Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= B0336_12
(423 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17554750|ref|NP_498231.1| ribosomal Protein, Large subunit (1... 281 3e-75
gi|2500265|sp|Q93140|RL23_BRUMA 60S ribosomal protein L23 >gnl|B... 257 3e-68
gi|29839631|sp|Q9GNE2|RL23_AEDAE 60S ribosomal protein L23 (L17A... 253 8e-67
gi|17647883|ref|NP_523813.1| CG3661-PA [Drosophila melanogaster]... 252 1e-66
gi|29294663|gb|AAH49038.1| Zgc:73149 protein [Danio rerio] 249 8e-66
gi|41282078|ref|NP_957026.1| ribosomal protein L23; wu:fb06e03 [... 249 8e-66
gi|38571606|gb|AAH62716.1| Unknown (protein for MGC:72008) [Homo... 248 1e-65
gi|4506605|ref|NP_000969.1| ribosomal protein L23; 60S ribosomal... 248 2e-65
gi|10121725|gb|AAG13342.1| ribosomal protein L23 [Gillichthys mi... 248 2e-65
gi|30144650|gb|AAP14949.1| ribosomal protein L23 [Branchiostoma ... 246 5e-65
gi|12849613|dbj|BAB28415.1| unnamed protein product [Mus musculus] 246 5e-65
gi|49257378|gb|AAH73541.1| Unknown (protein for MGC:82808) [Xeno... 246 5e-65
gi|15081322|gb|AAK83857.1| ribosomal protein L17/23 [Spodoptera ... 246 9e-65
gi|12832665|dbj|BAB22203.1| unnamed protein product [Mus musculus] 245 2e-64
gi|279650|pir||R5HU23 ribosomal protein L23 - human 244 2e-64
gi|4583511|gb|AAD25102.1| ribosomal protein L17 [Dicentrarchus l... 243 5e-64
gi|31236609|ref|XP_319443.1| ENSANGP00000014430 [Anopheles gambi... 243 6e-64
gi|1350673|sp|P48159|RL23_DROME 60S RIBOSOMAL PROTEIN L23 (L17A)... 243 8e-64
gi|5441537|emb|CAB46823.1| Ribosomal protein [Canis familiaris] 242 1e-63
gi|37779090|gb|AAP20205.1| ribosomal protein L17 [Pagrus major] 237 3e-62
gi|48102823|ref|XP_392812.1| similar to ribosomal protein L17/23... 237 3e-62
gi|13097600|gb|AAH03518.1| Similar to ribosomal protein L23 [Hom... 236 6e-62
gi|22758906|gb|AAN05612.1| ribosomal protein L17A [Argopecten ir... 233 5e-61
gi|33772493|gb|AAQ54648.1| 60S ribosomal protein L23 [Oikopleura... 224 2e-58
gi|15226102|ref|NP_180895.1| 60S ribosomal protein L23 (RPL23B) ... 224 3e-58
gi|13430182|gb|AAK25758.1| ribosomal protein L17 [Castanea sativa] 223 5e-58
gi|21618149|gb|AAM67199.1| putative 60S ribosomal protein L17 [A... 223 6e-58
gi|730536|sp|Q07760|RL23_TOBAC 60S RIBOSOMAL PROTEIN L23 >gnl|BL... 223 6e-58
gi|32400871|gb|AAP80667.1| ribosomal Pr 117 [Triticum aestivum] 223 8e-58
gi|37535214|ref|NP_921909.1| 60S ribosomal protein L17 [Oryza sa... 221 2e-57
gi|38048025|gb|AAR09915.1| similar to Drosophila melanogaster Rp... 219 1e-56
gi|4028025|gb|AAC96111.1| ribosomal protein L17 homolog [Dicentr... 218 3e-56
gi|17369866|sp|Q9XEK8|RL23_TORRU 60S ribosomal protein L23 (L17)... 218 3e-56
gi|25295199|pir||B86177 hypothetical protein [imported] - Arabid... 217 5e-56
gi|19075639|ref|NP_588139.1| 60s ribosomal protein L23. [Schizos... 216 1e-55
gi|49073960|ref|XP_401148.1| RL23_AEDAE 60S ribosomal protein L2... 213 5e-55
gi|6006439|emb|CAB56830.1| 60S ribosomal protein L17 [Cyanophora... 213 7e-55
gi|50255282|gb|EAL18017.1| hypothetical protein CNBK0380 [Crypto... 211 2e-54
gi|2982289|gb|AAC32130.1| 60S ribosomal protein L17 [Picea mariana] 206 6e-53
gi|50550357|ref|XP_502651.1| hypothetical protein [Yarrowia lipo... 206 1e-52
gi|6319384|ref|NP_009466.1| Protein component of the large (60S)... 205 2e-52
gi|50308523|ref|XP_454264.1| unnamed protein product [Kluyveromy... 203 7e-52
gi|45200809|ref|NP_986379.1| AGL288Wp [Eremothecium gossypii] >g... 202 1e-51
gi|50288181|ref|XP_446519.1| unnamed protein product [Candida gl... 202 2e-51
gi|3851618|gb|AAC72377.1| ribosomal protein L17 [Leishmania infa... 202 2e-51
gi|46229266|gb|EAK90115.1| 60S ribosomal protein L23, transcript... 201 3e-51
gi|32419235|ref|XP_330093.1| hypothetical protein [Neurospora cr... 197 3e-50
gi|38105852|gb|EAA52229.1| hypothetical protein MG04921.4 [Magna... 197 4e-50
gi|46107838|ref|XP_380978.1| hypothetical protein FG00802.1 [Gib... 195 1e-49
gi|40643024|emb|CAD91439.1| ribosomal protein L17A [Crassostrea ... 192 9e-49
gi|50760764|ref|XP_418122.1| PREDICTED: similar to ribosomal pro... 191 3e-48
gi|38327027|gb|AAO65478.4| alkaline serine protease [Bionectria ... 190 5e-48
gi|50428125|ref|XP_457899.1| unnamed protein product [Debaryomyc... 189 8e-48
gi|34853274|ref|XP_345326.1| similar to ribosomal protein L23 [R... 186 9e-47
gi|23484554|gb|EAA19848.1| 60S ribosomal protein L23 [Plasmodium... 185 2e-46
gi|42656610|ref|XP_377786.1| similar to ribosomal protein L23 [H... 184 3e-46
gi|23619260|ref|NP_705222.1| 60S ribosomal protein L23, putative... 184 4e-46
gi|13812126|ref|NP_113253.1| 60S ribosomal protein L23 [Guillard... 183 6e-46
gi|29246677|gb|EAA38265.1| GLP_15_22119_21691 [Giardia lamblia A... 181 2e-45
gi|46432077|gb|EAK91582.1| hypothetical protein CaO19.10998 [Can... 177 5e-44
gi|2500266|sp|Q94776|RL23_TRYCR 60S RIBOSOMAL PROTEIN L23 (L17) ... 169 9e-42
gi|47824967|gb|AAT38741.1| ribosomal protein [Solanum demissum] 165 2e-40
gi|47156919|gb|AAT12309.1| large subunit ribosomal protein L23e ... 158 2e-38
gi|19173443|ref|NP_597246.1| RIBOSOMAL PROTEIN L23 [Encephalitoz... 150 5e-36
gi|13541166|ref|NP_110854.1| 50S ribosomal protein L14 [Thermopl... 148 3e-35
gi|16082262|ref|NP_394717.1| probable 50S ribosomal protein L14 ... 147 3e-35
gi|48477722|ref|YP_023428.1| large subunit ribosomal protein L14... 146 1e-34
gi|20094654|ref|NP_614501.1| Ribosomal protein L14 [Methanopyrus... 145 2e-34
gi|14600659|ref|NP_147177.1| 50S ribosomal protein L14 [Aeropyru... 144 3e-34
gi|48852515|ref|ZP_00306701.1| COG0093: Ribosomal protein L14 [F... 142 1e-33
gi|15678044|ref|NP_275158.1| ribosomal protein L23 (E.coli L14) ... 137 6e-32
gi|38084282|ref|XP_357621.1| similar to ribosomal protein L23 [M... 134 5e-31
gi|21706701|gb|AAH34378.1| RPL23 protein [Homo sapiens] 134 5e-31
gi|15668643|ref|NP_247441.1| LSU ribosomal protein L14P (rplN) [... 132 2e-30
gi|132670|sp|P14031|RL14_METVA 50S RIBOSOMAL PROTEIN L14P >gnl|B... 131 3e-30
gi|45358972|ref|NP_988529.1| LSU ribosomal protein L14P [Methano... 131 3e-30
gi|18978186|ref|NP_579543.1| LSU ribosomal protein L14P [Pyrococ... 131 3e-30
gi|14520547|ref|NP_126022.1| LSU ribosomal protein L14P [Pyrococ... 130 4e-30
gi|14591524|ref|NP_143605.1| 50S ribosomal protein L14 [Pyrococc... 130 6e-30
gi|13124814|sp|O59427|RL14_PYRHO 50S ribosomal protein L14P 130 6e-30
gi|15790642|ref|NP_280466.1| 50S ribosomal protein L14P; Rpl14p ... 129 1e-29
gi|11499499|ref|NP_070740.1| LSU ribosomal protein L14P (rpl14P)... 129 2e-29
gi|20089952|ref|NP_616027.1| ribosomal protein L14p [Methanosarc... 128 2e-29
gi|48838693|ref|ZP_00295633.1| COG0093: Ribosomal protein L14 [M... 127 4e-29
gi|21228236|ref|NP_634158.1| LSU ribosomal protein L14P [Methano... 127 4e-29
gi|15897614|ref|NP_342219.1| LSU ribosomal protein L14AB (rpl14A... 126 8e-29
gi|50513480|pdb|1S72|K Chain K, Refined Crystal Structure Of The... 126 1e-28
gi|15920632|ref|NP_376301.1| 141aa long hypothetical 50S ribosom... 125 2e-28
gi|132667|sp|P22450|RL14_HALMA 50S ribosomal protein L14P (Hmal1... 123 7e-28
gi|20539732|ref|XP_167275.1| similar to ribosomal protein L23 [H... 122 2e-27
gi|18313850|ref|NP_560517.1| ribosomal protein L14 [Pyrobaculum ... 120 6e-27
gi|49094340|ref|XP_408631.1| hypothetical protein AN4494.2 [Aspe... 120 6e-27
gi|45269025|gb|AAS55925.1| 60S ribosomal protein L23 [Sus scrofa] 117 7e-26
gi|41614889|ref|NP_963387.1| NEQ092 [Nanoarchaeum equitans Kin4-... 111 4e-24
gi|6491770|emb|CAB61886.1| ribosomal protein L17 [Lycopersicon e... 102 2e-21
gi|1710496|sp|P52816|RL23_ONCVO 60S ribosomal protein L23 >gnl|B... 95 3e-19
gi|39997939|ref|NP_953890.1| ribosomal protein L14 [Geobacter su... 87 9e-17
gi|34764028|ref|ZP_00144914.1| LSU ribosomal protein L14P [Fusob... 84 8e-16
gi|19704956|ref|NP_602451.1| LSU ribosomal protein L14P [Fusobac... 84 8e-16
gi|34501441|ref|NP_904228.1| ribosomal protein L14 [Physcomitrel... 81 5e-15
gi|417660|sp|P33100|RL14_MICLU 50S RIBOSOMAL PROTEIN L14 >gnl|BL... 81 5e-15
gi|15488436|gb|AAL01114.1| ribosomal protein L17 [Oryctolagus cu... 81 5e-15
gi|4007873|gb|AAC95313.1| ribosomal protein L14 [Spirogyra maxima] 80 7e-15
gi|11466740|ref|NP_039336.1| ribosomal protein L14 [Marchantia p... 79 2e-14
gi|50259374|gb|EAL22047.1| hypothetical protein CNBC1850 [Crypto... 79 2e-14
gi|38233098|ref|NP_938865.1| 50S ribosomal protein L14 [Coryneba... 79 2e-14
gi|11467228|ref|NP_043060.1| ribosomal protein L14 [Zea mays] >g... 79 2e-14
gi|48478709|ref|YP_024316.1| ribosomal protein L14 [Saccharum hy... 79 2e-14
gi|46130381|ref|ZP_00202310.1| COG0093: Ribosomal protein L14 [S... 79 3e-14
gi|29348126|ref|NP_811629.1| 50S ribosomal protein L14 [Bacteroi... 79 3e-14
gi|23474530|ref|ZP_00129823.1| COG0093: Ribosomal protein L14 [D... 78 3e-14
gi|19551758|ref|NP_599760.1| ribosomal protein L14 [Corynebacter... 78 4e-14
gi|22297635|ref|NP_680882.1| 50S ribosomal protein L14 [Thermosy... 78 4e-14
gi|25027089|ref|NP_737143.1| putative 50S ribosomal protein L14 ... 78 4e-14
gi|23097584|ref|NP_691050.1| 50S ribosomal protein L14 [Oceanoba... 77 6e-14
gi|15612707|ref|NP_241010.1| 50S ribosomal protein L14; ribosoma... 77 6e-14
gi|46579724|ref|YP_010532.1| ribosomal protein L14 [Desulfovibri... 77 6e-14
gi|45531569|ref|ZP_00182609.1| COG0093: Ribosomal protein L14 [E... 77 8e-14
gi|41179017|ref|NP_958372.1| ribosomal protein L14 [Chlamydomona... 77 8e-14
gi|15835419|ref|NP_297178.1| ribosomal protein L14 [Chlamydia mu... 77 1e-13
gi|48374166|gb|AAT41879.1| 50S ribosomal subunit L14 [Fremyella ... 77 1e-13
gi|21223092|ref|NP_628871.1| 50S ribosomal protein L14 [Streptom... 76 1e-13
gi|15644238|ref|NP_229290.1| ribosomal protein L14 [Thermotoga m... 76 1e-13
gi|49574618|ref|NP_848096.2| ribosomal protein L14 [Adiantum cap... 76 2e-13
gi|23112495|ref|ZP_00097971.1| COG0093: Ribosomal protein L14 [D... 76 2e-13
gi|29831479|ref|NP_826113.1| putative ribosomal protein L14 [Str... 76 2e-13
gi|437933|emb|CAA79787.1| ribosomal protein L14 [Thermotoga mari... 76 2e-13
gi|42526289|ref|NP_971387.1| ribosomal protein L14 [Treponema de... 76 2e-13
gi|48855311|ref|ZP_00309470.1| COG0093: Ribosomal protein L14 [C... 75 2e-13
gi|11465770|ref|NP_053914.1| ribosomal protein L14 [Porphyra pur... 75 2e-13
gi|20808650|ref|NP_623821.1| Ribosomal protein L14 [Thermoanaero... 75 2e-13
gi|50657687|gb|AAT79672.1| 50S ribosomal protein L14 [Gracilaria... 75 2e-13
gi|14017608|ref|NP_114294.1| ribosomal protein L14 [Triticum aes... 75 3e-13
gi|11467772|ref|NP_050823.1| ribosomal protein L14 [Nephroselmis... 75 3e-13
gi|46364482|ref|ZP_00227097.1| COG0093: Ribosomal protein L14 [K... 75 4e-13
gi|7524926|ref|NP_045928.1| ribosomal protein L14 [Chlorella vul... 75 4e-13
gi|21674988|ref|NP_663053.1| ribosomal protein L14 [Chlorobium t... 75 4e-13
gi|48893983|ref|ZP_00327181.1| COG0093: Ribosomal protein L14 [T... 75 4e-13
gi|22956583|ref|ZP_00004338.1| COG0093: Ribosomal protein L14 [R... 74 5e-13
gi|15605247|ref|NP_220033.1| L14 Ribosomal Protein [Chlamydia tr... 74 5e-13
gi|15618547|ref|NP_224833.1| L14 Ribosomal Protein [Chlamydophil... 74 5e-13
gi|282134|pir||D42645 ribosomal protein L14 - Chlamydia trachoma... 74 5e-13
gi|15639192|ref|NP_218638.1| ribosomal protein L14 (rplN) [Trepo... 74 6e-13
gi|46199620|ref|YP_005287.1| LSU ribosomal protein L14P [Thermus... 74 6e-13
gi|26554455|ref|NP_758389.1| ribosomal protein L14 [Mycoplasma p... 74 6e-13
gi|16125507|ref|NP_420071.1| ribosomal protein L14 [Caulobacter ... 74 6e-13
gi|50725918|dbj|BAD33446.1| putative ribosomal protein L14 [Oryz... 74 6e-13
gi|11466826|ref|NP_039422.1| ribosomal protein L14 [Oryza sativa... 74 6e-13
gi|34855162|ref|XP_231617.2| similar to RIKEN cDNA D130059P03 ge... 74 6e-13
gi|11466363|ref|NP_038366.1| ribosomal protein L14 [Mesostigma v... 74 8e-13
gi|29839871|ref|NP_828977.1| ribosomal protein L14 [Chlamydophil... 74 8e-13
gi|16801832|ref|NP_472100.1| ribosomal protein L14 [Listeria inn... 74 8e-13
gi|18860348|ref|NP_569665.1| ribosomal protein L14 [Psilotum nud... 74 8e-13
gi|48835045|ref|ZP_00292047.1| COG0093: Ribosomal protein L14 [T... 74 8e-13
gi|23336511|ref|ZP_00121725.1| COG0093: Ribosomal protein L14 [B... 74 8e-13
gi|34899178|ref|NP_910935.1| chloroplast 50Sribosomal protein L1... 74 8e-13
gi|34541531|ref|NP_906010.1| ribosomal protein L14 [Porphyromona... 74 8e-13
gi|34558018|ref|NP_907833.1| 50S RIBOSOMAL PROTEIN L14 [Wolinell... 73 1e-12
gi|15645922|ref|NP_208101.1| ribosomal protein L14 (rpl14) [Heli... 73 1e-12
gi|28212168|ref|NP_783112.1| LSU ribosomal protein L14P [Clostri... 73 1e-12
gi|7519272|pir||E71186 hypothetical protein PH1769 - Pyrococcus ... 73 1e-12
gi|28493511|ref|NP_787672.1| 50S ribosomal protein L14 [Trophery... 73 1e-12
gi|50876023|emb|CAG35863.1| probable 50S ribosomal protein L14 [... 73 1e-12
gi|50843308|ref|YP_056535.1| 50S ribosomal protein L14 [Propioni... 73 1e-12
gi|5163214|gb|AAD40593.1| ribosomal protein L14 [Leptospira inte... 72 2e-12
gi|24213449|ref|NP_710930.1| ribosomal protein L14 [Leptospira i... 72 2e-12
gi|15793000|ref|NP_282823.1| 50S ribosomal protein L14 [Campylob... 72 2e-12
gi|7524689|ref|NP_042443.1| ribosomal protein L14 [Pinus thunber... 72 2e-12
gi|23024317|ref|ZP_00063533.1| COG0093: Ribosomal protein L14 [L... 72 2e-12
gi|17148896|gb|AAL35833.1| RBL1 [Cucumis sativus] 72 2e-12
gi|42524365|ref|NP_969745.1| 50S ribosomal protein L14 [Bdellovi... 72 2e-12
gi|16077194|ref|NP_388007.1| ribosomal protein L14 [Bacillus sub... 72 2e-12
gi|50556262|ref|XP_505539.1| hypothetical protein [Yarrowia lipo... 72 2e-12
gi|50878303|gb|AAT85078.1| putative 50S ribosomal protein L14 [O... 72 2e-12
gi|15612294|ref|NP_223947.1| 50S RIBOSOMAL PROTEIN L14 [Helicoba... 72 2e-12
gi|11467336|ref|NP_043193.1| ribosomal protein L14 [Cyanophora p... 72 2e-12
gi|15836169|ref|NP_300693.1| L14 ribosomal protein [Chlamydophil... 72 2e-12
gi|39936303|ref|NP_948579.1| 50S ribosomal protein L14 [Rhodopse... 72 3e-12
gi|46311176|ref|ZP_00211786.1| COG0093: Ribosomal protein L14 [B... 72 3e-12
gi|48849962|ref|ZP_00304205.1| COG0093: Ribosomal protein L14 [N... 72 3e-12
gi|27468732|ref|NP_765369.1| 50S ribosomal protein L14 [Staphylo... 72 3e-12
gi|45917161|ref|ZP_00196307.2| COG0093: Ribosomal protein L14 [M... 72 3e-12
gi|27380501|ref|NP_772030.1| 50S ribosomal protein L14 [Bradyrhi... 72 3e-12
gi|16329931|ref|NP_440659.1| 50S ribosomal protein L14 [Synechoc... 72 3e-12
gi|49235635|ref|ZP_00329702.1| COG0093: Ribosomal protein L14 [M... 72 3e-12
gi|17987050|ref|NP_539684.1| LSU ribosomal protein L14P [Brucell... 72 3e-12
gi|15889233|ref|NP_354914.1| AGR_C_3539p [Agrobacterium tumefaci... 71 4e-12
gi|11467727|ref|NP_050779.1| ribosomal protein L14 [Guillardia t... 71 4e-12
gi|33862104|ref|NP_893665.1| 50S Ribosomal protein L14 [Prochlor... 71 4e-12
gi|11497563|ref|NP_054971.1| ribosomal protein L14 [Spinacia ole... 71 4e-12
gi|3914694|sp|O52342|RL14_MYCGA 50S ribosomal protein L14 >gnl|B... 71 5e-12
gi|48765734|ref|ZP_00270284.1| COG0093: Ribosomal protein L14 [R... 71 5e-12
gi|32266887|ref|NP_860919.1| ribosomal protein L14 [Helicobacter... 71 5e-12
gi|30018390|ref|NP_830021.1| LSU ribosomal protein L14P [Bacillu... 71 5e-12
gi|13470561|ref|NP_102130.1| 50S ribosomal protein L14 [Mesorhiz... 71 5e-12
gi|49474394|ref|YP_032436.1| 50s ribosomal protein l14 [Bartonel... 71 5e-12
gi|15925230|ref|NP_372764.1| 50S ribosomal protein L14 [Staphylo... 71 5e-12
gi|13507914|ref|NP_109863.1| ribosomal protein L14 [Mycoplasma p... 71 5e-12
gi|28261753|ref|NP_783267.1| ribosomal protein L14 [Atropa bella... 71 5e-12
gi|31544265|ref|NP_852843.1| RplN [Mycoplasma gallisepticum R] >... 71 5e-12
gi|15674297|ref|NP_268470.1| 50S ribosomal protein L14 [Streptoc... 70 7e-12
gi|132660|sp|P04450|RL14_BACST 50S ribosomal protein L14 >gnl|BL... 70 7e-12
gi|41723118|ref|ZP_00150061.1| COG0093: Ribosomal protein L14 [D... 70 7e-12
gi|49475784|ref|YP_033825.1| 50S ribosomal protein l14 [Bartonel... 70 7e-12
gi|46319573|ref|ZP_00219976.1| COG0093: Ribosomal protein L14 [B... 70 7e-12
gi|30248428|ref|NP_840498.1| Ribosomal protein L14b/L23e family ... 70 7e-12
gi|11467460|ref|NP_043606.1| ribosomal protein L14 [Odontella si... 70 7e-12
gi|37523486|ref|NP_926863.1| 50S ribosomal protein L14 [Gloeobac... 70 7e-12
gi|23124118|ref|ZP_00106129.1| COG0093: Ribosomal protein L14 [N... 70 9e-12
gi|29374861|ref|NP_814014.1| ribosomal protein L14 [Enterococcus... 70 9e-12
gi|15965119|ref|NP_385472.1| PROBABLE 50S RIBOSOMAL PROTEIN L14 ... 70 9e-12
gi|32480879|ref|NP_862790.1| ribosomal protein L14 [Calycanthus ... 70 9e-12
gi|13357801|ref|NP_078075.1| ribosomal protein L14 [Ureaplasma p... 70 9e-12
gi|47459080|ref|YP_015942.1| 50S ribosomal protein l14 [Mycoplas... 70 9e-12
gi|48857570|ref|ZP_00311564.1| COG0093: Ribosomal protein L14 [C... 70 9e-12
gi|22711950|ref|NP_683838.1| ribosomal protein L14 [Chaetosphaer... 70 9e-12
gi|15805350|ref|NP_294044.1| ribosomal protein L14 [Deinococcus ... 70 1e-11
gi|15607854|ref|NP_215228.1| rplN [Mycobacterium tuberculosis H3... 70 1e-11
gi|7525069|ref|NP_051094.1| ribosomal protein L14 [Arabidopsis t... 70 1e-11
gi|17231697|ref|NP_488245.1| 50S ribosomal protein L14 [Nostoc s... 70 1e-11
gi|34811562|pdb|1PNU|I Chain I, Crystal Structure Of A Streptomy... 70 1e-11
gi|48824732|ref|ZP_00286071.1| COG0093: Ribosomal protein L14 [E... 69 2e-11
gi|50346820|ref|YP_053191.1| ribosomal protein L14 [Nymphaea alb... 69 2e-11
gi|24380359|ref|NP_722314.1| 50S ribosomal protein L14 [Streptoc... 69 2e-11
gi|15606756|ref|NP_214136.1| ribosomal protein L14 [Aquifex aeol... 69 2e-11
gi|23104449|ref|ZP_00090913.1| COG0093: Ribosomal protein L14 [A... 69 2e-11
gi|15896373|ref|NP_349722.1| Ribosomal protein L14 [Clostridium ... 69 2e-11
gi|23470615|ref|ZP_00125947.1| COG0093: Ribosomal protein L14 [P... 69 2e-11
gi|29653600|ref|NP_819292.1| ribosomal protein L14 [Coxiella bur... 69 2e-11
gi|15900155|ref|NP_344759.1| ribosomal protein L14 [Streptococcu... 69 2e-11
gi|33866609|ref|NP_898168.1| 50S ribosomal protein L14 [Synechoc... 69 2e-11
gi|11466514|ref|NP_044763.1| ribosomal protein L14 [Reclinomonas... 69 3e-11
gi|50364948|ref|YP_053373.1| 50S ribosomal protein L14 [Mesoplas... 69 3e-11
gi|32475068|ref|NP_868062.1| 50S ribosomal protein L14 [Pirellul... 69 3e-11
gi|42561260|ref|NP_975711.1| 50S RIBOSOMAL PROTEIN L14 [Mycoplas... 69 3e-11
gi|48728501|ref|ZP_00262259.1| COG0093: Ribosomal protein L14 [P... 69 3e-11
gi|39938696|ref|NP_950462.1| ribosomal protein L14 [Onion yellow... 68 3e-11
gi|34499631|ref|NP_903846.1| 50S ribosomal protein L14 [Chromoba... 68 3e-11
gi|21672760|ref|NP_660827.1| 50S ribosomal protein L14 [Buchnera... 68 3e-11
gi|15676079|ref|NP_273210.1| 50S ribosomal protein L14 [Neisseri... 68 3e-11
gi|18311377|ref|NP_563311.1| 50S ribosomal protein L14 [Clostrid... 68 3e-11
gi|28377842|ref|NP_784734.1| ribosomal protein L14 [Lactobacillu... 68 3e-11
gi|16762853|ref|NP_458470.1| 50S ribosomal subunit protein L14 [... 68 3e-11
gi|18140856|gb|AAL60450.1| HUELLENLOS-like protein [Oryza sativa] 68 3e-11
gi|1172956|sp|P46176|RL14_BUCAK 50S RIBOSOMAL PROTEIN L14 >gnl|B... 68 3e-11
gi|48860651|ref|ZP_00314562.1| COG0093: Ribosomal protein L14 [M... 68 5e-11
gi|27904932|ref|NP_778058.1| 50S ribosomal protein L14 [Buchnera... 68 5e-11
gi|15599449|ref|NP_252943.1| 50S ribosomal protein L14 [Pseudomo... 68 5e-11
gi|23003715|ref|ZP_00047367.1| COG0093: Ribosomal protein L14 [L... 68 5e-11
gi|22725683|gb|AAN04890.1| ribosomal protein L14 [Vigna angularis] 68 5e-11
gi|46431726|gb|EAK91258.1| hypothetical protein CaO19.5684 [Cand... 68 5e-11
gi|16120557|ref|NP_403870.1| 50S ribosomal protein L14 [Yersinia... 68 5e-11
gi|13518370|ref|NP_084729.1| ribosomal protein L14 [Oenothera el... 67 6e-11
gi|3122677|sp|O32993|RL14_MYCLE 50S ribosomal protein L14 >gnl|B... 67 6e-11
gi|21230374|ref|NP_636291.1| 50S ribosomal protein L14 [Xanthomo... 67 6e-11
gi|33594491|ref|NP_882135.1| 50S ribosomal protein L14 [Bordetel... 67 6e-11
gi|15674071|ref|NP_268246.1| 50S ribosomal protein L14 [Lactococ... 67 6e-11
gi|48831556|ref|ZP_00288616.1| COG0093: Ribosomal protein L14 [M... 67 6e-11
gi|46164750|ref|ZP_00137740.2| COG0093: Ribosomal protein L14 [P... 67 6e-11
gi|11465993|ref|NP_054535.1| ribosomal protein L14 [Nicotiana ta... 67 6e-11
gi|15803837|ref|NP_289871.1| 50S ribosomal subunit protein L14 [... 67 6e-11
gi|33241151|ref|NP_876093.1| Ribosomal protein L14 [Prochlorococ... 67 6e-11
gi|46308729|ref|ZP_00210921.1| COG0093: Ribosomal protein L14 [E... 67 8e-11
gi|28202209|ref|NP_777450.1| ribosomal protein L14 [Anthoceros f... 67 8e-11
gi|12045014|ref|NP_072824.1| ribosomal protein L14 (rpL14) [Myco... 67 8e-11
gi|15827992|ref|NP_302255.1| 50S ribosomal protein L14 [Mycobact... 67 8e-11
gi|33864009|ref|NP_895569.1| 50S Ribosomal protein L14 [Prochlor... 67 8e-11
gi|48767838|ref|ZP_00272191.1| COG0093: Ribosomal protein L14 [R... 67 1e-10
gi|71223|pir||R5SP14 ribosomal protein L14, chloroplast - spinac... 67 1e-10
gi|15837764|ref|NP_298452.1| 50S ribosomal protein L14 [Xylella ... 66 1e-10
gi|22995984|ref|ZP_00040261.1| COG0093: Ribosomal protein L14 [X... 66 1e-10
gi|46446056|ref|YP_007421.1| probable 50S ribosomal protein L14 ... 66 1e-10
gi|32423683|gb|AAP81226.1| ribosomal protein L14 [Candidatus Por... 66 1e-10
gi|7674189|sp|Q9ZI42|RL14_AQUPY 50S ribosomal protein L14 >gnl|B... 66 1e-10
gi|48871246|ref|ZP_00323962.1| COG0093: Ribosomal protein L14 [P... 66 2e-10
gi|17547728|ref|NP_521130.1| PROBABLE 50S RIBOSOMAL SUBUNIT PROT... 66 2e-10
gi|11467012|ref|NP_041919.1| ribosomal protein L14 [Euglena grac... 66 2e-10
gi|3122676|sp|O31165|RL14_SPICI 50S ribosomal protein L14 >gnl|B... 65 2e-10
gi|48864645|ref|ZP_00318531.1| COG0093: Ribosomal protein L14 [O... 65 2e-10
gi|34500950|ref|NP_904135.1| ribosomal protein L14 [Amborella tr... 65 2e-10
gi|15617108|ref|NP_240321.1| 50S ribosomal protein L14 [Buchnera... 65 2e-10
gi|13518474|ref|NP_084833.1| ribosomal protein L14 [Lotus cornic... 65 2e-10
gi|15829048|ref|NP_326408.1| 50S RIBOSOMAL PROTEIN L14 [Mycoplas... 65 2e-10
gi|23014078|ref|ZP_00053915.1| COG0093: Ribosomal protein L14 [M... 65 3e-10
gi|48781558|ref|ZP_00278149.1| COG0093: Ribosomal protein L14 [B... 65 3e-10
gi|37528533|ref|NP_931878.1| 50S ribosomal protein L14 [Photorha... 65 4e-10
gi|45525168|ref|ZP_00176414.1| COG0093: Ribosomal protein L14 [C... 64 5e-10
gi|15642581|ref|NP_232214.1| ribosomal protein L14 [Vibrio chole... 64 5e-10
gi|23482150|gb|EAA18215.1| LSU ribosomal protein L14P [Plasmodiu... 64 7e-10
gi|34849402|gb|AAP58901.1| ribosomal protein L14 [Spiroplasma ku... 64 7e-10
gi|42520520|ref|NP_966435.1| ribosomal protein L14 [Wolbachia en... 64 9e-10
gi|45658693|ref|YP_002779.1| 50S ribosomal protein L14 [Leptospi... 64 9e-10
gi|32035723|ref|ZP_00135604.1| COG0093: Ribosomal protein L14 [A... 64 9e-10
gi|27364205|ref|NP_759733.1| Ribosomal protein L14 [Vibrio vulni... 64 9e-10
gi|15603270|ref|NP_246344.1| RpL14 [Pasteurella multocida Pm70] ... 64 9e-10
gi|33519668|ref|NP_878500.1| 50S ribosomal subunit protein L14 [... 63 1e-09
gi|23467450|ref|ZP_00123031.1| COG0093: Ribosomal protein L14 [H... 63 1e-09
gi|15594833|ref|NP_212622.1| ribosomal protein L14 (rplN) [Borre... 63 1e-09
gi|6015769|emb|CAB57596.1| hypothetical protein [Sulfolobus solf... 63 1e-09
gi|30468192|ref|NP_849079.1| ribosomal protein L14 [Cyanidioschy... 62 2e-09
gi|24371839|ref|NP_715881.1| ribosomal protein L14 [Shewanella o... 62 2e-09
gi|28897041|ref|NP_796646.1| ribosomal protein L14 [Vibrio parah... 62 2e-09
gi|11465432|ref|NP_045177.1| ribosomal protein L14 [Cyanidium ca... 62 2e-09
gi|46141796|ref|ZP_00147203.2| COG0093: Ribosomal protein L14 [P... 62 3e-09
gi|50086205|ref|YP_047715.1| 50S ribosomal protein L14 [Acinetob... 62 3e-09
gi|46911971|emb|CAG18769.1| putative ribosomal protein L14 [Phot... 61 4e-09
gi|12545440|ref|NP_074990.1| ribosomal protein L14 [Euglena long... 61 6e-09
gi|23613214|ref|NP_703536.1| 50S ribosomal subunit protein L14, ... 60 7e-09
gi|15604495|ref|NP_221013.1| 50S RIBOSOMAL PROTEIN L14 (rplN) [R... 60 1e-08
gi|15892919|ref|NP_360633.1| 50S ribosomal protein L14 [Ricketts... 59 2e-08
gi|11466628|ref|NP_066311.1| ribosomal protein L14 [Malawimonas ... 59 3e-08
gi|42454068|ref|ZP_00153975.1| hypothetical protein Rick095001 [... 58 4e-08
gi|50590427|ref|ZP_00331810.1| COG0093: Ribosomal protein L14 [S... 58 4e-08
gi|32491302|ref|NP_871556.1| rplN [Wigglesworthia glossinidia en... 58 4e-08
gi|47574129|ref|ZP_00244165.1| COG0093: Ribosomal protein L14 [R... 57 6e-08
gi|17222553|gb|AAL36726.1| ribosomal protein L14 [Mesostigma vir... 57 8e-08
gi|30694896|ref|NP_851140.1| ribosomal protein L14 family protei... 57 8e-08
gi|20260394|gb|AAM13095.1| unknown protein [Arabidopsis thaliana... 57 8e-08
gi|30694900|ref|NP_199428.3| ribosomal protein L14 family protei... 57 8e-08
gi|9757736|dbj|BAB08261.1| 50S ribosomal protein L14 [Arabidopsi... 57 1e-07
gi|45547041|ref|ZP_00187102.1| COG0093: Ribosomal protein L14 [R... 56 2e-07
gi|49097646|ref|XP_410283.1| hypothetical protein AN6146.2 [Aspe... 54 7e-07
gi|49068904|ref|XP_398741.1| hypothetical protein UM01126.1 [Ust... 53 1e-06
gi|11466201|ref|NP_066524.1| ribosomal protein L14 [Naegleria gr... 53 2e-06
gi|8778471|gb|AAF79479.1| F1L3.27 [Arabidopsis thaliana] 52 3e-06
gi|21555596|gb|AAM63894.1| ribosomal protein, putative [Arabidop... 52 3e-06
gi|15220161|ref|NP_173200.1| ribosomal protein L14 family protei... 52 3e-06
gi|18140858|gb|AAL60451.1| HUELLENLOS [Arabidopsis thaliana] 52 3e-06
gi|45507558|ref|ZP_00159901.1| COG0093: Ribosomal protein L14 [A... 51 4e-06
gi|38106861|gb|EAA53115.1| hypothetical protein MG07392.4 [Magna... 51 4e-06
gi|32418238|ref|XP_329597.1| hypothetical protein [Neurospora cr... 51 6e-06
gi|50261285|ref|YP_052893.1| ribosomal protein L14 [Saprolegnia ... 50 1e-05
gi|22995898|ref|ZP_00040186.1| COG0093: Ribosomal protein L14 [X... 50 1e-05
gi|50414368|ref|XP_457400.1| unnamed protein product [Debaryomyc... 50 1e-05
gi|46124305|ref|XP_386706.1| hypothetical protein FG06530.1 [Gib... 50 1e-05
gi|6066167|gb|AAF03185.1| ribosomal protein L14 [Nephroselmis ol... 47 6e-05
gi|21398078|ref|NP_654063.1| Ribosomal_L14, Ribosomal protein L1... 47 6e-05
gi|11465894|ref|NP_066443.1| ribosomal protein L14 [Ochromonas d... 47 8e-05
gi|13272307|gb|AAK17090.1| ribosomal protein L14 [Candidatus Car... 47 1e-04
gi|38638305|ref|NP_943672.1| ribosomal protein L14 [Chara vulgar... 46 1e-04
gi|50302733|ref|XP_451303.1| unnamed protein product [Kluyveromy... 45 2e-04
gi|19113273|ref|NP_596481.1| putative 50s ribosomal protein l14 ... 45 4e-04
gi|11466306|ref|NP_051134.1| ribosomal protein L14 [Cafeteria ro... 44 7e-04
gi|6322678|ref|NP_012751.1| Mitochondrial ribosomal protein of t... 41 0.005
gi|45190488|ref|NP_984742.1| AEL119Wp [Eremothecium gossypii] >g... 40 0.008
gi|50294594|ref|XP_449708.1| unnamed protein product [Candida gl... 40 0.008
gi|31442371|ref|NP_852628.1| ribosomal protein L14 [Eimeria tene... 40 0.010
gi|11466570|ref|NP_066460.1| ribosomal protein L14 [Rhodomonas s... 40 0.010
gi|8954384|ref|NP_059373.1| ribosomal protein L14 [Cyanidioschyz... 40 0.013
gi|7524998|ref|NP_050096.1| ribosomal protein L14 [Dictyostelium... 40 0.013
gi|8928583|ref|NP_059388.1| ribosomal protein L14 [Paramecium au... 39 0.017
gi|9695373|ref|NP_037595.1| ribosomal protein L14 [Phytophthora ... 38 0.039
gi|11466293|ref|NP_049608.1| ribosomal protein L14 [Tetrahymena ... 36 0.19
gi|47225094|emb|CAF98721.1| unnamed protein product [Tetraodon n... 35 0.25
gi|15027671|ref|NP_149405.1| ribosomal protein L14 [Tetrahymena ... 34 0.56
gi|49147208|ref|YP_025801.1| ribosomal protein L14 [Pseudendoclo... 34 0.73
gi|20373167|ref|NP_619621.1| LUC7-like 2; CGI-74-like SR-rich; C... 33 0.95
gi|49071560|ref|XP_400069.1| hypothetical protein UM02454.1 [Ust... 33 1.2
gi|19921544|ref|NP_609981.1| CG10137-PA [Drosophila melanogaster... 33 1.6
gi|20090839|ref|NP_616914.1| sensory transduction histidine kina... 32 2.1
gi|41055419|ref|NP_957478.1| similar to proteasome (prosome, mac... 32 2.1
gi|20092160|ref|NP_618235.1| sensory transduction histidine kina... 32 2.8
gi|47222707|emb|CAG00141.1| unnamed protein product [Tetraodon n... 32 2.8
gi|2246475|gb|AAB62600.1| ORF 64, large tegument protein homolog... 32 2.8
gi|18846034|ref|NP_572120.1| ORF 64; tegument protein homolog; E... 32 2.8
gi|47216197|emb|CAG01231.1| unnamed protein product [Tetraodon n... 32 2.8
gi|21228817|ref|NP_634739.1| hypothetical protein MM2715 [Methan... 32 3.6
gi|27382055|ref|NP_773584.1| HupU protein [Bradyrhizobium japoni... 32 3.6
gi|34498770|ref|NP_902985.1| conserved hypothetical protein [Chr... 32 3.6
gi|7440847|pir||S72294 ribosomal protein L14 - Plasmodium falcip... 31 4.7
gi|48838961|ref|ZP_00295897.1| COG2202: FOG: PAS/PAC domain [Met... 31 4.7
gi|47116960|sp|Q9Y383|L7L2_HUMAN Putative RNA-binding protein Lu... 31 6.2
gi|23466045|ref|NP_696648.1| hypothetical protein BL1488 [Bifido... 31 6.2
gi|47115719|sp|Q7TNC4|L7L2_MOUSE Putative RNA-binding protein Lu... 31 6.2
gi|7022826|dbj|BAA91737.1| unnamed protein product [Homo sapiens] 31 6.2
gi|34855164|ref|XP_231620.2| similar to CGI-74-like SR-rich prot... 31 6.2
gi|7959052|dbj|BAA95933.1| Orf1 [Clostridium perfringens] 31 6.2
gi|4929587|gb|AAD34054.1| CGI-59 protein [Homo sapiens] 31 6.2
gi|7706310|ref|NP_057103.1| LUC7-like 2; CGI-74 protein; CGI-59 ... 31 6.2
gi|17558882|ref|NP_506598.1| putative cytoplasmic protein (16.5 ... 31 6.2
gi|12805661|gb|AAH02314.1| Luc7l2 protein [Mus musculus] 31 6.2
gi|39589879|emb|CAE60877.1| Hypothetical protein CBG04589 [Caeno... 31 6.2
gi|27503744|gb|AAH42625.1| LUC7L2 protein [Homo sapiens] 31 6.2
gi|21228379|ref|NP_634301.1| hypothetical sensory transduction h... 31 6.2
gi|34532335|dbj|BAC86391.1| unnamed protein product [Homo sapiens] 30 8.1
gi|7512678|pir||T17269 hypothetical protein DKFZp434N231.1 - hum... 30 8.1
gi|50744602|ref|XP_419795.1| PREDICTED: similar to hypothetical ... 30 8.1
gi|47218803|emb|CAG02788.1| unnamed protein product [Tetraodon n... 30 8.1
gi|18311331|ref|NP_563265.1| conserved hypothetical protein [Clo... 30 8.1
gi|38348420|ref|NP_940975.1| GAAI470 [Homo sapiens] >gnl|BL_ORD_... 30 8.1
gi|3413850|dbj|BAA32289.1| KIAA0444 protein [Homo sapiens] 30 8.1
gi|24308089|ref|NP_056372.1| chromodomain helicase DNA binding p... 30 8.1
gi|50728628|ref|XP_416210.1| PREDICTED: similar to LUC7L2 protei... 30 8.1
gi|39589232|emb|CAE57965.1| Hypothetical protein CBG01026 [Caeno... 30 8.1
gi|49127354|ref|XP_412782.1| hypothetical protein AN8645.2 [Aspe... 30 8.1
gi|20090694|ref|NP_616769.1| sensory transduction histidine kina... 30 8.1
gi|30268589|dbj|BAC76023.1| opsin [Branchiostoma belcheri] 30 8.1
>gi|17554750|ref|NP_498231.1| ribosomal Protein, Large subunit (15.0
kD) (rpl-23) [Caenorhabditis elegans]
gi|1350671|sp|P48158|RL23_CAEEL 60S ribosomal protein L23
gi|7440841|pir||T15337 hypothetical protein B0336.10 -
Caenorhabditis elegans
gi|13324872|gb|AAK18857.1| Ribosomal protein, large subunit protein
23 [Caenorhabditis elegans]
gi|39584899|emb|CAE64323.1| Hypothetical protein CBG09001
[Caenorhabditis briggsae]
Length = 140
Score = 281 bits (718), Expect = 3e-75
Identities = 140/140 (100%), Positives = 140/140 (100%)
Frame = -1
Query: 423 MSKRGRGGASGAKFRISLGLPVGAVMNCADNTGAKNLFVISVYGIRGRLNRLPSAGVGDM 244
MSKRGRGGASGAKFRISLGLPVGAVMNCADNTGAKNLFVISVYGIRGRLNRLPSAGVGDM
Sbjct: 1 MSKRGRGGASGAKFRISLGLPVGAVMNCADNTGAKNLFVISVYGIRGRLNRLPSAGVGDM 60
Query: 243 FVCSVKKGKPELRKKVLQGVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP 64
FVCSVKKGKPELRKKVLQGVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP
Sbjct: 61 FVCSVKKGKPELRKKVLQGVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP 120
Query: 63 VAKECADLWPRIAANAGSIA 4
VAKECADLWPRIAANAGSIA
Sbjct: 121 VAKECADLWPRIAANAGSIA 140