Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= B0336_12
         (423 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17554750|ref|NP_498231.1| ribosomal Protein, Large subunit (1...   281   3e-75
gi|2500265|sp|Q93140|RL23_BRUMA 60S ribosomal protein L23 >gnl|B...   257   3e-68
gi|29839631|sp|Q9GNE2|RL23_AEDAE 60S ribosomal protein L23 (L17A...   253   8e-67
gi|17647883|ref|NP_523813.1| CG3661-PA [Drosophila melanogaster]...   252   1e-66
gi|29294663|gb|AAH49038.1| Zgc:73149 protein [Danio rerio]            249   8e-66
gi|41282078|ref|NP_957026.1| ribosomal protein L23; wu:fb06e03 [...   249   8e-66
gi|38571606|gb|AAH62716.1| Unknown (protein for MGC:72008) [Homo...   248   1e-65
gi|4506605|ref|NP_000969.1| ribosomal protein L23; 60S ribosomal...   248   2e-65
gi|10121725|gb|AAG13342.1| ribosomal protein L23 [Gillichthys mi...   248   2e-65
gi|30144650|gb|AAP14949.1| ribosomal protein L23 [Branchiostoma ...   246   5e-65
gi|12849613|dbj|BAB28415.1| unnamed protein product [Mus musculus]    246   5e-65
gi|49257378|gb|AAH73541.1| Unknown (protein for MGC:82808) [Xeno...   246   5e-65
gi|15081322|gb|AAK83857.1| ribosomal protein L17/23 [Spodoptera ...   246   9e-65
gi|12832665|dbj|BAB22203.1| unnamed protein product [Mus musculus]    245   2e-64
gi|279650|pir||R5HU23 ribosomal protein L23 - human                   244   2e-64
gi|4583511|gb|AAD25102.1| ribosomal protein L17 [Dicentrarchus l...   243   5e-64
gi|31236609|ref|XP_319443.1| ENSANGP00000014430 [Anopheles gambi...   243   6e-64
gi|1350673|sp|P48159|RL23_DROME 60S RIBOSOMAL PROTEIN L23 (L17A)...   243   8e-64
gi|5441537|emb|CAB46823.1| Ribosomal protein [Canis familiaris]       242   1e-63
gi|37779090|gb|AAP20205.1| ribosomal protein L17 [Pagrus major]       237   3e-62
gi|48102823|ref|XP_392812.1| similar to ribosomal protein L17/23...   237   3e-62
gi|13097600|gb|AAH03518.1| Similar to ribosomal protein L23 [Hom...   236   6e-62
gi|22758906|gb|AAN05612.1| ribosomal protein L17A [Argopecten ir...   233   5e-61
gi|33772493|gb|AAQ54648.1| 60S ribosomal protein L23 [Oikopleura...   224   2e-58
gi|15226102|ref|NP_180895.1| 60S ribosomal protein L23 (RPL23B) ...   224   3e-58
gi|13430182|gb|AAK25758.1| ribosomal protein L17 [Castanea sativa]    223   5e-58
gi|21618149|gb|AAM67199.1| putative 60S ribosomal protein L17 [A...   223   6e-58
gi|730536|sp|Q07760|RL23_TOBAC 60S RIBOSOMAL PROTEIN L23 >gnl|BL...   223   6e-58
gi|32400871|gb|AAP80667.1| ribosomal Pr 117 [Triticum aestivum]       223   8e-58
gi|37535214|ref|NP_921909.1| 60S ribosomal protein L17 [Oryza sa...   221   2e-57
gi|38048025|gb|AAR09915.1| similar to Drosophila melanogaster Rp...   219   1e-56
gi|4028025|gb|AAC96111.1| ribosomal protein L17 homolog [Dicentr...   218   3e-56
gi|17369866|sp|Q9XEK8|RL23_TORRU 60S ribosomal protein L23 (L17)...   218   3e-56
gi|25295199|pir||B86177 hypothetical protein [imported] - Arabid...   217   5e-56
gi|19075639|ref|NP_588139.1| 60s ribosomal protein L23. [Schizos...   216   1e-55
gi|49073960|ref|XP_401148.1| RL23_AEDAE 60S ribosomal protein L2...   213   5e-55
gi|6006439|emb|CAB56830.1| 60S ribosomal protein L17 [Cyanophora...   213   7e-55
gi|50255282|gb|EAL18017.1| hypothetical protein CNBK0380 [Crypto...   211   2e-54
gi|2982289|gb|AAC32130.1| 60S ribosomal protein L17 [Picea mariana]   206   6e-53
gi|50550357|ref|XP_502651.1| hypothetical protein [Yarrowia lipo...   206   1e-52
gi|6319384|ref|NP_009466.1| Protein component of the large (60S)...   205   2e-52
gi|50308523|ref|XP_454264.1| unnamed protein product [Kluyveromy...   203   7e-52
gi|45200809|ref|NP_986379.1| AGL288Wp [Eremothecium gossypii] >g...   202   1e-51
gi|50288181|ref|XP_446519.1| unnamed protein product [Candida gl...   202   2e-51
gi|3851618|gb|AAC72377.1| ribosomal protein L17 [Leishmania infa...   202   2e-51
gi|46229266|gb|EAK90115.1| 60S ribosomal protein L23, transcript...   201   3e-51
gi|32419235|ref|XP_330093.1| hypothetical protein [Neurospora cr...   197   3e-50
gi|38105852|gb|EAA52229.1| hypothetical protein MG04921.4 [Magna...   197   4e-50
gi|46107838|ref|XP_380978.1| hypothetical protein FG00802.1 [Gib...   195   1e-49
gi|40643024|emb|CAD91439.1| ribosomal protein L17A [Crassostrea ...   192   9e-49
gi|50760764|ref|XP_418122.1| PREDICTED: similar to ribosomal pro...   191   3e-48
gi|38327027|gb|AAO65478.4| alkaline serine protease [Bionectria ...   190   5e-48
gi|50428125|ref|XP_457899.1| unnamed protein product [Debaryomyc...   189   8e-48
gi|34853274|ref|XP_345326.1| similar to ribosomal protein L23 [R...   186   9e-47
gi|23484554|gb|EAA19848.1| 60S ribosomal protein L23 [Plasmodium...   185   2e-46
gi|42656610|ref|XP_377786.1| similar to ribosomal protein L23 [H...   184   3e-46
gi|23619260|ref|NP_705222.1| 60S ribosomal protein L23, putative...   184   4e-46
gi|13812126|ref|NP_113253.1| 60S ribosomal protein L23 [Guillard...   183   6e-46
gi|29246677|gb|EAA38265.1| GLP_15_22119_21691 [Giardia lamblia A...   181   2e-45
gi|46432077|gb|EAK91582.1| hypothetical protein CaO19.10998 [Can...   177   5e-44
gi|2500266|sp|Q94776|RL23_TRYCR 60S RIBOSOMAL PROTEIN L23 (L17) ...   169   9e-42
gi|47824967|gb|AAT38741.1| ribosomal protein [Solanum demissum]       165   2e-40
gi|47156919|gb|AAT12309.1| large subunit ribosomal protein L23e ...   158   2e-38
gi|19173443|ref|NP_597246.1| RIBOSOMAL PROTEIN L23 [Encephalitoz...   150   5e-36
gi|13541166|ref|NP_110854.1| 50S ribosomal protein L14 [Thermopl...   148   3e-35
gi|16082262|ref|NP_394717.1| probable 50S ribosomal protein L14 ...   147   3e-35
gi|48477722|ref|YP_023428.1| large subunit ribosomal protein L14...   146   1e-34
gi|20094654|ref|NP_614501.1| Ribosomal protein L14 [Methanopyrus...   145   2e-34
gi|14600659|ref|NP_147177.1| 50S ribosomal protein L14 [Aeropyru...   144   3e-34
gi|48852515|ref|ZP_00306701.1| COG0093: Ribosomal protein L14 [F...   142   1e-33
gi|15678044|ref|NP_275158.1| ribosomal protein L23 (E.coli L14) ...   137   6e-32
gi|38084282|ref|XP_357621.1| similar to ribosomal protein L23 [M...   134   5e-31
gi|21706701|gb|AAH34378.1| RPL23 protein [Homo sapiens]               134   5e-31
gi|15668643|ref|NP_247441.1| LSU ribosomal protein L14P (rplN) [...   132   2e-30
gi|132670|sp|P14031|RL14_METVA 50S RIBOSOMAL PROTEIN L14P >gnl|B...   131   3e-30
gi|45358972|ref|NP_988529.1| LSU ribosomal protein L14P [Methano...   131   3e-30
gi|18978186|ref|NP_579543.1| LSU ribosomal protein L14P [Pyrococ...   131   3e-30
gi|14520547|ref|NP_126022.1| LSU ribosomal protein L14P [Pyrococ...   130   4e-30
gi|14591524|ref|NP_143605.1| 50S ribosomal protein L14 [Pyrococc...   130   6e-30
gi|13124814|sp|O59427|RL14_PYRHO 50S ribosomal protein L14P           130   6e-30
gi|15790642|ref|NP_280466.1| 50S ribosomal protein L14P; Rpl14p ...   129   1e-29
gi|11499499|ref|NP_070740.1| LSU ribosomal protein L14P (rpl14P)...   129   2e-29
gi|20089952|ref|NP_616027.1| ribosomal protein L14p [Methanosarc...   128   2e-29
gi|48838693|ref|ZP_00295633.1| COG0093: Ribosomal protein L14 [M...   127   4e-29
gi|21228236|ref|NP_634158.1| LSU ribosomal protein L14P [Methano...   127   4e-29
gi|15897614|ref|NP_342219.1| LSU ribosomal protein L14AB (rpl14A...   126   8e-29
gi|50513480|pdb|1S72|K Chain K, Refined Crystal Structure Of The...   126   1e-28
gi|15920632|ref|NP_376301.1| 141aa long hypothetical 50S ribosom...   125   2e-28
gi|132667|sp|P22450|RL14_HALMA 50S ribosomal protein L14P (Hmal1...   123   7e-28
gi|20539732|ref|XP_167275.1| similar to ribosomal protein L23 [H...   122   2e-27
gi|18313850|ref|NP_560517.1| ribosomal protein L14 [Pyrobaculum ...   120   6e-27
gi|49094340|ref|XP_408631.1| hypothetical protein AN4494.2 [Aspe...   120   6e-27
gi|45269025|gb|AAS55925.1| 60S ribosomal protein L23 [Sus scrofa]     117   7e-26
gi|41614889|ref|NP_963387.1| NEQ092 [Nanoarchaeum equitans Kin4-...   111   4e-24
gi|6491770|emb|CAB61886.1| ribosomal protein L17 [Lycopersicon e...   102   2e-21
gi|1710496|sp|P52816|RL23_ONCVO 60S ribosomal protein L23 >gnl|B...    95   3e-19
gi|39997939|ref|NP_953890.1| ribosomal protein L14 [Geobacter su...    87   9e-17
gi|34764028|ref|ZP_00144914.1| LSU ribosomal protein L14P [Fusob...    84   8e-16
gi|19704956|ref|NP_602451.1| LSU ribosomal protein L14P [Fusobac...    84   8e-16
gi|34501441|ref|NP_904228.1| ribosomal protein L14 [Physcomitrel...    81   5e-15
gi|417660|sp|P33100|RL14_MICLU 50S RIBOSOMAL PROTEIN L14 >gnl|BL...    81   5e-15
gi|15488436|gb|AAL01114.1| ribosomal protein L17 [Oryctolagus cu...    81   5e-15
gi|4007873|gb|AAC95313.1| ribosomal protein L14 [Spirogyra maxima]     80   7e-15
gi|11466740|ref|NP_039336.1| ribosomal protein L14 [Marchantia p...    79   2e-14
gi|50259374|gb|EAL22047.1| hypothetical protein CNBC1850 [Crypto...    79   2e-14
gi|38233098|ref|NP_938865.1| 50S ribosomal protein L14 [Coryneba...    79   2e-14
gi|11467228|ref|NP_043060.1| ribosomal protein L14 [Zea mays] >g...    79   2e-14
gi|48478709|ref|YP_024316.1| ribosomal protein L14 [Saccharum hy...    79   2e-14
gi|46130381|ref|ZP_00202310.1| COG0093: Ribosomal protein L14 [S...    79   3e-14
gi|29348126|ref|NP_811629.1| 50S ribosomal protein L14 [Bacteroi...    79   3e-14
gi|23474530|ref|ZP_00129823.1| COG0093: Ribosomal protein L14 [D...    78   3e-14
gi|19551758|ref|NP_599760.1| ribosomal protein L14 [Corynebacter...    78   4e-14
gi|22297635|ref|NP_680882.1| 50S ribosomal protein L14 [Thermosy...    78   4e-14
gi|25027089|ref|NP_737143.1| putative 50S ribosomal protein L14 ...    78   4e-14
gi|23097584|ref|NP_691050.1| 50S ribosomal protein L14 [Oceanoba...    77   6e-14
gi|15612707|ref|NP_241010.1| 50S ribosomal protein L14; ribosoma...    77   6e-14
gi|46579724|ref|YP_010532.1| ribosomal protein L14 [Desulfovibri...    77   6e-14
gi|45531569|ref|ZP_00182609.1| COG0093: Ribosomal protein L14 [E...    77   8e-14
gi|41179017|ref|NP_958372.1| ribosomal protein L14 [Chlamydomona...    77   8e-14
gi|15835419|ref|NP_297178.1| ribosomal protein L14 [Chlamydia mu...    77   1e-13
gi|48374166|gb|AAT41879.1| 50S ribosomal subunit L14 [Fremyella ...    77   1e-13
gi|21223092|ref|NP_628871.1| 50S ribosomal protein L14 [Streptom...    76   1e-13
gi|15644238|ref|NP_229290.1| ribosomal protein L14 [Thermotoga m...    76   1e-13
gi|49574618|ref|NP_848096.2| ribosomal protein L14 [Adiantum cap...    76   2e-13
gi|23112495|ref|ZP_00097971.1| COG0093: Ribosomal protein L14 [D...    76   2e-13
gi|29831479|ref|NP_826113.1| putative ribosomal protein L14 [Str...    76   2e-13
gi|437933|emb|CAA79787.1| ribosomal protein L14 [Thermotoga mari...    76   2e-13
gi|42526289|ref|NP_971387.1| ribosomal protein L14 [Treponema de...    76   2e-13
gi|48855311|ref|ZP_00309470.1| COG0093: Ribosomal protein L14 [C...    75   2e-13
gi|11465770|ref|NP_053914.1| ribosomal protein L14 [Porphyra pur...    75   2e-13
gi|20808650|ref|NP_623821.1| Ribosomal protein L14 [Thermoanaero...    75   2e-13
gi|50657687|gb|AAT79672.1| 50S ribosomal protein L14 [Gracilaria...    75   2e-13
gi|14017608|ref|NP_114294.1| ribosomal protein L14 [Triticum aes...    75   3e-13
gi|11467772|ref|NP_050823.1| ribosomal protein L14 [Nephroselmis...    75   3e-13
gi|46364482|ref|ZP_00227097.1| COG0093: Ribosomal protein L14 [K...    75   4e-13
gi|7524926|ref|NP_045928.1| ribosomal protein L14 [Chlorella vul...    75   4e-13
gi|21674988|ref|NP_663053.1| ribosomal protein L14 [Chlorobium t...    75   4e-13
gi|48893983|ref|ZP_00327181.1| COG0093: Ribosomal protein L14 [T...    75   4e-13
gi|22956583|ref|ZP_00004338.1| COG0093: Ribosomal protein L14 [R...    74   5e-13
gi|15605247|ref|NP_220033.1| L14 Ribosomal Protein [Chlamydia tr...    74   5e-13
gi|15618547|ref|NP_224833.1| L14 Ribosomal Protein [Chlamydophil...    74   5e-13
gi|282134|pir||D42645 ribosomal protein L14 - Chlamydia trachoma...    74   5e-13
gi|15639192|ref|NP_218638.1| ribosomal protein L14 (rplN) [Trepo...    74   6e-13
gi|46199620|ref|YP_005287.1| LSU ribosomal protein L14P [Thermus...    74   6e-13
gi|26554455|ref|NP_758389.1| ribosomal protein L14 [Mycoplasma p...    74   6e-13
gi|16125507|ref|NP_420071.1| ribosomal protein L14 [Caulobacter ...    74   6e-13
gi|50725918|dbj|BAD33446.1| putative ribosomal protein L14 [Oryz...    74   6e-13
gi|11466826|ref|NP_039422.1| ribosomal protein L14 [Oryza sativa...    74   6e-13
gi|34855162|ref|XP_231617.2| similar to RIKEN cDNA D130059P03 ge...    74   6e-13
gi|11466363|ref|NP_038366.1| ribosomal protein L14 [Mesostigma v...    74   8e-13
gi|29839871|ref|NP_828977.1| ribosomal protein L14 [Chlamydophil...    74   8e-13
gi|16801832|ref|NP_472100.1| ribosomal protein L14 [Listeria inn...    74   8e-13
gi|18860348|ref|NP_569665.1| ribosomal protein L14 [Psilotum nud...    74   8e-13
gi|48835045|ref|ZP_00292047.1| COG0093: Ribosomal protein L14 [T...    74   8e-13
gi|23336511|ref|ZP_00121725.1| COG0093: Ribosomal protein L14 [B...    74   8e-13
gi|34899178|ref|NP_910935.1| chloroplast 50Sribosomal protein L1...    74   8e-13
gi|34541531|ref|NP_906010.1| ribosomal protein L14 [Porphyromona...    74   8e-13
gi|34558018|ref|NP_907833.1| 50S RIBOSOMAL PROTEIN L14 [Wolinell...    73   1e-12
gi|15645922|ref|NP_208101.1| ribosomal protein L14 (rpl14) [Heli...    73   1e-12
gi|28212168|ref|NP_783112.1| LSU ribosomal protein L14P [Clostri...    73   1e-12
gi|7519272|pir||E71186 hypothetical protein PH1769 - Pyrococcus ...    73   1e-12
gi|28493511|ref|NP_787672.1| 50S ribosomal protein L14 [Trophery...    73   1e-12
gi|50876023|emb|CAG35863.1| probable 50S ribosomal protein L14 [...    73   1e-12
gi|50843308|ref|YP_056535.1| 50S ribosomal protein L14 [Propioni...    73   1e-12
gi|5163214|gb|AAD40593.1| ribosomal protein L14 [Leptospira inte...    72   2e-12
gi|24213449|ref|NP_710930.1| ribosomal protein L14 [Leptospira i...    72   2e-12
gi|15793000|ref|NP_282823.1| 50S ribosomal protein L14 [Campylob...    72   2e-12
gi|7524689|ref|NP_042443.1| ribosomal protein L14 [Pinus thunber...    72   2e-12
gi|23024317|ref|ZP_00063533.1| COG0093: Ribosomal protein L14 [L...    72   2e-12
gi|17148896|gb|AAL35833.1| RBL1 [Cucumis sativus]                      72   2e-12
gi|42524365|ref|NP_969745.1| 50S ribosomal protein L14 [Bdellovi...    72   2e-12
gi|16077194|ref|NP_388007.1| ribosomal protein L14 [Bacillus sub...    72   2e-12
gi|50556262|ref|XP_505539.1| hypothetical protein [Yarrowia lipo...    72   2e-12
gi|50878303|gb|AAT85078.1| putative 50S ribosomal protein L14 [O...    72   2e-12
gi|15612294|ref|NP_223947.1| 50S RIBOSOMAL PROTEIN L14 [Helicoba...    72   2e-12
gi|11467336|ref|NP_043193.1| ribosomal protein L14 [Cyanophora p...    72   2e-12
gi|15836169|ref|NP_300693.1| L14 ribosomal protein [Chlamydophil...    72   2e-12
gi|39936303|ref|NP_948579.1| 50S ribosomal protein L14 [Rhodopse...    72   3e-12
gi|46311176|ref|ZP_00211786.1| COG0093: Ribosomal protein L14 [B...    72   3e-12
gi|48849962|ref|ZP_00304205.1| COG0093: Ribosomal protein L14 [N...    72   3e-12
gi|27468732|ref|NP_765369.1| 50S ribosomal protein L14 [Staphylo...    72   3e-12
gi|45917161|ref|ZP_00196307.2| COG0093: Ribosomal protein L14 [M...    72   3e-12
gi|27380501|ref|NP_772030.1| 50S ribosomal protein L14 [Bradyrhi...    72   3e-12
gi|16329931|ref|NP_440659.1| 50S ribosomal protein L14 [Synechoc...    72   3e-12
gi|49235635|ref|ZP_00329702.1| COG0093: Ribosomal protein L14 [M...    72   3e-12
gi|17987050|ref|NP_539684.1| LSU ribosomal protein L14P [Brucell...    72   3e-12
gi|15889233|ref|NP_354914.1| AGR_C_3539p [Agrobacterium tumefaci...    71   4e-12
gi|11467727|ref|NP_050779.1| ribosomal protein L14 [Guillardia t...    71   4e-12
gi|33862104|ref|NP_893665.1| 50S Ribosomal protein L14 [Prochlor...    71   4e-12
gi|11497563|ref|NP_054971.1| ribosomal protein L14 [Spinacia ole...    71   4e-12
gi|3914694|sp|O52342|RL14_MYCGA 50S ribosomal protein L14 >gnl|B...    71   5e-12
gi|48765734|ref|ZP_00270284.1| COG0093: Ribosomal protein L14 [R...    71   5e-12
gi|32266887|ref|NP_860919.1| ribosomal protein L14 [Helicobacter...    71   5e-12
gi|30018390|ref|NP_830021.1| LSU ribosomal protein L14P [Bacillu...    71   5e-12
gi|13470561|ref|NP_102130.1| 50S ribosomal protein L14 [Mesorhiz...    71   5e-12
gi|49474394|ref|YP_032436.1| 50s ribosomal protein l14 [Bartonel...    71   5e-12
gi|15925230|ref|NP_372764.1| 50S ribosomal protein L14 [Staphylo...    71   5e-12
gi|13507914|ref|NP_109863.1| ribosomal protein L14 [Mycoplasma p...    71   5e-12
gi|28261753|ref|NP_783267.1| ribosomal protein L14 [Atropa bella...    71   5e-12
gi|31544265|ref|NP_852843.1| RplN [Mycoplasma gallisepticum R] >...    71   5e-12
gi|15674297|ref|NP_268470.1| 50S ribosomal protein L14 [Streptoc...    70   7e-12
gi|132660|sp|P04450|RL14_BACST 50S ribosomal protein L14 >gnl|BL...    70   7e-12
gi|41723118|ref|ZP_00150061.1| COG0093: Ribosomal protein L14 [D...    70   7e-12
gi|49475784|ref|YP_033825.1| 50S ribosomal protein l14 [Bartonel...    70   7e-12
gi|46319573|ref|ZP_00219976.1| COG0093: Ribosomal protein L14 [B...    70   7e-12
gi|30248428|ref|NP_840498.1| Ribosomal protein L14b/L23e family ...    70   7e-12
gi|11467460|ref|NP_043606.1| ribosomal protein L14 [Odontella si...    70   7e-12
gi|37523486|ref|NP_926863.1| 50S ribosomal protein L14 [Gloeobac...    70   7e-12
gi|23124118|ref|ZP_00106129.1| COG0093: Ribosomal protein L14 [N...    70   9e-12
gi|29374861|ref|NP_814014.1| ribosomal protein L14 [Enterococcus...    70   9e-12
gi|15965119|ref|NP_385472.1| PROBABLE 50S RIBOSOMAL PROTEIN L14 ...    70   9e-12
gi|32480879|ref|NP_862790.1| ribosomal protein L14 [Calycanthus ...    70   9e-12
gi|13357801|ref|NP_078075.1| ribosomal protein L14 [Ureaplasma p...    70   9e-12
gi|47459080|ref|YP_015942.1| 50S ribosomal protein l14 [Mycoplas...    70   9e-12
gi|48857570|ref|ZP_00311564.1| COG0093: Ribosomal protein L14 [C...    70   9e-12
gi|22711950|ref|NP_683838.1| ribosomal protein L14 [Chaetosphaer...    70   9e-12
gi|15805350|ref|NP_294044.1| ribosomal protein L14 [Deinococcus ...    70   1e-11
gi|15607854|ref|NP_215228.1| rplN [Mycobacterium tuberculosis H3...    70   1e-11
gi|7525069|ref|NP_051094.1| ribosomal protein L14 [Arabidopsis t...    70   1e-11
gi|17231697|ref|NP_488245.1| 50S ribosomal protein L14 [Nostoc s...    70   1e-11
gi|34811562|pdb|1PNU|I Chain I, Crystal Structure Of A Streptomy...    70   1e-11
gi|48824732|ref|ZP_00286071.1| COG0093: Ribosomal protein L14 [E...    69   2e-11
gi|50346820|ref|YP_053191.1| ribosomal protein L14 [Nymphaea alb...    69   2e-11
gi|24380359|ref|NP_722314.1| 50S ribosomal protein L14 [Streptoc...    69   2e-11
gi|15606756|ref|NP_214136.1| ribosomal protein L14 [Aquifex aeol...    69   2e-11
gi|23104449|ref|ZP_00090913.1| COG0093: Ribosomal protein L14 [A...    69   2e-11
gi|15896373|ref|NP_349722.1| Ribosomal protein L14 [Clostridium ...    69   2e-11
gi|23470615|ref|ZP_00125947.1| COG0093: Ribosomal protein L14 [P...    69   2e-11
gi|29653600|ref|NP_819292.1| ribosomal protein L14 [Coxiella bur...    69   2e-11
gi|15900155|ref|NP_344759.1| ribosomal protein L14 [Streptococcu...    69   2e-11
gi|33866609|ref|NP_898168.1| 50S ribosomal protein L14 [Synechoc...    69   2e-11
gi|11466514|ref|NP_044763.1| ribosomal protein L14 [Reclinomonas...    69   3e-11
gi|50364948|ref|YP_053373.1| 50S ribosomal protein L14 [Mesoplas...    69   3e-11
gi|32475068|ref|NP_868062.1| 50S ribosomal protein L14 [Pirellul...    69   3e-11
gi|42561260|ref|NP_975711.1| 50S RIBOSOMAL PROTEIN L14 [Mycoplas...    69   3e-11
gi|48728501|ref|ZP_00262259.1| COG0093: Ribosomal protein L14 [P...    69   3e-11
gi|39938696|ref|NP_950462.1| ribosomal protein L14 [Onion yellow...    68   3e-11
gi|34499631|ref|NP_903846.1| 50S ribosomal protein L14 [Chromoba...    68   3e-11
gi|21672760|ref|NP_660827.1| 50S ribosomal protein L14 [Buchnera...    68   3e-11
gi|15676079|ref|NP_273210.1| 50S ribosomal protein L14 [Neisseri...    68   3e-11
gi|18311377|ref|NP_563311.1| 50S ribosomal protein L14 [Clostrid...    68   3e-11
gi|28377842|ref|NP_784734.1| ribosomal protein L14 [Lactobacillu...    68   3e-11
gi|16762853|ref|NP_458470.1| 50S ribosomal subunit protein L14 [...    68   3e-11
gi|18140856|gb|AAL60450.1| HUELLENLOS-like protein [Oryza sativa]      68   3e-11
gi|1172956|sp|P46176|RL14_BUCAK 50S RIBOSOMAL PROTEIN L14 >gnl|B...    68   3e-11
gi|48860651|ref|ZP_00314562.1| COG0093: Ribosomal protein L14 [M...    68   5e-11
gi|27904932|ref|NP_778058.1| 50S ribosomal protein L14 [Buchnera...    68   5e-11
gi|15599449|ref|NP_252943.1| 50S ribosomal protein L14 [Pseudomo...    68   5e-11
gi|23003715|ref|ZP_00047367.1| COG0093: Ribosomal protein L14 [L...    68   5e-11
gi|22725683|gb|AAN04890.1| ribosomal protein L14 [Vigna angularis]     68   5e-11
gi|46431726|gb|EAK91258.1| hypothetical protein CaO19.5684 [Cand...    68   5e-11
gi|16120557|ref|NP_403870.1| 50S ribosomal protein L14 [Yersinia...    68   5e-11
gi|13518370|ref|NP_084729.1| ribosomal protein L14 [Oenothera el...    67   6e-11
gi|3122677|sp|O32993|RL14_MYCLE 50S ribosomal protein L14 >gnl|B...    67   6e-11
gi|21230374|ref|NP_636291.1| 50S ribosomal protein L14 [Xanthomo...    67   6e-11
gi|33594491|ref|NP_882135.1| 50S ribosomal protein L14 [Bordetel...    67   6e-11
gi|15674071|ref|NP_268246.1| 50S ribosomal protein L14 [Lactococ...    67   6e-11
gi|48831556|ref|ZP_00288616.1| COG0093: Ribosomal protein L14 [M...    67   6e-11
gi|46164750|ref|ZP_00137740.2| COG0093: Ribosomal protein L14 [P...    67   6e-11
gi|11465993|ref|NP_054535.1| ribosomal protein L14 [Nicotiana ta...    67   6e-11
gi|15803837|ref|NP_289871.1| 50S ribosomal subunit protein L14 [...    67   6e-11
gi|33241151|ref|NP_876093.1| Ribosomal protein L14 [Prochlorococ...    67   6e-11
gi|46308729|ref|ZP_00210921.1| COG0093: Ribosomal protein L14 [E...    67   8e-11
gi|28202209|ref|NP_777450.1| ribosomal protein L14 [Anthoceros f...    67   8e-11
gi|12045014|ref|NP_072824.1| ribosomal protein L14 (rpL14) [Myco...    67   8e-11
gi|15827992|ref|NP_302255.1| 50S ribosomal protein L14 [Mycobact...    67   8e-11
gi|33864009|ref|NP_895569.1| 50S Ribosomal protein L14 [Prochlor...    67   8e-11
gi|48767838|ref|ZP_00272191.1| COG0093: Ribosomal protein L14 [R...    67   1e-10
gi|71223|pir||R5SP14 ribosomal protein L14, chloroplast - spinac...    67   1e-10
gi|15837764|ref|NP_298452.1| 50S ribosomal protein L14 [Xylella ...    66   1e-10
gi|22995984|ref|ZP_00040261.1| COG0093: Ribosomal protein L14 [X...    66   1e-10
gi|46446056|ref|YP_007421.1| probable 50S ribosomal protein L14 ...    66   1e-10
gi|32423683|gb|AAP81226.1| ribosomal protein L14 [Candidatus Por...    66   1e-10
gi|7674189|sp|Q9ZI42|RL14_AQUPY 50S ribosomal protein L14 >gnl|B...    66   1e-10
gi|48871246|ref|ZP_00323962.1| COG0093: Ribosomal protein L14 [P...    66   2e-10
gi|17547728|ref|NP_521130.1| PROBABLE 50S RIBOSOMAL SUBUNIT PROT...    66   2e-10
gi|11467012|ref|NP_041919.1| ribosomal protein L14 [Euglena grac...    66   2e-10
gi|3122676|sp|O31165|RL14_SPICI 50S ribosomal protein L14 >gnl|B...    65   2e-10
gi|48864645|ref|ZP_00318531.1| COG0093: Ribosomal protein L14 [O...    65   2e-10
gi|34500950|ref|NP_904135.1| ribosomal protein L14 [Amborella tr...    65   2e-10
gi|15617108|ref|NP_240321.1| 50S ribosomal protein L14 [Buchnera...    65   2e-10
gi|13518474|ref|NP_084833.1| ribosomal protein L14 [Lotus cornic...    65   2e-10
gi|15829048|ref|NP_326408.1| 50S RIBOSOMAL PROTEIN L14 [Mycoplas...    65   2e-10
gi|23014078|ref|ZP_00053915.1| COG0093: Ribosomal protein L14 [M...    65   3e-10
gi|48781558|ref|ZP_00278149.1| COG0093: Ribosomal protein L14 [B...    65   3e-10
gi|37528533|ref|NP_931878.1| 50S ribosomal protein L14 [Photorha...    65   4e-10
gi|45525168|ref|ZP_00176414.1| COG0093: Ribosomal protein L14 [C...    64   5e-10
gi|15642581|ref|NP_232214.1| ribosomal protein L14 [Vibrio chole...    64   5e-10
gi|23482150|gb|EAA18215.1| LSU ribosomal protein L14P [Plasmodiu...    64   7e-10
gi|34849402|gb|AAP58901.1| ribosomal protein L14 [Spiroplasma ku...    64   7e-10
gi|42520520|ref|NP_966435.1| ribosomal protein L14 [Wolbachia en...    64   9e-10
gi|45658693|ref|YP_002779.1| 50S ribosomal protein L14 [Leptospi...    64   9e-10
gi|32035723|ref|ZP_00135604.1| COG0093: Ribosomal protein L14 [A...    64   9e-10
gi|27364205|ref|NP_759733.1| Ribosomal protein L14 [Vibrio vulni...    64   9e-10
gi|15603270|ref|NP_246344.1| RpL14 [Pasteurella multocida Pm70] ...    64   9e-10
gi|33519668|ref|NP_878500.1| 50S ribosomal subunit protein L14 [...    63   1e-09
gi|23467450|ref|ZP_00123031.1| COG0093: Ribosomal protein L14 [H...    63   1e-09
gi|15594833|ref|NP_212622.1| ribosomal protein L14 (rplN) [Borre...    63   1e-09
gi|6015769|emb|CAB57596.1| hypothetical protein [Sulfolobus solf...    63   1e-09
gi|30468192|ref|NP_849079.1| ribosomal protein L14 [Cyanidioschy...    62   2e-09
gi|24371839|ref|NP_715881.1| ribosomal protein L14 [Shewanella o...    62   2e-09
gi|28897041|ref|NP_796646.1| ribosomal protein L14 [Vibrio parah...    62   2e-09
gi|11465432|ref|NP_045177.1| ribosomal protein L14 [Cyanidium ca...    62   2e-09
gi|46141796|ref|ZP_00147203.2| COG0093: Ribosomal protein L14 [P...    62   3e-09
gi|50086205|ref|YP_047715.1| 50S ribosomal protein L14 [Acinetob...    62   3e-09
gi|46911971|emb|CAG18769.1| putative ribosomal protein L14 [Phot...    61   4e-09
gi|12545440|ref|NP_074990.1| ribosomal protein L14 [Euglena long...    61   6e-09
gi|23613214|ref|NP_703536.1| 50S ribosomal subunit protein L14, ...    60   7e-09
gi|15604495|ref|NP_221013.1| 50S RIBOSOMAL PROTEIN L14 (rplN) [R...    60   1e-08
gi|15892919|ref|NP_360633.1| 50S ribosomal protein L14 [Ricketts...    59   2e-08
gi|11466628|ref|NP_066311.1| ribosomal protein L14 [Malawimonas ...    59   3e-08
gi|42454068|ref|ZP_00153975.1| hypothetical protein Rick095001 [...    58   4e-08
gi|50590427|ref|ZP_00331810.1| COG0093: Ribosomal protein L14 [S...    58   4e-08
gi|32491302|ref|NP_871556.1| rplN [Wigglesworthia glossinidia en...    58   4e-08
gi|47574129|ref|ZP_00244165.1| COG0093: Ribosomal protein L14 [R...    57   6e-08
gi|17222553|gb|AAL36726.1| ribosomal protein L14 [Mesostigma vir...    57   8e-08
gi|30694896|ref|NP_851140.1| ribosomal protein L14 family protei...    57   8e-08
gi|20260394|gb|AAM13095.1| unknown protein [Arabidopsis thaliana...    57   8e-08
gi|30694900|ref|NP_199428.3| ribosomal protein L14 family protei...    57   8e-08
gi|9757736|dbj|BAB08261.1| 50S ribosomal protein L14 [Arabidopsi...    57   1e-07
gi|45547041|ref|ZP_00187102.1| COG0093: Ribosomal protein L14 [R...    56   2e-07
gi|49097646|ref|XP_410283.1| hypothetical protein AN6146.2 [Aspe...    54   7e-07
gi|49068904|ref|XP_398741.1| hypothetical protein UM01126.1 [Ust...    53   1e-06
gi|11466201|ref|NP_066524.1| ribosomal protein L14 [Naegleria gr...    53   2e-06
gi|8778471|gb|AAF79479.1| F1L3.27 [Arabidopsis thaliana]               52   3e-06
gi|21555596|gb|AAM63894.1| ribosomal protein, putative [Arabidop...    52   3e-06
gi|15220161|ref|NP_173200.1| ribosomal protein L14 family protei...    52   3e-06
gi|18140858|gb|AAL60451.1| HUELLENLOS [Arabidopsis thaliana]           52   3e-06
gi|45507558|ref|ZP_00159901.1| COG0093: Ribosomal protein L14 [A...    51   4e-06
gi|38106861|gb|EAA53115.1| hypothetical protein MG07392.4 [Magna...    51   4e-06
gi|32418238|ref|XP_329597.1| hypothetical protein [Neurospora cr...    51   6e-06
gi|50261285|ref|YP_052893.1| ribosomal protein L14 [Saprolegnia ...    50   1e-05
gi|22995898|ref|ZP_00040186.1| COG0093: Ribosomal protein L14 [X...    50   1e-05
gi|50414368|ref|XP_457400.1| unnamed protein product [Debaryomyc...    50   1e-05
gi|46124305|ref|XP_386706.1| hypothetical protein FG06530.1 [Gib...    50   1e-05
gi|6066167|gb|AAF03185.1| ribosomal protein L14 [Nephroselmis ol...    47   6e-05
gi|21398078|ref|NP_654063.1| Ribosomal_L14, Ribosomal protein L1...    47   6e-05
gi|11465894|ref|NP_066443.1| ribosomal protein L14 [Ochromonas d...    47   8e-05
gi|13272307|gb|AAK17090.1| ribosomal protein L14 [Candidatus Car...    47   1e-04
gi|38638305|ref|NP_943672.1| ribosomal protein L14 [Chara vulgar...    46   1e-04
gi|50302733|ref|XP_451303.1| unnamed protein product [Kluyveromy...    45   2e-04
gi|19113273|ref|NP_596481.1| putative 50s ribosomal protein l14 ...    45   4e-04
gi|11466306|ref|NP_051134.1| ribosomal protein L14 [Cafeteria ro...    44   7e-04
gi|6322678|ref|NP_012751.1| Mitochondrial ribosomal protein of t...    41   0.005
gi|45190488|ref|NP_984742.1| AEL119Wp [Eremothecium gossypii] >g...    40   0.008
gi|50294594|ref|XP_449708.1| unnamed protein product [Candida gl...    40   0.008
gi|31442371|ref|NP_852628.1| ribosomal protein L14 [Eimeria tene...    40   0.010
gi|11466570|ref|NP_066460.1| ribosomal protein L14 [Rhodomonas s...    40   0.010
gi|8954384|ref|NP_059373.1| ribosomal protein L14 [Cyanidioschyz...    40   0.013
gi|7524998|ref|NP_050096.1| ribosomal protein L14 [Dictyostelium...    40   0.013
gi|8928583|ref|NP_059388.1| ribosomal protein L14 [Paramecium au...    39   0.017
gi|9695373|ref|NP_037595.1| ribosomal protein L14 [Phytophthora ...    38   0.039
gi|11466293|ref|NP_049608.1| ribosomal protein L14 [Tetrahymena ...    36   0.19
gi|47225094|emb|CAF98721.1| unnamed protein product [Tetraodon n...    35   0.25
gi|15027671|ref|NP_149405.1| ribosomal protein L14 [Tetrahymena ...    34   0.56
gi|49147208|ref|YP_025801.1| ribosomal protein L14 [Pseudendoclo...    34   0.73
gi|20373167|ref|NP_619621.1| LUC7-like 2; CGI-74-like SR-rich; C...    33   0.95
gi|49071560|ref|XP_400069.1| hypothetical protein UM02454.1 [Ust...    33   1.2
gi|19921544|ref|NP_609981.1| CG10137-PA [Drosophila melanogaster...    33   1.6
gi|20090839|ref|NP_616914.1| sensory transduction histidine kina...    32   2.1
gi|41055419|ref|NP_957478.1| similar to proteasome (prosome, mac...    32   2.1
gi|20092160|ref|NP_618235.1| sensory transduction histidine kina...    32   2.8
gi|47222707|emb|CAG00141.1| unnamed protein product [Tetraodon n...    32   2.8
gi|2246475|gb|AAB62600.1| ORF 64, large tegument protein homolog...    32   2.8
gi|18846034|ref|NP_572120.1| ORF 64; tegument protein homolog; E...    32   2.8
gi|47216197|emb|CAG01231.1| unnamed protein product [Tetraodon n...    32   2.8
gi|21228817|ref|NP_634739.1| hypothetical protein MM2715 [Methan...    32   3.6
gi|27382055|ref|NP_773584.1| HupU protein [Bradyrhizobium japoni...    32   3.6
gi|34498770|ref|NP_902985.1| conserved hypothetical protein [Chr...    32   3.6
gi|7440847|pir||S72294 ribosomal protein L14 - Plasmodium falcip...    31   4.7
gi|48838961|ref|ZP_00295897.1| COG2202: FOG: PAS/PAC domain [Met...    31   4.7
gi|47116960|sp|Q9Y383|L7L2_HUMAN Putative RNA-binding protein Lu...    31   6.2
gi|23466045|ref|NP_696648.1| hypothetical protein BL1488 [Bifido...    31   6.2
gi|47115719|sp|Q7TNC4|L7L2_MOUSE Putative RNA-binding protein Lu...    31   6.2
gi|7022826|dbj|BAA91737.1| unnamed protein product [Homo sapiens]      31   6.2
gi|34855164|ref|XP_231620.2| similar to CGI-74-like SR-rich prot...    31   6.2
gi|7959052|dbj|BAA95933.1| Orf1 [Clostridium perfringens]              31   6.2
gi|4929587|gb|AAD34054.1| CGI-59 protein [Homo sapiens]                31   6.2
gi|7706310|ref|NP_057103.1| LUC7-like 2; CGI-74 protein; CGI-59 ...    31   6.2
gi|17558882|ref|NP_506598.1| putative cytoplasmic protein (16.5 ...    31   6.2
gi|12805661|gb|AAH02314.1| Luc7l2 protein [Mus musculus]               31   6.2
gi|39589879|emb|CAE60877.1| Hypothetical protein CBG04589 [Caeno...    31   6.2
gi|27503744|gb|AAH42625.1| LUC7L2 protein [Homo sapiens]               31   6.2
gi|21228379|ref|NP_634301.1| hypothetical sensory transduction h...    31   6.2
gi|34532335|dbj|BAC86391.1| unnamed protein product [Homo sapiens]     30   8.1
gi|7512678|pir||T17269 hypothetical protein DKFZp434N231.1 - hum...    30   8.1
gi|50744602|ref|XP_419795.1| PREDICTED: similar to hypothetical ...    30   8.1
gi|47218803|emb|CAG02788.1| unnamed protein product [Tetraodon n...    30   8.1
gi|18311331|ref|NP_563265.1| conserved hypothetical protein [Clo...    30   8.1
gi|38348420|ref|NP_940975.1| GAAI470 [Homo sapiens] >gnl|BL_ORD_...    30   8.1
gi|3413850|dbj|BAA32289.1| KIAA0444 protein [Homo sapiens]             30   8.1
gi|24308089|ref|NP_056372.1| chromodomain helicase DNA binding p...    30   8.1
gi|50728628|ref|XP_416210.1| PREDICTED: similar to LUC7L2 protei...    30   8.1
gi|39589232|emb|CAE57965.1| Hypothetical protein CBG01026 [Caeno...    30   8.1
gi|49127354|ref|XP_412782.1| hypothetical protein AN8645.2 [Aspe...    30   8.1
gi|20090694|ref|NP_616769.1| sensory transduction histidine kina...    30   8.1
gi|30268589|dbj|BAC76023.1| opsin [Branchiostoma belcheri]             30   8.1


>gi|17554750|ref|NP_498231.1| ribosomal Protein, Large subunit (15.0
           kD) (rpl-23) [Caenorhabditis elegans]
 gi|1350671|sp|P48158|RL23_CAEEL 60S ribosomal protein L23
 gi|7440841|pir||T15337 hypothetical protein B0336.10 -
           Caenorhabditis elegans
 gi|13324872|gb|AAK18857.1| Ribosomal protein, large subunit protein
           23 [Caenorhabditis elegans]
 gi|39584899|emb|CAE64323.1| Hypothetical protein CBG09001
           [Caenorhabditis briggsae]
          Length = 140

 Score =  281 bits (718), Expect = 3e-75
 Identities = 140/140 (100%), Positives = 140/140 (100%)
 Frame = -1

Query: 423 MSKRGRGGASGAKFRISLGLPVGAVMNCADNTGAKNLFVISVYGIRGRLNRLPSAGVGDM 244
           MSKRGRGGASGAKFRISLGLPVGAVMNCADNTGAKNLFVISVYGIRGRLNRLPSAGVGDM
Sbjct: 1   MSKRGRGGASGAKFRISLGLPVGAVMNCADNTGAKNLFVISVYGIRGRLNRLPSAGVGDM 60

Query: 243 FVCSVKKGKPELRKKVLQGVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP 64
           FVCSVKKGKPELRKKVLQGVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP
Sbjct: 61  FVCSVKKGKPELRKKVLQGVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP 120

Query: 63  VAKECADLWPRIAANAGSIA 4
           VAKECADLWPRIAANAGSIA
Sbjct: 121 VAKECADLWPRIAANAGSIA 140




[DB home][top]