Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= B0334_2
(873 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536607|ref|NP_496452.1| TWiK family of potassium channels (... 562 e-159
gi|50507717|emb|CAA91376.2| Hypothetical protein B0334.2 [Caenor... 553 e-156
gi|39597266|emb|CAE59494.1| Hypothetical protein CBG02879 [Caeno... 416 e-115
gi|39582763|emb|CAE74226.1| Hypothetical protein CBG21910 [Caeno... 100 4e-20
gi|39587366|emb|CAE75020.1| Hypothetical protein CBG22924 [Caeno... 85 2e-15
gi|32563600|ref|NP_492054.2| TWiK family of potassium channels (... 85 2e-15
gi|7499553|pir||T21188 hypothetical protein F21C3.1 - Caenorhabd... 85 2e-15
gi|25144330|ref|NP_498903.2| TWiK family of potassium channels (... 85 2e-15
gi|39596461|emb|CAE63080.1| Hypothetical protein CBG07369 [Caeno... 78 3e-13
gi|17570153|ref|NP_510305.1| TWiK family of potassium channels (... 77 4e-13
gi|1078847|pir||S44635 f22b7.7 protein - Caenorhabditis elegans 76 1e-12
gi|32566087|ref|NP_502685.2| putative protein family member, wit... 75 1e-12
gi|7509540|pir||T26616 hypothetical protein Y37A1B.11 - Caenorha... 75 1e-12
gi|25147096|ref|NP_508732.2| twk-8 protein like family member (X... 74 4e-12
gi|34850053|gb|AAK39218.3| Twik family of potassium channels pro... 74 4e-12
gi|39584578|emb|CAE74656.1| Hypothetical protein CBG22456 [Caeno... 72 1e-11
gi|39597860|emb|CAE68552.1| Hypothetical protein CBG14385 [Caeno... 72 2e-11
gi|25395539|pir||H88124 protein T12C9.3 [imported] - Caenorhabdi... 72 2e-11
gi|25147273|ref|NP_508526.2| potassium channel subunit n2P16 fam... 70 8e-11
gi|7503954|pir||T16426 hypothetical protein F52E4.4 - Caenorhabd... 70 8e-11
gi|39587874|emb|CAE67892.1| Hypothetical protein CBG13488 [Caeno... 70 8e-11
gi|50748854|ref|XP_421431.1| PREDICTED: similar to potassium cha... 69 1e-10
gi|50740491|ref|XP_419477.1| PREDICTED: similar to potassium cha... 69 1e-10
gi|19343981|gb|AAH25726.1| Potassium channel, subfamily K, membe... 69 1e-10
gi|17025230|ref|NP_113648.2| potassium channel, subfamily K, mem... 69 1e-10
gi|13507377|gb|AAK28551.1| potassium channel TASK-4 [Homo sapiens] 69 1e-10
gi|7503519|pir||T22269 hypothetical protein F46A9.3 - Caenorhabd... 69 2e-10
gi|9988111|emb|CAC07335.1| dJ137F1.1 (novel member of the potass... 69 2e-10
gi|34868980|ref|XP_223777.2| similar to dJ137F1.2 (novel member ... 69 2e-10
gi|24641306|ref|NP_572720.1| CG1756-PA [Drosophila melanogaster]... 69 2e-10
gi|32562837|ref|NP_492511.2| putative protein family member, wit... 69 2e-10
gi|48095690|ref|XP_394509.1| similar to CG9637-PA [Apis mellifera] 68 2e-10
gi|17536609|ref|NP_495727.1| TWiK family of potassium channels (... 68 2e-10
gi|50740494|ref|XP_419478.1| PREDICTED: similar to potassium cha... 68 3e-10
gi|27807011|ref|NP_776983.1| potassium channel, subfamily K, mem... 68 3e-10
gi|4504851|ref|NP_003731.1| potassium channel, subfamily K, memb... 68 3e-10
gi|39585309|emb|CAE61631.1| Hypothetical protein CBG05561 [Caeno... 68 3e-10
gi|20870425|ref|XP_138942.1| RIKEN cDNA 4731413G05 [Mus musculus] 67 4e-10
gi|17536613|ref|NP_494333.1| TWiK family of potassium channels (... 67 5e-10
gi|7511511|pir||T32347 outward rectifier potassium channel homol... 67 5e-10
gi|39597681|emb|CAE68372.1| Hypothetical protein CBG14128 [Caeno... 67 5e-10
gi|39584651|emb|CAE72404.1| Hypothetical protein CBG19563 [Caeno... 67 5e-10
gi|11496265|ref|NP_067517.1| potassium channel, subfamily K, mem... 67 7e-10
gi|29835154|gb|AAH51088.1| Kcnk5 protein [Mus musculus] 67 7e-10
gi|17555324|ref|NP_499790.1| twk-8 protein like family member (3... 66 9e-10
gi|39595158|emb|CAE60195.1| Hypothetical protein CBG03756 [Caeno... 66 9e-10
gi|31043788|emb|CAB07375.2| Hypothetical protein F31D4.7 [Caenor... 66 9e-10
gi|17560382|ref|NP_508031.1| putative protein family member, wit... 66 9e-10
gi|17530889|ref|NP_511112.1| CG1615-PB [Drosophila melanogaster]... 66 9e-10
gi|14149764|ref|NP_115491.1| potassium channel, subfamily K, mem... 66 1e-09
gi|9988112|emb|CAC07336.1| dJ137F1.2 (novel member of the potass... 66 1e-09
gi|48094838|ref|XP_394281.1| similar to ENSANGP00000013427 [Apis... 65 1e-09
gi|39591758|emb|CAE71336.1| Hypothetical protein CBG18237 [Caeno... 65 1e-09
gi|39587238|emb|CAE57706.1| Hypothetical protein CBG00713 [Caeno... 65 2e-09
gi|31211993|ref|XP_314981.1| ENSANGP00000021390 [Anopheles gambi... 65 2e-09
gi|32454070|gb|AAP82866.1| pancreatic potassium channel TALK-1b ... 64 3e-09
gi|39594882|emb|CAE70750.1| Hypothetical protein CBG17497 [Caeno... 64 3e-09
gi|7505938|pir||T16629 hypothetical protein M02F4.5 - Caenorhabd... 64 3e-09
gi|17570151|ref|NP_508522.1| TWiK family of potassium channels (... 64 3e-09
gi|7497822|pir||T28933 hypothetical protein C52B9.6 - Caenorhabd... 64 3e-09
gi|17536611|ref|NP_495961.1| TWiK family of potassium channels (... 64 4e-09
gi|32454074|gb|AAP82868.1| pancreatic potassium channel TALK-1d ... 64 4e-09
gi|39596487|emb|CAE63106.1| Hypothetical protein CBG07401 [Caeno... 64 6e-09
gi|19110344|gb|AAL82795.1| potassium channel TWIK-1 [Cavia porce... 63 7e-09
gi|17550920|ref|NP_510284.1| TWiK family of potassium channels (... 63 7e-09
gi|11359774|pir||T45032 hypothetical protein Y39B6B.f [imported]... 63 7e-09
gi|25151576|ref|NP_741678.1| potassium channel TWIK-1 (36.4 kD) ... 63 7e-09
gi|7497246|pir||T19860 hypothetical protein C40C9.1 - Caenorhabd... 63 7e-09
gi|47229323|emb|CAG04075.1| unnamed protein product [Tetraodon n... 63 1e-08
gi|39597677|emb|CAE68368.1| Hypothetical protein CBG14123 [Caeno... 63 1e-08
gi|39580228|emb|CAE72984.1| Hypothetical protein CBG20326 [Caeno... 62 2e-08
gi|7500371|pir||T21683 hypothetical protein F32H5.2 - Caenorhabd... 62 2e-08
gi|7506281|pir||T23907 hypothetical protein R04F11.4 - Caenorhab... 62 2e-08
gi|25146228|ref|NP_506091.2| TWiK family of potassium channels (... 62 2e-08
gi|39592237|emb|CAE75458.1| Hypothetical protein CBG23453 [Caeno... 62 2e-08
gi|17542644|ref|NP_502170.1| TWiK family of potassium channels (... 62 2e-08
gi|50507748|emb|CAB01238.2| Hypothetical protein M04B2.5 [Caenor... 62 2e-08
gi|26331778|dbj|BAC29619.1| unnamed protein product [Mus musculus] 62 2e-08
gi|26349569|dbj|BAC38424.1| unnamed protein product [Mus musculus] 61 3e-08
gi|26331130|dbj|BAC29295.1| unnamed protein product [Mus musculus] 61 3e-08
gi|6680538|ref|NP_032456.1| potassium channel, subfamily K, memb... 61 3e-08
gi|47217179|emb|CAG11015.1| unnamed protein product [Tetraodon n... 61 3e-08
gi|45505228|gb|AAS66991.1| potassium channel TREK-2 [Oryctolagus... 61 3e-08
gi|12831215|ref|NP_075584.1| potassium channel TREK-2 [Rattus no... 61 3e-08
gi|10863961|ref|NP_066984.1| potassium channel, subfamily K, mem... 61 3e-08
gi|19716292|gb|AAL95706.1| potassium channel TREK2 splice varian... 61 3e-08
gi|19716290|gb|AAL95705.1| potassium channel TREK2 splice varian... 61 3e-08
gi|20143944|ref|NP_612190.1| potassium channel, subfamily K, mem... 61 3e-08
gi|20143946|ref|NP_612191.1| potassium channel, subfamily K, mem... 61 3e-08
gi|7500584|pir||T21834 hypothetical protein F36A2.4 - Caenorhabd... 61 4e-08
gi|6680540|ref|NP_032457.1| potassium channel, subfamily K, memb... 61 4e-08
gi|34861038|ref|XP_346569.1| hypothetical protein XP_346568 [Rat... 61 4e-08
gi|17507181|ref|NP_492381.1| fibronectin, type III and ion trans... 61 4e-08
gi|31441785|emb|CAB03071.3| C. elegans TWK-30 protein (correspon... 61 4e-08
gi|13277636|gb|AAH03729.1| Potassium channel, subfamily K, membe... 61 4e-08
gi|18034771|ref|NP_446256.2| potassium inwardly-rectifying chann... 60 5e-08
gi|31198023|ref|XP_307959.1| ENSANGP00000013427 [Anopheles gambi... 60 5e-08
gi|4758624|ref|NP_004814.1| potassium channel, subfamily K, memb... 60 5e-08
gi|4504847|ref|NP_002236.1| potassium channel, subfamily K, memb... 60 5e-08
gi|39589742|emb|CAE66977.1| Hypothetical protein CBG12373 [Caeno... 60 6e-08
gi|2213891|gb|AAB61602.1| rabKCNK1 [Oryctolagus cuniculus] 60 6e-08
gi|11067417|ref|NP_067720.1| putative potassium channel TWIK [Ra... 60 6e-08
gi|50758683|ref|XP_417369.1| PREDICTED: similar to Potassium cha... 60 8e-08
gi|4504849|ref|NP_002237.1| potassium channel, subfamily K, memb... 60 8e-08
gi|47208750|emb|CAF94456.1| unnamed protein product [Tetraodon n... 60 8e-08
gi|47229993|emb|CAG10407.1| unnamed protein product [Tetraodon n... 59 1e-07
gi|38086199|ref|XP_355877.1| similar to potassium channel, subfa... 59 1e-07
gi|34855627|ref|XP_215230.2| hypothetical protein XP_215230 [Rat... 59 1e-07
gi|19110352|gb|AAL82796.1| potassium channel TWIK-2 [Cavia porce... 59 1e-07
gi|27503347|gb|AAH42262.1| MGC53410 protein [Xenopus laevis] 59 1e-07
gi|15419623|gb|AAK97094.1| tandem acid-sensitive potassium chann... 59 1e-07
gi|39593815|emb|CAE62108.1| Hypothetical protein CBG06143 [Caeno... 59 1e-07
gi|38075345|ref|XP_141526.2| similar to Potassium channel subfam... 59 1e-07
gi|39930507|ref|NP_570826.1| potassium channel, subfamily K, mem... 59 1e-07
gi|15718767|ref|NP_201567.1| potassium channel, subfamily K, mem... 59 2e-07
gi|7576935|gb|AAF64062.1| tandem pore domain potassium channel T... 59 2e-07
gi|15718765|ref|NP_057695.2| potassium channel, subfamily K, mem... 59 2e-07
gi|16758650|ref|NP_446258.1| potassium channel, subfamily K, mem... 59 2e-07
gi|48107867|ref|XP_396190.1| similar to ENSANGP00000017384 [Apis... 58 2e-07
gi|10801598|dbj|BAB16710.1| TASK1 splice bvariant (TASK1b) [Ratt... 58 2e-07
gi|33859576|ref|NP_034738.1| potassium channel, subfamily K, mem... 58 2e-07
gi|15431283|ref|NP_203694.1| potassium channel, subfamily K, mem... 58 2e-07
gi|4103376|gb|AAD09338.1| putative potassium channel DP4 [Mus mu... 58 2e-07
gi|50741362|ref|XP_419561.1| PREDICTED: similar to putative pota... 58 2e-07
gi|16758136|ref|NP_445857.1| potassium channel, subfamily K, mem... 58 2e-07
gi|31240391|ref|XP_320609.1| ENSANGP00000010680 [Anopheles gambi... 58 3e-07
gi|50740290|ref|XP_419418.1| PREDICTED: similar to potassium cha... 58 3e-07
gi|47219414|emb|CAG01577.1| unnamed protein product [Tetraodon n... 58 3e-07
gi|2465544|gb|AAC53367.1| TWIK-related acid-sensitive K+ channel... 58 3e-07
gi|47225271|emb|CAG09771.1| unnamed protein product [Tetraodon n... 58 3e-07
gi|14589851|ref|NP_055032.1| potassium channel, subfamily K, mem... 57 4e-07
gi|5712621|gb|AAD47569.1| TREK-1 potassium channel [Homo sapiens] 57 4e-07
gi|27807241|ref|NP_777111.1| potassium channel, subfamily K, mem... 57 4e-07
gi|6754432|ref|NP_034737.1| potassium channel, subfamily K, memb... 57 4e-07
gi|25146143|ref|NP_506906.2| potassium channel TWIK-1 family mem... 57 4e-07
gi|7505363|pir||T23373 hypothetical protein K06B4.12 - Caenorhab... 57 4e-07
gi|13124054|sp|O95069|CIW2_HUMAN Potassium channel subfamily K m... 57 4e-07
gi|25282403|ref|NP_742038.1| potassium channel, subfamily K, mem... 57 4e-07
gi|38566067|gb|AAH62094.1| Kcnk2 protein [Mus musculus] 57 4e-07
gi|32454072|gb|AAP82867.1| pancreatic potassium channel TALK-1c ... 57 5e-07
gi|39590077|emb|CAE61075.1| Hypothetical protein CBG04825 [Caeno... 57 7e-07
gi|14583127|gb|AAK69764.1| potassium channel TASK-3 [Rattus norv... 57 7e-07
gi|47216202|emb|CAG01236.1| unnamed protein product [Tetraodon n... 56 9e-07
gi|39585409|emb|CAE61731.1| Hypothetical protein CBG05682 [Caeno... 56 9e-07
gi|41055407|ref|NP_956927.1| hypothetical protein MGC63921 [Dani... 56 9e-07
gi|13431425|sp|Q9JL58|CIW9_CAVPO Potassium channel subfamily K m... 56 9e-07
gi|47225555|emb|CAG12038.1| unnamed protein product [Tetraodon n... 56 9e-07
gi|31207013|ref|XP_312473.1| ENSANGP00000021888 [Anopheles gambi... 56 9e-07
gi|39589137|emb|CAE57870.1| Hypothetical protein CBG00910 [Caeno... 56 9e-07
gi|17542648|ref|NP_501724.1| TWiK family of potassium channels (... 56 9e-07
gi|7706135|ref|NP_057685.1| potassium channel, subfamily K, memb... 56 1e-06
gi|17564904|ref|NP_504663.1| predicted CDS, TWiK family of potas... 56 1e-06
gi|28704121|gb|AAH47247.1| Kcnk6-prov protein [Xenopus laevis] 56 1e-06
gi|17565098|ref|NP_507480.1| potassium channel TWIK-1 family mem... 56 1e-06
gi|25513799|pir||JC7703 TASK-5 protein - human 56 1e-06
gi|11641275|ref|NP_071753.1| potassium family, subfamily K, memb... 56 1e-06
gi|17570155|ref|NP_510654.1| predicted CDS, TWiK family of potas... 55 2e-06
gi|48120923|ref|XP_396471.1| similar to ENSANGP00000021888 [Apis... 55 2e-06
gi|24646638|ref|NP_650300.1| CG9637-PA [Drosophila melanogaster]... 55 2e-06
gi|17570149|ref|NP_509516.1| TWiK family of potassium channels (... 55 2e-06
gi|39588079|emb|CAE57311.1| Hypothetical protein CBG00233 [Caeno... 55 2e-06
gi|7496375|pir||T15584 hypothetical protein C24A3.6 - Caenorhabd... 55 2e-06
gi|17564900|ref|NP_506103.1| TWiK family of potassium channels (... 55 2e-06
gi|47224316|emb|CAG09162.1| unnamed protein product [Tetraodon n... 55 2e-06
gi|32565295|ref|NP_499470.2| putative protein family member, wit... 55 3e-06
gi|7509931|pir||T26953 hypothetical protein Y47D3B.5 - Caenorhab... 55 3e-06
gi|39582439|emb|CAE74823.1| Hypothetical protein CBG22661 [Caeno... 54 3e-06
gi|24636274|sp|Q9ES08|CIW9_RAT Potassium channel subfamily K mem... 54 4e-06
gi|38102438|gb|EAA49275.1| hypothetical protein MG00933.4 [Magna... 54 4e-06
gi|47221027|emb|CAG12721.1| unnamed protein product [Tetraodon n... 54 6e-06
gi|31228794|ref|XP_318112.1| ENSANGP00000017590 [Anopheles gambi... 53 8e-06
gi|31231315|ref|XP_318503.1| ENSANGP00000021246 [Anopheles gambi... 53 8e-06
gi|50749036|ref|XP_426457.1| PREDICTED: similar to potassium cha... 53 1e-05
gi|10944275|emb|CAC14068.1| dJ781B1.1 (Two pore potassium channe... 53 1e-05
gi|39592250|emb|CAE75471.1| Hypothetical protein CBG23471 [Caeno... 53 1e-05
gi|15237430|ref|NP_199449.1| outward rectifying potassium channe... 52 1e-05
gi|6686780|emb|CAB64717.1| KCO2 protein [Arabidopsis thaliana] 52 1e-05
gi|24655040|ref|NP_612084.1| CG9194-PA [Drosophila melanogaster]... 52 1e-05
gi|33636599|gb|AAQ23597.1| RE05370p [Drosophila melanogaster] 52 1e-05
gi|39596343|emb|CAE69981.1| Hypothetical protein CBG16379 [Caeno... 52 2e-05
gi|39584817|emb|CAE67712.1| Hypothetical protein CBG13286 [Caeno... 52 2e-05
gi|17555394|ref|NP_497973.1| TWiK family of potassium channels (... 52 2e-05
gi|24645352|ref|NP_649891.1| CG9361-PA [Drosophila melanogaster]... 52 2e-05
gi|47227295|emb|CAF96844.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|39594328|emb|CAE71906.1| Hypothetical protein CBG18967 [Caeno... 52 2e-05
gi|23821211|emb|CAD53325.1| potassium channel [Neurospora crassa] 51 3e-05
gi|31204249|ref|XP_311073.1| ENSANGP00000017384 [Anopheles gambi... 51 4e-05
gi|17564896|ref|NP_506416.1| TWiK family of potassium channels (... 50 5e-05
gi|38077857|ref|XP_139424.3| similar to potassium channel TASK3 ... 50 6e-05
gi|17506133|ref|NP_491810.1| potassium channel DP4 family member... 50 6e-05
gi|47206503|emb|CAF90084.1| unnamed protein product [Tetraodon n... 50 8e-05
gi|46139449|ref|XP_391415.1| hypothetical protein FG11239.1 [Gib... 50 8e-05
gi|25151933|ref|NP_741842.1| putative potassium channel subunit ... 50 8e-05
gi|25151936|ref|NP_741845.1| putative potassium channel subunit ... 50 8e-05
gi|25151939|ref|NP_741846.1| putative potassium channel subunit ... 50 8e-05
gi|11359804|pir||T43393 potassium channel chain n2P17m3 homolog ... 50 8e-05
gi|21392667|gb|AAM51529.1| Hypothetical protein C44E12.3a [Caeno... 50 8e-05
gi|19921794|ref|NP_610349.1| CG8713-PA [Drosophila melanogaster]... 50 8e-05
gi|25151942|ref|NP_741844.1| putative potassium channel subunit ... 50 8e-05
gi|46134185|ref|XP_389408.1| hypothetical protein FG09232.1 [Gib... 50 8e-05
gi|25151930|ref|NP_741843.1| putative potassium channel subunit ... 50 8e-05
gi|34785960|gb|AAH58054.1| LOC402860 protein [Danio rerio] 49 1e-04
gi|50732038|ref|XP_425942.1| PREDICTED: similar to Potassium cha... 49 1e-04
gi|46434032|gb|EAK93454.1| hypothetical protein CaO19.4175 [Cand... 49 1e-04
gi|17563162|ref|NP_507485.1| potassium channel family member (5S... 49 1e-04
gi|50507821|emb|CAB07854.2| Hypothetical protein R12G8.2 [Caenor... 49 1e-04
gi|39594738|emb|CAE70606.1| Hypothetical protein CBG17283 [Caeno... 49 2e-04
gi|48124394|ref|XP_396556.1| similar to CG8713-PA [Apis mellifera] 49 2e-04
gi|24647970|ref|NP_650726.1| CG10864-PA [Drosophila melanogaster... 49 2e-04
gi|46113983|ref|ZP_00184200.2| COG1226: Kef-type K+ transport sy... 48 2e-04
gi|21228960|ref|NP_634882.1| Potassium channel protein [Methanos... 48 2e-04
gi|17570457|ref|NP_509942.1| ion transport protein family member... 48 2e-04
gi|19110369|gb|AAL82797.1| potassium channel TWIK-2 [Cavia porce... 48 3e-04
gi|34861469|ref|XP_219517.2| similar to mitogen activated protei... 48 3e-04
gi|47217756|emb|CAG05978.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|24656702|ref|NP_611547.1| CG15655-PA [Drosophila melanogaster... 48 3e-04
gi|13124112|sp|Q9Z2T1|CIW8_MOUSE Potassium channel subfamily K m... 47 4e-04
gi|8132414|gb|AAF73282.1| two pore domain K+ channel subunit [Mu... 47 4e-04
gi|5821141|dbj|BAA35074.1| double-pore K channel 3 [Mus musculus] 47 4e-04
gi|4768615|gb|AAD29577.1| two pore domain K+ channel subunit [Mu... 47 4e-04
gi|4103374|gb|AAD09337.1| putative potassium channel DP3 [Mus mu... 47 4e-04
gi|6502965|gb|AAF14528.1| two pore domain potassium channel KCNK... 47 4e-04
gi|6649861|gb|AAF21603.1| neuromuscular two P domain potassium c... 47 4e-04
gi|47224354|emb|CAG09200.1| unnamed protein product [Tetraodon n... 47 4e-04
gi|19921934|ref|NP_610516.1| CG1688-PA [Drosophila melanogaster]... 47 5e-04
gi|39595653|emb|CAE67155.1| Hypothetical protein CBG12580 [Caeno... 47 5e-04
gi|39594139|emb|CAE70249.1| Hypothetical protein CBG16741 [Caeno... 47 7e-04
gi|11177516|gb|AAG32314.1| tandem pore domain potassium channel ... 47 7e-04
gi|16306555|ref|NP_071337.2| potassium channel, subfamily K, mem... 47 7e-04
gi|7496433|pir||T19429 hypothetical protein C24H11.8 - Caenorhab... 47 7e-04
gi|32565622|ref|NP_499529.2| ion transport protein (3M891) [Caen... 47 7e-04
gi|17564898|ref|NP_506078.1| TWiK family of potassium channels (... 46 0.001
gi|39584824|emb|CAE67719.1| Hypothetical protein CBG13294 [Caeno... 46 0.001
gi|50507754|emb|CAH04700.1| Hypothetical protein F55C5.3b [Caeno... 46 0.001
gi|25147267|ref|NP_741881.1| UNCoordinated locomotion UNC-110, M... 46 0.001
gi|7546841|gb|AAF63707.1| potassium channel TASK3 [Cavia porcellus] 46 0.001
gi|39592213|emb|CAE75434.1| Hypothetical protein CBG23427 [Caeno... 46 0.001
gi|7507331|pir||T24626 hypothetical protein T06H11.1 - Caenorhab... 46 0.001
gi|39591002|emb|CAE58782.1| Hypothetical protein CBG01980 [Caeno... 46 0.001
gi|19882235|ref|NP_084187.1| TREK2; outward rectifying potassium... 46 0.001
gi|39594957|emb|CAE70825.1| Hypothetical protein CBG17601 [Caeno... 46 0.001
gi|25147270|ref|NP_741880.1| UNCoordinated locomotion UNC-110, M... 46 0.001
gi|25991361|gb|AAN76819.1| large conductance calcium activated p... 46 0.001
gi|50552031|ref|XP_503490.1| hypothetical protein [Yarrowia lipo... 46 0.001
gi|39586438|emb|CAE74097.1| Hypothetical protein CBG21757 [Caeno... 46 0.001
gi|17565094|ref|NP_507483.1| putative protein family member, wit... 45 0.002
gi|21707910|gb|AAH33577.1| KCNK4 protein [Homo sapiens] 45 0.002
gi|45357590|ref|NP_987147.1| putative potassium channel protein ... 45 0.002
gi|39585390|emb|CAE61712.1| Hypothetical protein CBG05661 [Caeno... 45 0.002
gi|47223248|emb|CAF98632.1| unnamed protein product [Tetraodon n... 45 0.002
gi|39590497|emb|CAE66237.1| Hypothetical protein CBG11481 [Caeno... 45 0.002
gi|47216079|emb|CAG04818.1| unnamed protein product [Tetraodon n... 45 0.002
gi|39580013|emb|CAE56818.1| Hypothetical protein CBG24632 [Caeno... 45 0.002
gi|34556101|emb|CAE46687.1| C. elegans TWK-8 protein (correspond... 45 0.002
gi|17542646|ref|NP_501578.1| TWiK family of potassium channels (... 45 0.002
gi|33300325|emb|CAE17863.1| Hypothetical protein K11H3.7 [Caenor... 45 0.002
gi|39590727|emb|CAE65097.1| Hypothetical protein CBG09957 [Caeno... 45 0.002
gi|48124397|ref|XP_396557.1| similar to ENSANGP00000003582 [Apis... 45 0.003
gi|5577974|gb|AAD45406.1| calcium-activated potassium channel is... 45 0.003
gi|45594290|gb|AAS68516.1| 2P K ion channel TRESK [Rattus norveg... 45 0.003
gi|22122525|ref|NP_666149.1| potassium channel, subfamily K, mem... 45 0.003
gi|3136120|gb|AAC41282.1| calcium-activated potassium channel [T... 45 0.003
gi|3136118|gb|AAC41281.1| calcium-activated potassium channel [T... 45 0.003
gi|38085211|ref|XP_285304.2| similar to TWIK-related spinal cord... 45 0.003
gi|3136122|gb|AAC41283.1| calcium-activated potassium channel [T... 45 0.003
gi|50292983|ref|XP_448924.1| unnamed protein product [Candida gl... 45 0.003
gi|3136124|gb|AAC41284.1| calcium-activated potassium channel [T... 45 0.003
gi|31228802|ref|XP_318113.1| ENSANGP00000003582 [Anopheles gambi... 45 0.003
gi|31209077|ref|XP_313505.1| ENSANGP00000021317 [Anopheles gambi... 44 0.004
gi|31209075|ref|XP_313504.1| ENSANGP00000000423 [Anopheles gambi... 44 0.004
gi|321029|pir||JH0697 potassium channel protein Slo - fruit fly ... 44 0.004
gi|24649749|ref|NP_524486.2| CG10693-PA [Drosophila melanogaster... 44 0.004
gi|31209079|ref|XP_313506.1| ENSANGP00000023880 [Anopheles gambi... 44 0.004
gi|1305547|gb|AAA99161.1| calcium activated potassium channel 44 0.004
gi|103086|pir||A39800 calcium-activated potassium channel, compo... 44 0.004
gi|46396599|sp|Q03720|SLO_DROME Calcium-activated potassium chan... 44 0.004
gi|45553505|ref|NP_996289.1| CG10693-PC [Drosophila melanogaster... 44 0.004
gi|24649751|ref|NP_733029.1| CG10693-PB [Drosophila melanogaster... 44 0.004
gi|32448658|gb|AAP82450.1| large-conductance calcium-activated p... 44 0.005
gi|15822585|gb|AAK54354.1| BK potassium ion channel isoform C [B... 44 0.005
gi|48124383|ref|XP_393264.1| similar to ENSANGP00000017550 [Apis... 44 0.005
gi|50749108|ref|XP_429228.1| PREDICTED: hypothetical protein XP_... 44 0.005
gi|15822583|gb|AAK54353.1| BK potassium ion channel isoform B [B... 44 0.005
gi|28557653|gb|AAO45232.1| LD16342p [Drosophila melanogaster] 44 0.005
gi|32448664|gb|AAP82453.1| large-conductance calcium-activated p... 44 0.005
gi|487428|gb|AAA50173.1| calcium-activated potassium channel 44 0.005
gi|46396068|sp|Q62976|KCA1_RAT Calcium-activated potassium chann... 44 0.005
gi|4972782|gb|AAD34786.1| large-conductance calcium-activated po... 44 0.005
gi|46396132|sp|O18867|KCA1_MACMU Calcium-activated potassium cha... 44 0.005
gi|606876|gb|AAC50353.1| calcium activated potassium channel 44 0.005
gi|46396489|sp|Q90ZC7|KCA1_XENLA Calcium-activated potassium cha... 44 0.005
gi|539800|pir||A48206 calcium-activated potassium channel mSlo -... 44 0.005
gi|2570854|gb|AAB88802.1| calcium-activated potassium channel al... 44 0.005
gi|40645516|dbj|BAD06365.1| stretch-activated Kca channel [Homo ... 44 0.005
gi|7512323|pir||I38596 calcium-activated potassium channel - hum... 44 0.005
gi|27807229|ref|NP_777105.1| potassium large conductance calcium... 44 0.005
gi|47523514|ref|NP_999384.1| calcium-activated potassium channel... 44 0.005
gi|46396500|sp|Q9BG98|KCA1_RABIT Calcium-activated potassium cha... 44 0.005
gi|13929184|ref|NP_114016.1| potassium large conductance calcium... 44 0.005
gi|537439|gb|AAA85104.1| large-conductance calcium-activated pot... 44 0.005
gi|26638650|ref|NP_002238.2| large conductance calcium-activated... 44 0.005
gi|1929018|gb|AAB51398.1| calcium-activated potassium channel al... 44 0.005
gi|2137183|pir||I49017 calcium-activated potassium channel - mou... 44 0.005
gi|2134854|pir||S62904 calcium-regulated potassium channel alpha... 44 0.005
gi|32448660|gb|AAP82451.1| large-conductance calcium-activated p... 44 0.005
gi|18448948|gb|AAL69971.1| calcium-activated potassium channel S... 44 0.005
gi|4868124|gb|AAD31173.1| BKCA alpha subunit; MaxiK alpha subuni... 44 0.005
gi|23616922|dbj|BAC20639.1| stretch-activated Kca channel [Gallu... 44 0.005
gi|2662316|dbj|BAA23747.1| large conductance calcium-activated p... 44 0.005
gi|6754436|ref|NP_034740.1| large conductance calcium-activated ... 44 0.005
gi|1654389|gb|AAB17873.1| calcium-activated potassium channel [G... 44 0.005
gi|32448666|gb|AAP82454.1| large-conductance calcium-activated p... 44 0.005
gi|46396283|sp|Q12791|KCA1_HUMAN Calcium-activated potassium cha... 44 0.005
gi|6573132|gb|AAF17562.1| maxi-K channel alpha subunit [Oryctola... 44 0.005
gi|1408204|gb|AAB03663.1| large conductance calcium-activated po... 44 0.005
gi|3452426|gb|AAC32866.1| calcium-activated potassium channel [R... 44 0.005
gi|40645551|dbj|BAD06397.1| BK variant stretch-activated Kca cha... 44 0.005
gi|46396408|sp|Q8AYS8|KCA1_CHICK Calcium-activated potassium cha... 44 0.005
gi|31544745|ref|NP_853323.1| Kef [Mycoplasma gallisepticum R] >g... 44 0.005
gi|46396281|sp|Q08460|KCA1_MOUSE Calcium-activated potassium cha... 44 0.005
gi|45383676|ref|NP_989555.1| potassium large conductance calcium... 44 0.005
gi|24376318|ref|NP_720426.1| conserved hypothetical protein [She... 44 0.006
gi|6322368|ref|NP_012442.1| Target Of K1 Killer Toxin; Tok1p [Sa... 44 0.006
gi|1147595|emb|CAA64176.1| outward-rectifier potassium channel [... 44 0.006
gi|13276863|emb|CAC34339.1| K+ channel protein [Solanum tuberosum] 43 0.008
gi|4151117|emb|CAA12225.1| K+ channel protein [Solanum tuberosum] 43 0.008
gi|24528452|gb|AAN62847.1| tandem pore domain potassium channel ... 43 0.008
gi|4323298|gb|AAD16279.1| pulvinus outward-rectifying channel fo... 43 0.010
gi|44890021|emb|CAF32139.1| outward-rectifier potassium channel ... 43 0.010
gi|20091059|ref|NP_617134.1| potassium channel protein [Methanos... 43 0.010
gi|50590667|ref|ZP_00332025.1| COG1226: Kef-type K+ transport sy... 42 0.014
gi|31205787|ref|XP_311845.1| ENSANGP00000017550 [Anopheles gambi... 42 0.014
gi|26051268|ref|NP_742107.1| potassium voltage-gated channel KQT... 42 0.014
gi|13559046|emb|CAC36010.1| bA358D14.1.2 (potassium voltage-gate... 42 0.014
gi|13559045|emb|CAC36009.1| bA358D14.1.1 (potassium voltage-gate... 42 0.014
gi|25147238|ref|NP_741820.1| potassium channel, KvQLT family (77... 42 0.014
gi|39586721|emb|CAE65763.1| Hypothetical protein CBG10852 [Caeno... 42 0.014
gi|18959272|ref|NP_579856.1| potassium voltage-gated channel KQT... 42 0.014
gi|4324687|gb|AAD16988.1| potassium channel [Homo sapiens] 42 0.014
gi|26051262|ref|NP_742104.1| potassium voltage-gated channel KQT... 42 0.014
gi|3294577|gb|AAC25921.1| neuronal delayed-rectifier voltage-gat... 42 0.014
gi|26051266|ref|NP_742106.1| potassium voltage-gated channel KQT... 42 0.014
gi|50759033|ref|XP_425709.1| PREDICTED: similar to Potassium vol... 42 0.014
gi|4176412|dbj|BAA37165.1| alternative splicing:see accession be... 42 0.014
gi|4176396|dbj|BAA37157.1| alternative splicing:see accession be... 42 0.014
gi|4176398|dbj|BAA37158.1| alternative splicing:see accession be... 42 0.014
gi|4176410|dbj|BAA37164.1| alternative splicing:see accession be... 42 0.014
gi|4176402|dbj|BAA37160.1| alternative splicing:see accession be... 42 0.014
gi|4176408|dbj|BAA37163.1| alternative splicing:see accession be... 42 0.014
gi|26051264|ref|NP_742105.1| potassium voltage-gated channel KQT... 42 0.014
gi|30584387|gb|AAP36442.1| Homo sapiens potassium voltage-gated ... 42 0.014
gi|7511689|pir||T34116 voltage-gated potassium channel klq-1 - C... 42 0.014
gi|2801452|gb|AAB97315.1| potassium channel; KvEBN1 [Homo sapiens] 42 0.014
gi|26051260|ref|NP_004509.2| potassium voltage-gated channel KQT... 42 0.014
gi|2826773|emb|CAA75348.1| voltage gated potassium channel [Homo... 42 0.014
gi|4176404|dbj|BAA37161.1| alternative splicing:see accession be... 42 0.014
gi|4176400|dbj|BAA37159.1| alternative splicing:see accession be... 42 0.014
gi|25147242|ref|NP_741819.1| potassium channel, KvQLT family (82... 42 0.014
gi|14285404|sp|Q9Z351|CIQ2_MOUSE Potassium voltage-gated channel... 42 0.014
gi|4176406|dbj|BAA37162.1| alternative splicing:see accession be... 42 0.014
gi|20069141|gb|AAM09696.1| potassium channel KCNQ2 [Mus musculus] 42 0.014
gi|7510109|pir||T27083 hypothetical protein Y51A2D.19 - Caenorha... 42 0.018
gi|39595930|emb|CAE67433.1| Hypothetical protein CBG12923 [Caeno... 42 0.018
gi|13540549|ref|NP_110406.1| potassium voltage-gated channel, su... 42 0.018
gi|25154301|ref|NP_741647.1| SLOwpoke potassium channel subunit,... 42 0.018
gi|50725050|dbj|BAD33183.1| putative outward-rectifying potassiu... 42 0.018
gi|38091877|ref|XP_112511.2| similar to potassium voltage-gated ... 42 0.018
gi|38605046|sp|Q9FWX6|KCO4_ARATH Putative outward-rectifying pot... 42 0.018
gi|15217783|ref|NP_171752.1| outward rectifying potassium channe... 42 0.018
gi|50549977|ref|XP_502461.1| hypothetical protein [Yarrowia lipo... 42 0.018
gi|28898897|ref|NP_798502.1| putative potassium channel [Vibrio ... 42 0.018
gi|25154299|ref|NP_741649.1| SLOwpoke potassium channel subunit,... 42 0.018
gi|25154297|ref|NP_741648.1| SLOwpoke potassium channel subunit,... 42 0.018
gi|16758818|ref|NP_446389.1| potassium voltage-gated channel, su... 42 0.018
gi|49035146|gb|AAK18976.2| Twik family of potassium channels pro... 42 0.023
gi|34541257|ref|NP_905736.1| ion transporter [Porphyromonas ging... 42 0.023
gi|21397876|ref|NP_653861.1| KTN, KTN NAD-binding domain [Bacill... 42 0.023
gi|22535558|dbj|BAC10733.1| putative potassium channel [Oryza sa... 42 0.023
gi|17536221|ref|NP_494786.1| twk-8 protein like family member (2... 42 0.023
gi|15668310|ref|NP_247106.1| potassium channel protein [Methanoc... 42 0.023
gi|49478984|ref|YP_039385.1| potassium channel protein [Bacillus... 42 0.023
gi|46912082|emb|CAG18877.1| hypothetical potassium channel prote... 42 0.023
gi|45526586|ref|ZP_00177790.1| COG1226: Kef-type K+ transport sy... 42 0.023
gi|19110360|gb|AAL82798.1| potassium channel KCNK7 [Cavia porcel... 42 0.023
gi|17556454|ref|NP_497621.1| predicted CDS, open rectifier K+ ch... 41 0.030
gi|47223249|emb|CAF98633.1| unnamed protein product [Tetraodon n... 41 0.030
gi|47226372|emb|CAG09340.1| unnamed protein product [Tetraodon n... 41 0.030
gi|28144878|gb|AAO32309.1| putative outward rectifying potassium... 41 0.030
gi|23100733|ref|NP_694200.1| potassium channel protein [Oceanoba... 41 0.039
gi|32469495|ref|NP_862823.1| TWIK-related spinal cord K+ channel... 41 0.039
gi|47199936|emb|CAF89004.1| unnamed protein product [Tetraodon n... 41 0.039
gi|47215607|emb|CAG11638.1| unnamed protein product [Tetraodon n... 41 0.039
gi|46396287|sp|Q28265|KCA1_CANFA Calcium-activated potassium cha... 41 0.039
gi|1127824|gb|AAA84000.1| calcium activated potassium channel pr... 41 0.039
gi|46117626|ref|ZP_00174072.2| COG1226: Kef-type K+ transport sy... 41 0.039
gi|48102756|ref|XP_395425.1| similar to ENSANGP00000021246 [Apis... 41 0.039
gi|48788374|ref|ZP_00284353.1| COG1226: Kef-type K+ transport sy... 40 0.051
gi|48838131|ref|ZP_00295079.1| COG1226: Kef-type K+ transport sy... 40 0.051
gi|47086359|ref|NP_998002.1| potassium voltage-gated channel, su... 40 0.051
gi|27805971|ref|NP_776799.1| potassium voltage-gated channel, KQ... 40 0.067
gi|46391141|gb|AAS90668.1| putative potassium channel protein [O... 40 0.067
gi|48895851|ref|ZP_00328835.1| COG1226: Kef-type K+ transport sy... 40 0.067
gi|3929231|gb|AAC79846.1| potassium channel [Rattus norvegicus] 40 0.067
gi|2801450|gb|AAB97314.1| potassium channel homolog; KvEBN2 [Hom... 40 0.067
gi|41409397|ref|NP_962233.1| hypothetical protein MAP3299c [Myco... 40 0.067
gi|34899396|ref|NP_911044.1| putative outward-rectifying potassi... 40 0.067
gi|38505613|ref|NP_942234.1| slr5078 [Synechocystis sp. PCC 6803... 40 0.067
gi|15826856|ref|NP_113785.2| potassium voltage-gated channel, su... 40 0.067
gi|4758630|ref|NP_004510.1| potassium voltage-gated channel KQT-... 40 0.067
gi|23097333|ref|NP_690887.1| potassium voltage-gated channel, su... 40 0.067
gi|27364075|ref|NP_759603.1| Kef-type K+ transport system, predi... 40 0.067
gi|37678762|ref|NP_933371.1| Kef-type K+ transport system, predi... 40 0.067
gi|5830781|emb|CAB54856.1| potassium channel protein ZMK2 [Zea m... 40 0.067
gi|37679357|ref|NP_933966.1| putative potassium channel protein ... 40 0.067
gi|33595148|ref|NP_882791.1| putative potassium channel protein ... 40 0.067
gi|27366380|ref|NP_761908.1| Probable potassium channel [Vibrio ... 40 0.067
gi|50731960|ref|XP_418434.1| PREDICTED: similar to potassium vol... 40 0.067
gi|50750517|ref|XP_422030.1| PREDICTED: similar to potassium vol... 40 0.088
gi|19424136|ref|NP_598004.1| potassium channel, subfamily V, mem... 40 0.088
gi|50760596|ref|XP_418075.1| PREDICTED: potassium voltage-gated ... 40 0.088
gi|45945867|gb|AAH01914.2| KCNH2 protein [Homo sapiens] 40 0.088
gi|26051271|ref|NP_742053.1| voltage-gated potassium channel, su... 40 0.088
gi|38635441|emb|CAE82156.1| potassium voltage-gated channel, sub... 40 0.088
gi|11933152|dbj|BAB19682.1| HERG-USO [Homo sapiens] 40 0.088
gi|26006811|sp|Q9NS40|KCH7_HUMAN Potassium voltage-gated channel... 40 0.088
gi|27886653|ref|NP_150375.2| potassium voltage-gated channel, su... 40 0.088
gi|50346158|gb|AAT74902.1| potassium voltage-gated channel splic... 40 0.088
gi|21717341|gb|AAL35327.2| ERG potassium channel [Oryctolagus cu... 40 0.088
gi|22795050|gb|AAN05415.1| ether-a-go-go related potassium chann... 40 0.088
gi|26006812|sp|Q9PT84|KCH2_CHICK Potassium voltage-gated channel... 40 0.088
gi|38075778|ref|XP_358348.1| potassium voltage-gated channel KQT... 40 0.088
gi|2582017|gb|AAC53422.1| Merg1a' [Mus musculus] 40 0.088
gi|2582011|gb|AAC53419.1| Merg1b [Mus musculus] 40 0.088
gi|2582016|gb|AAC53421.1| Merg1b [Mus musculus] >gnl|BL_ORD_ID|5... 40 0.088
gi|16758828|ref|NP_446401.1| voltage-gated potassium channel, su... 40 0.088
gi|27886665|ref|NP_775185.1| potassium voltage-gated channel, su... 40 0.088
gi|26006813|sp|Q9TSZ3|KCH2_CANFA Potassium voltage-gated channel... 40 0.088
gi|4557729|ref|NP_000229.1| voltage-gated potassium channel, sub... 40 0.088
gi|26051273|ref|NP_742054.1| voltage-gated potassium channel, su... 40 0.088
gi|30583511|gb|AAP36000.1| potassium voltage-gated channel, subf... 40 0.088
gi|22971581|ref|ZP_00018526.1| hypothetical protein [Chloroflexu... 40 0.088
gi|3452413|emb|CAA09232.1| ether-a-go-go-related protein [Homo s... 40 0.088
gi|33239377|ref|NP_573470.1| potassium voltage-gated channel, su... 40 0.088
gi|29835138|gb|AAH51016.1| Kcnh2 protein [Mus musculus] 40 0.088
gi|18777774|ref|NP_571987.1| potassium channel erg3 [Rattus norv... 40 0.088
gi|34811832|gb|AAQ82708.1| potassium channel erg1a [Mus musculus] 40 0.088
gi|26006798|sp|O35219|KCH2_MOUSE Potassium voltage-gated channel... 40 0.088
gi|7305203|ref|NP_038597.1| voltage-gated potassium channel, sub... 40 0.088
gi|47225221|emb|CAF98848.1| unnamed protein product [Tetraodon n... 40 0.088
gi|15828892|ref|NP_326252.1| POTASSIUM CHANNEL PROTEIN [Mycoplas... 39 0.11
gi|2181186|emb|CAA65988.1| outward rectifying potassium channel ... 39 0.11
gi|21592756|gb|AAM64705.1| outward rectifying potassium channel ... 39 0.11
gi|47219730|emb|CAG12652.1| unnamed protein product [Tetraodon n... 39 0.11
gi|47221472|emb|CAG08134.1| unnamed protein product [Tetraodon n... 39 0.11
gi|7512004|pir||T13168 probable potassium channel elk chain - fr... 39 0.11
gi|17136946|ref|NP_477009.1| CG5076-PA [Drosophila melanogaster]... 39 0.11
gi|7489262|pir||T07396 probable outward rectifying potassium cha... 39 0.11
gi|34147232|ref|NP_899002.1| potassium channel, subfamily V, mem... 39 0.11
gi|27684873|ref|XP_220024.1| similar to potassium channel, subfa... 39 0.11
gi|33594472|ref|NP_882116.1| putative potassium channel protein ... 39 0.11
gi|33599430|ref|NP_886990.1| putative potassium channel protein ... 39 0.11
gi|34871140|ref|XP_233477.2| similar to potassium voltage-gated ... 39 0.15
gi|38176034|gb|AAK68392.2| Hypothetical protein R05G9.2 [Caenorh... 39 0.15
gi|2351698|gb|AAB68612.1| ventricular ERG K+ channel subunit [Or... 39 0.15
gi|39597105|emb|CAE59332.1| Hypothetical protein CBG02674 [Caeno... 39 0.15
gi|15240552|ref|NP_200374.1| outward rectifying potassium channe... 39 0.15
gi|26006805|sp|Q8WNY2|KCH2_RABIT Potassium voltage-gated channel... 39 0.15
gi|33357898|pdb|1P7B|A Chain A, Crystal Structure Of An Inward R... 39 0.15
gi|26333633|dbj|BAC30534.1| unnamed protein product [Mus musculus] 39 0.15
gi|5081378|gb|AAD39357.1| delayed rectifier potassium channel [O... 39 0.15
gi|26638653|ref|NP_004691.2| potassium voltage-gated channel KQT... 39 0.15
gi|48106734|ref|XP_396150.1| similar to ENSANGP00000021390 [Apis... 39 0.15
gi|6166006|sp|P56696|CIQ4_HUMAN Potassium voltage-gated channel ... 39 0.15
gi|17535453|ref|NP_495313.1| potassium channel DP4 (2G784) [Caen... 39 0.15
gi|34396038|gb|AAQ65221.1| K+-channel protein PAK2.4 [Paramecium... 39 0.15
gi|26638655|ref|NP_751895.1| potassium voltage-gated channel KQT... 39 0.15
gi|38078783|ref|XP_143960.4| potassium voltage-gated channel, su... 39 0.15
gi|16760140|ref|NP_455757.1| possible membrane transport protein... 39 0.15
gi|50876151|emb|CAG35991.1| related to voltage-gated potassium c... 39 0.15
gi|47222729|emb|CAG01696.1| unnamed protein product [Tetraodon n... 39 0.15
gi|16765085|ref|NP_460700.1| putative voltage-gated potassium ch... 39 0.15
gi|31198437|ref|XP_308166.1| ENSANGP00000009272 [Anopheles gambi... 39 0.20
gi|47212729|emb|CAF90757.1| unnamed protein product [Tetraodon n... 39 0.20
gi|47211206|emb|CAF90163.1| unnamed protein product [Tetraodon n... 39 0.20
gi|37678323|ref|NP_932932.1| conserved hypothetical protein [Vib... 39 0.20
gi|48892039|ref|ZP_00325472.1| COG0664: cAMP-binding proteins - ... 39 0.20
gi|6562375|emb|CAB62555.1| potassium channel [Daucus carota] 39 0.20
gi|14285391|sp|O73925|CIQ1_SQUAC Potassium voltage-gated channel... 39 0.20
gi|30023424|ref|NP_835055.1| Potassium channel protein [Bacillus... 39 0.20
gi|31210399|ref|XP_314166.1| ENSANGP00000003834 [Anopheles gambi... 39 0.20
gi|32566708|ref|NP_872137.1| putative protein family member, wit... 39 0.20
gi|28897195|ref|NP_796800.1| putative potassium channel protein ... 39 0.20
gi|32564066|ref|NP_496875.2| potassium channel, KvQLT family (kq... 38 0.26
gi|31217139|ref|XP_316369.1| ENSANGP00000004228 [Anopheles gambi... 38 0.26
gi|1165000|emb|CAA63601.1| K+ channel [Arabidopsis thaliana] 38 0.26
gi|15237407|ref|NP_199436.1| inward rectifying potassium channel... 38 0.26
gi|39591253|emb|CAE73306.1| Hypothetical protein CBG20733 [Caeno... 38 0.26
gi|32405542|ref|XP_323384.1| hypothetical protein [Neurospora cr... 38 0.26
gi|7510212|pir||T27186 hypothetical protein Y54G9A.3 - Caenorhab... 38 0.26
gi|46912722|emb|CAG19512.1| Putative potassium channel [Photobac... 38 0.26
>gi|17536607|ref|NP_496452.1| TWiK family of potassium channels
(twk-1) [Caenorhabditis elegans]
gi|7494859|pir||T18706 hypothetical protein B0334.2 -
Caenorhabditis elegans
Length = 290
Score = 562 bits (1448), Expect = e-159
Identities = 279/290 (96%), Positives = 279/290 (96%)
Frame = -1
Query: 873 MSLETRCRLHLWPSGVRKLLRRIAPQAXXXXXXXXXXXVGAAIFQSIDPVLGEQSFYEVV 694
MSLETRCRLHLWPSGVRKLLRRIAPQA VGAAIFQSIDPVLGEQSFYEVV
Sbjct: 1 MSLETRCRLHLWPSGVRKLLRRIAPQAIIVLILTTLMLVGAAIFQSIDPVLGEQSFYEVV 60
Query: 693 FFEFITISTIGYGNQYPQTHASRVFSIFFSILGIPLLVVTLGNFGKYLTKFYWKTHGWIF 514
FFEFITISTIGYGNQYPQTHASRVFSIFFSILGIPLLVVTLGNFGKYLTKFYWKTHGWIF
Sbjct: 61 FFEFITISTIGYGNQYPQTHASRVFSIFFSILGIPLLVVTLGNFGKYLTKFYWKTHGWIF 120
Query: 513 SERTESELVNDKDMPGIVIACLYLLTFAIGFFFIPHSGAAYSIDDCYFSFISFATVGFGD 334
SERTESELVNDKDMPGIVIACLYLLTFAIGFFFIPHSGAAYSIDDCYFSFISFATVGFGD
Sbjct: 121 SERTESELVNDKDMPGIVIACLYLLTFAIGFFFIPHSGAAYSIDDCYFSFISFATVGFGD 180
Query: 333 KVPQIDTFEKFCKVITYLVWGTILNIMLISYVTNWFTQLFARQPFRGTDVEVMIGGQCIT 154
KVPQIDTFEKFCKVITYLVWGTILNIMLISYVTNWFTQLFARQPFRGTDVEVMIGGQCIT
Sbjct: 181 KVPQIDTFEKFCKVITYLVWGTILNIMLISYVTNWFTQLFARQPFRGTDVEVMIGGQCIT 240
Query: 153 VSEITSLVAKEFHASPHQVRSILHDINGIMEDMKTEEDSEKSDILVAQDL 4
VSEITSLVAKEFHASPHQVRSILHDINGIMEDMKTEEDSEKSDILVAQDL
Sbjct: 241 VSEITSLVAKEFHASPHQVRSILHDINGIMEDMKTEEDSEKSDILVAQDL 290