF [Homo s...    34   3.2
gi|33356138|ref|NP_877498.1| hypothetical protein FLJ32940 isofo...    33   4.2
gi|39581892|emb|CAE72854.1| Hypothetical protein CBG20153 [Caeno...    33   4.2
gi|28867251|ref|NP_789870.1| type I site-specific deoxyribonucle...    33   4.2
gi|23487197|gb|EAA20995.1| hypothetical protein [Plasmodium yoel...    33   4.2
gi|47229609|emb|CAG06805.1| unnamed protein product [Tetraodon n...    33   4.2
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043...    33   4.2
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n...    33   4.2
gi|23508971|ref|NP_701639.1| 101 kd malaria antigen [Plasmodium ...    33   4.2
gi|46226949|gb|EAK87915.1| Spb1p-like, FtsJ methylase, transcrip...    33   4.2
gi|34854626|ref|XP_218226.2| similar to mKIAA0287 protein [Rattu...    33   5.4
gi|31211711|ref|XP_314825.1| ENSANGP00000011098 [Anopheles gambi...    33   5.4
gi|50428778|gb|AAT77099.1| myosin 10 [Xenopus laevis]                  33   5.4
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp...    33   5.4
gi|26352726|dbj|BAC39993.1| unnamed protein product [Mus musculus]     33   5.4
gi|47211224|emb|CAF92780.1| unnamed protein product [Tetraodon n...    33   5.4
gi|38083816|ref|XP_128924.4| expressed sequence AI043120 [Mus mu...    33   5.4
gi|50732982|ref|XP_418856.1| PREDICTED: similar to Golgi autoant...    33   5.4
gi|6624128|gb|AAF19255.1|AC004858_3 U1 small ribonucleoprotein 1...    33   5.4
gi|30794168|ref|NP_083191.1| RIKEN cDNA 1200008A14 [Mus musculus...    33   5.4
gi|34865364|ref|XP_234281.2| similar to retinoblastoma-binding p...    33   5.4
gi|33439104|gb|AAQ18697.1| calreticulin [Dermacentor variabilis]       33   5.4
gi|28829018|gb|AAO51593.1| similar to Plasmodium falciparum (iso...    33   5.4
gi|12855356|dbj|BAB30303.1| unnamed protein product [Mus musculus]     33   5.4
gi|25411439|pir||G84501 probable TNP2-like transposon protein [i...    33   5.4
gi|23613218|ref|NP_703540.1| hypothetical protein [Plasmodium fa...    33   5.4
gi|4050087|gb|AAC97961.1| S164 [Homo sapiens]                          33   5.4
gi|37360324|dbj|BAC98140.1| mKIAA1311 protein [Mus musculus]           33   5.4
gi|50511097|dbj|BAD32534.1| mKIAA1764 protein [Mus musculus]           33   5.4
gi|23488075|gb|EAA21219.1| glutamic acid-rich protein precursor ...    33   5.4
gi|47223792|emb|CAF98562.1| unnamed protein product [Tetraodon n...    33   5.4
gi|47575818|ref|NP_001001253.1| hypothetical protein MGC69541 [X...    33   5.4
gi|38173988|gb|AAH61202.1| 1200008A14Rik protein [Mus musculus]        33   5.4
gi|15792671|ref|NP_282494.1| putative coiled-coil protein [Campy...    33   5.4
gi|5815432|gb|AAD52670.1| high mobility group protein HMG1 [Gall...    33   5.4
gi|41203740|ref|XP_027330.7| RNA-binding region (RNP1, RRM) cont...    33   5.4
gi|45382473|ref|NP_990233.1| high mobility group 1 protein [Gall...    33   5.4
gi|10438851|dbj|BAB15362.1| unnamed protein product [Homo sapiens]     33   5.4
gi|32449689|gb|AAH54080.1| Rbm27 protein [Mus musculus]                33   5.4
gi|28302252|gb|AAH46699.1| Calr-prov protein [Xenopus laevis]          33   7.1
gi|46433489|gb|EAK92927.1| hypothetical protein CaO19.13986 [Can...    33   7.1
gi|113006|sp|P23746|ABRA_PLAFF 101 kDa malaria antigen (P101) (A...    33   7.1
gi|1399801|gb|AAB41586.1| p167                                         33   7.1
gi|23508707|ref|NP_701375.1| hypothetical protein [Plasmodium fa...    33   7.1
gi|10697039|emb|CAC12741.1| intermediate filament protein [Glott...    33   7.1
gi|18543333|ref|NP_570091.1| synaptonemal complex protein 2 [Rat...    33   7.1
gi|21732876|emb|CAD38617.1| hypothetical protein [Homo sapiens]        33   7.1
gi|22327990|ref|NP_200888.2| heavy-metal-associated domain-conta...    33   7.1
gi|48116262|ref|XP_393186.1| similar to CG6322-PA [Apis mellifera]     33   7.1
gi|34854264|ref|XP_242005.2| similar to mKIAA0569 protein [Rattu...    33   7.1
gi|26328731|dbj|BAC28104.1| unnamed protein product [Mus musculus]     33   7.1
gi|30722291|emb|CAD91140.1| hypothetical protein [Homo sapiens]        33   7.1
gi|23479537|gb|EAA16337.1| Heme/Steroid binding domain, putative...    33   7.1
gi|47218066|emb|CAG09938.1| unnamed protein product [Tetraodon n...    33   7.1
gi|50748864|ref|XP_421434.1| PREDICTED: similar to retinoblastom...    33   7.1
gi|50405879|ref|XP_456580.1| unnamed protein product [Debaryomyc...    33   7.1
gi|419976|pir||S29130 calreticulin (clone 8) - African clawed fr...    33   7.1
gi|23613137|ref|NP_703459.1| hypothetical protein [Plasmodium fa...    33   7.1
gi|40254564|ref|NP_056568.2| zinc finger homeobox 1b [Mus muscul...    33   7.1
gi|113005|sp|P22620|ABRA_PLAFC 101 kDa malaria antigen (P101) (A...    33   7.1
gi|28972281|dbj|BAC65594.1| mKIAA0569 protein [Mus musculus]           33   7.1
gi|35210318|dbj|BAC92688.1| muscle-derived protein 77 [Homo sapi...    33   7.1
gi|30268573|emb|CAD38924.2| hypothetical protein [Homo sapiens]        33   7.1
gi|50426497|ref|XP_461845.1| unnamed protein product [Debaryomyc...    33   7.1
gi|4503509|ref|NP_003741.1| eukaryotic translation initiation fa...    33   7.1
gi|41196224|ref|XP_371849.1| muscle-derived protein 77 [Homo sap...    33   7.1
gi|17826933|dbj|BAB79277.1| calreticulin [Galleria mellonella]         33   7.1
gi|40788877|dbj|BAA09488.2| KIAA0139 [Homo sapiens]                    33   7.1
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno...    33   7.1
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa...    32   9.3
gi|6321581|ref|NP_011658.1| Gene/protein whose expression is ele...    32   9.3
gi|46226569|gb|EAK87557.1| DHR1/Ecm16p/kurz.  HrpA family SFII h...    32   9.3
gi|47228182|emb|CAG07577.1| unnamed protein product [Tetraodon n...    32   9.3
gi|46440428|gb|EAK99734.1| hypothetical protein CaO19.7492 [Cand...    32   9.3
gi|50551841|ref|XP_503395.1| hypothetical protein [Yarrowia lipo...    32   9.3
gi|45506954|ref|ZP_00159302.1| hypothetical protein Avar391301 [...    32   9.3
gi|34881491|ref|XP_343817.1| similar to TAF7-like RNA polymerase...    32   9.3
gi|23478370|gb|EAA15477.1| NAD(P)H-dependent glutamate synthase-...    32   9.3
gi|23485824|gb|EAA20589.1| Formin Homology 2 Domain, putative [P...    32   9.3
gi|7511962|pir||T13030 microtubule binding protein D-CLIP-190 - ...    32   9.3
gi|39584973|emb|CAE64397.1| Hypothetical protein CBG09087 [Caeno...    32   9.3
gi|23613824|ref|NP_704845.1| hypothetical protein [Plasmodium fa...    32   9.3
gi|13124525|sp|Q9R0G7|SIP1_MOUSE Zinc finger homeobox protein 1b...    32   9.3
gi|48099114|ref|XP_394867.1| similar to ENSANGP00000017679 [Apis...    32   9.3
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel...    32   9.3
gi|23481068|gb|EAA17458.1| putative splicing factor [Plasmodium ...    32   9.3
gi|39594466|emb|CAE72044.1| Hypothetical protein CBG19126 [Caeno...    32   9.3
gi|28175578|gb|AAH43468.1| RIKEN cDNA 4921537D05 gene [Mus muscu...    32   9.3
gi|23612452|ref|NP_704013.1| hypothetical protein [Plasmodium fa...    32   9.3
gi|41057179|ref|NP_957893.1| ORF116 hypothetical protein [Orf vi...    32   9.3
gi|33413782|gb|AAN39444.1| normocyte binding protein 2a [Plasmod...    32   9.3
gi|27229249|ref|NP_084128.2| RIKEN cDNA 4921537D05 [Mus musculus...    32   9.3
gi|20130365|ref|NP_611933.1| CG11416-PA [Drosophila melanogaster...    32   9.3
gi|28828585|gb|AAO51188.1| similar to Dictyostelium discoideum (...    32   9.3
gi|17541376|ref|NP_501845.1| putative nuclear protein, with a co...    32   9.3
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb...    32   9.3
gi|19919998|gb|AAM08439.1| similar to Plasmodium falciparum. Pre...    32   9.3


>gi|25149118|ref|NP_494776.2| putative nuclear protein, with a
           coiled coil-4 domain (2E675) [Caenorhabditis elegans]
 gi|21431930|sp|Q10921|YWQ1_CAEEL Hypothetical protein B0286.1 in
           chromosome II
 gi|17976511|gb|AAA80693.3| Hypothetical protein B0286.1
           [Caenorhabditis elegans]
          Length = 230

 Score =  384 bits (985), Expect = e-105
 Identities = 196/230 (85%), Positives = 196/230 (85%)
 Frame = +1

Query: 1   MLQKEHASALEKLRVIWLHKKKIEAELQSRHAESTKFLSKIKLKESEIYGLKTKQETCQK 180
           MLQKEHASALEKLRVIWLHKKKIEAELQSRHAESTKFLSKIKLKESEIYGLKTKQETCQK
Sbjct: 1   MLQKEHASALEKLRVIWLHKKKIEAELQSRHAESTKFLSKIKLKESEIYGLKTKQETCQK 60

Query: 181 ELTDCQTLXXXXXXXXXXXXXXXXXXXXTIEKYEQEIAXXXXXXXXXXXXXXNNYSDENS 360
           ELTDCQTL                    TIEKYEQEIA              NNYSDENS
Sbjct: 61  ELTDCQTLKEEPKEQKKENNKNDENSKKTIEKYEQEIAGLKEKIEGLEEKVKNNYSDENS 120

Query: 361 SLKEELKQCETRIRQLTGGGAIEHYSQNETAHFSRNQKADEPLFFDRGNIQHHIPQKLLL 540
           SLKEELKQCETRIRQLTGGGAIEHYSQNETAHFSRNQKADEPLFFDRGNIQHHIPQKLLL
Sbjct: 121 SLKEELKQCETRIRQLTGGGAIEHYSQNETAHFSRNQKADEPLFFDRGNIQHHIPQKLLL 180

Query: 541 GRELVQTLEEAKVKKLEEREQMDKHPQDRDNKDKEVNEQPDNEEQDYKEH 690
           GRELVQTLEEAKVKKLEEREQMDKHPQDRDNKDKEVNEQPDNEEQDYKEH
Sbjct: 181 GRELVQTLEEAKVKKLEEREQMDKHPQDRDNKDKEVNEQPDNEEQDYKEH 230




[DB home][top]