Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= B0393_2
(831 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17554768|ref|NP_497978.1| ribosomal Protein, Small subunit (3... 508 e-143
gi|39591563|emb|CAE71139.1| Hypothetical protein CBG17994 [Caeno... 483 e-135
gi|730683|sp|P38981|RSP4_URECA 40S RIBOSOMAL PROTEIN SA (P40) (3... 303 3e-81
gi|50732898|ref|XP_418817.1| PREDICTED: similar to 37kD Laminin ... 298 7e-80
gi|45360789|ref|NP_989068.1| hypothetical protein MGC75768 [Xeno... 298 1e-79
gi|8393693|ref|NP_058834.1| laminin receptor 1 [Rattus norvegicu... 298 1e-79
gi|30047125|gb|AAH50688.1| Laminin receptor 1 [Homo sapiens] 297 2e-79
gi|41054972|ref|NP_957346.1| laminin receptor 1 (ribosomal prote... 296 3e-79
gi|15294011|gb|AAK95182.1| 40S ribosomal protein Sa [Ictalurus p... 296 3e-79
gi|28277316|gb|AAH46271.1| Lamr1-prov protein [Xenopus laevis] 296 4e-79
gi|125970|sp|P14206|RSP4_MOUSE 40S ribosomal protein SA (P40) (3... 296 5e-79
gi|226005|prf||1405340A protein 40kD 295 6e-79
gi|31560560|ref|NP_035159.2| laminin receptor 1 (ribosomal prote... 295 6e-79
gi|91035|pir||A29395 ribosomal protein RS.40K - mouse >gnl|BL_OR... 295 6e-79
gi|9845502|ref|NP_002286.2| laminin receptor 1; 67kD, ribosomal ... 295 6e-79
gi|30585305|gb|AAP36925.1| Homo sapiens laminin receptor 1 (ribo... 295 6e-79
gi|27805981|ref|NP_776804.1| laminin receptor 1 (ribosomal prote... 295 1e-78
gi|38074597|ref|XP_193262.3| similar to protein 40kD [Mus musculus] 294 1e-78
gi|47125390|gb|AAH70263.1| Laminin receptor 1 [Homo sapiens] 294 2e-78
gi|47940629|gb|AAH71971.1| Laminin receptor 1 [Homo sapiens] 293 2e-78
gi|12846904|dbj|BAB27355.1| unnamed protein product [Mus musculus] 293 2e-78
gi|730679|sp|P38982|RSP4_CRIGR 40S RIBOSOMAL PROTEIN SA (P40) (3... 293 3e-78
gi|44890755|gb|AAH66941.1| Laminin receptor 1 [Homo sapiens] 293 4e-78
gi|730682|sp|P38980|RSP4_TRIGR 40S RIBOSOMAL PROTEIN SA (P40) (3... 293 4e-78
gi|14583014|gb|AAK69721.1| laminin receptor-like protein LAMRL5 ... 292 7e-78
gi|41151149|ref|XP_371155.1| similar to 40S ribosomal protein SA... 291 9e-78
gi|34234|emb|CAA43469.1| laminin-binding protein [Homo sapiens] 291 9e-78
gi|250127|gb|AAB22299.1| 67 kda laminin receptor [Homo sapiens] 291 2e-77
gi|34272|emb|CAA33112.1| unnamed protein product [Homo sapiens] 289 5e-77
gi|631907|pir||S42405 ribosomal protein RS.40K, cytosolic [valid... 287 2e-76
gi|41190435|ref|XP_371495.1| similar to 40S ribosomal protein SA... 286 5e-76
gi|17298117|dbj|BAB78527.1| ribosome-associated protein P40 [Bom... 285 8e-76
gi|41201737|ref|XP_370697.1| similar to 40S ribosomal protein SA... 284 2e-75
gi|34881845|ref|XP_212894.2| similar to 40S RIBOSOMAL PROTEIN SA... 283 4e-75
gi|12249039|dbj|BAB20389.1| stubarista [Drosophila orena] 282 7e-75
gi|12249037|dbj|BAB20388.1| stubarista [Drosophila erecta] 282 7e-75
gi|12249035|dbj|BAB20387.1| stubarista [Drosophila yakuba] 282 7e-75
gi|17136518|ref|NP_476750.1| CG14792-PA [Drosophila melanogaster... 282 7e-75
gi|45551198|ref|NP_726745.2| CG14792-PD [Drosophila melanogaster... 282 7e-75
gi|41148736|ref|XP_372048.1| similar to 40S ribosomal protein SA... 280 2e-74
gi|37778974|gb|AAP20147.1| 40S ribosomal protein Sa [Pagrus major] 280 4e-74
gi|41103633|ref|XP_371273.1| similar to 40S ribosomal protein SA... 279 6e-74
gi|31240645|ref|XP_320736.1| ENSANGP00000020171 [Anopheles gambi... 278 8e-74
gi|41117179|ref|XP_371316.1| similar to 40S ribosomal protein SA... 278 1e-73
gi|730678|sp|P38984|RSP4_CHLVR 40S RIBOSOMAL PROTEIN SA (P40) (3... 277 2e-73
gi|38073579|ref|XP_123556.2| similar to 40S RIBOSOMAL PROTEIN SA... 273 3e-72
gi|38078430|ref|XP_124269.2| similar to 67 kda laminin receptor ... 272 6e-72
gi|48098058|ref|XP_393965.1| similar to ribosome-associated prot... 271 1e-71
gi|19115325|ref|NP_594413.1| 40s ribosomal protein s0B [Schizosa... 268 8e-71
gi|157810|gb|AAA28667.1| laminin receptor 268 1e-70
gi|38049446|ref|XP_126851.2| similar to 40S RIBOSOMAL PROTEIN SA... 266 3e-70
gi|42659034|ref|XP_376888.1| similar to Laminin receptor 1 [Homo... 266 4e-70
gi|19112932|ref|NP_596140.1| 40s ribosomal protein s0 [Schizosac... 264 2e-69
gi|38048381|gb|AAR10093.1| similar to Drosophila melanogaster st... 260 2e-68
gi|46138781|ref|XP_391081.1| conserved hypothetical protein [Gib... 259 5e-68
gi|38047861|gb|AAR09833.1| similar to Drosophila melanogaster st... 258 1e-67
gi|49091696|ref|XP_407309.1| hypothetical protein AN3172.2 [Aspe... 256 4e-67
gi|49077884|ref|XP_402752.1| hypothetical protein UM05137.1 [Ust... 256 6e-67
gi|41204911|ref|XP_370865.1| similar to Laminin receptor 1 [Homo... 255 9e-67
gi|32404076|ref|XP_322651.1| hypothetical protein [Neurospora cr... 254 2e-66
gi|50256590|gb|EAL19315.1| hypothetical protein CNBH4140 [Crypto... 253 5e-66
gi|7270973|emb|CAB77627.1| YST1 protein [Candida albicans] 251 1e-65
gi|34305123|gb|AAQ63482.1| laminin-binding protein [Acanthamoeba... 250 2e-65
gi|50309339|ref|XP_454677.1| unnamed protein product [Kluyveromy... 250 3e-65
gi|45185548|ref|NP_983264.1| ACL140Cp [Eremothecium gossypii] >g... 249 4e-65
gi|6323077|ref|NP_013149.1| Protein component of the small (40S)... 249 7e-65
gi|11276889|pir||T47199 probable ribosome-associated protein [im... 248 9e-65
gi|6094143|sp|O42817|RS0_CANAL 40S RIBOSOMAL PROTEIN S0 >gnl|BL_... 248 9e-65
gi|15217294|gb|AAK92638.1| Putative 40S Ribosomal protein [Oryza... 248 1e-64
gi|15020801|emb|CAC44623.1| ribosomal protein [Candida tropicalis] 248 2e-64
gi|50294117|ref|XP_449470.1| unnamed protein product [Candida gl... 248 2e-64
gi|50416787|ref|XP_457580.1| unnamed protein product [Debaryomyc... 247 2e-64
gi|33146943|dbj|BAC79991.1| putative 40S ribosomal protein [Oryz... 246 3e-64
gi|6321653|ref|NP_011730.1| Protein component of the small (40S)... 246 4e-64
gi|34935435|ref|XP_234486.2| similar to 40S RIBOSOMAL PROTEIN SA... 246 4e-64
gi|8928330|sp|O80377|RSP4_DAUCA 40S ribosomal protein SA (p40) >... 245 1e-63
gi|50545309|ref|XP_500192.1| hypothetical protein [Yarrowia lipo... 244 2e-63
gi|15214300|sp|Q9ZSR8|RSP4_BRANA 40S ribosomal protein SA (p40) ... 240 3e-62
gi|34906686|ref|NP_914690.1| putative 40S ribosomal protein [Ory... 239 4e-62
gi|11467967|sp|Q08682|RSP4_ARATH 40S ribosomal protein SA (p40) ... 239 5e-62
gi|15218458|ref|NP_177381.1| 40S ribosomal protein SA (RPSaA) [A... 239 7e-62
gi|16380|emb|CAA48794.1| laminin receptor homologue [Arabidopsis... 238 1e-61
gi|3334320|sp|O22518|RSP4_SOYBN 40S RIBOSOMAL PROTEIN SA (P40) >... 236 5e-61
gi|34500109|gb|AAQ73638.1| ribosome-associated protein RAP1-like... 235 1e-60
gi|2500393|sp|Q01661|RS0_PNECA 40S RIBOSOMAL PROTEIN S0 (EXTRACE... 234 2e-60
gi|22035888|emb|CAD43146.1| putative ribosomal protein S2 [Toxop... 234 2e-60
gi|3914935|sp|O65751|RSP4_CICAR 40S RIBOSOMAL PROTEIN SA (P40) >... 231 1e-59
gi|15229347|ref|NP_187128.1| 40S ribosomal protein SA (RPSaB) [A... 231 2e-59
gi|34859417|ref|XP_230714.2| similar to laminin receptor-like pr... 229 7e-59
gi|21593022|gb|AAM64971.1| putative 40S ribosomal protein [Arabi... 229 7e-59
gi|46228372|gb|EAK89271.1| 40S ribosomal protein SAe [Cryptospor... 228 2e-58
gi|1173296|sp|P46770|RSP4_ECHGR 40S RIBOSOMAL PROTEIN SA (P40) (... 227 3e-58
gi|23482139|gb|EAA18207.1| ribosomal protein S2, putative [Plasm... 226 6e-58
gi|23508067|ref|NP_700737.1| 40S ribosomal protein, putative [P... 224 1e-57
gi|46436269|gb|EAK95634.1| hypothetical protein CaO19.6975 [Cand... 219 4e-56
gi|49258822|pdb|1S1H|B Chain B, Structure Of The Ribosomal 80s-E... 216 6e-55
gi|30679260|ref|NP_850515.1| 40S ribosomal protein SA (RPSaB) [A... 216 6e-55
gi|18700176|gb|AAL77699.1| AT3g04770/F7O18_26 [Arabidopsis thali... 215 1e-54
gi|23308301|gb|AAN18120.1| At3g04770/F7O18_26 [Arabidopsis thali... 215 1e-54
gi|4809047|gb|AAD30064.1| laminin receptor precursor-like protei... 214 1e-54
gi|38079048|ref|XP_355538.1| similar to protein 40kD [Mus musculus] 204 2e-51
gi|41148772|ref|XP_041020.3| similar to protein 40kD [Homo sapiens] 200 4e-50
gi|28189773|dbj|BAC56501.1| similar to 40S ribosomal protein SA ... 199 6e-50
gi|29247816|gb|EAA39367.1| GLP_336_16528_17265 [Giardia lamblia ... 199 8e-50
gi|38078083|ref|XP_355473.1| similar to 40S RIBOSOMAL PROTEIN SA... 197 2e-49
gi|1173297|sp|P46771|RSP4_STRPU 40S RIBOSOMAL PROTEIN SA (P40) (... 194 2e-48
gi|38091008|ref|XP_354595.1| similar to protein 40kD [Mus musculus] 186 4e-46
gi|38091324|ref|XP_354604.1| similar to protein 40kD [Mus musculus] 186 4e-46
gi|38082910|ref|XP_355032.1| similar to protein 40kD [Mus musculus] 186 5e-46
gi|2350932|dbj|BAA21994.1| ribosomal protein SA (P40) / laminin ... 181 1e-44
gi|1125065|gb|AAC50313.1| laminin-binding protein 181 2e-44
gi|2350896|dbj|BAA21980.1| ribosomal protein SA (P40) / laminin ... 169 9e-41
gi|13812312|ref|NP_113430.1| 40S ribosomal protein SSA [Guillard... 162 8e-39
gi|42659568|ref|XP_377109.1| similar to 40S ribosomal protein SA... 158 2e-37
gi|14591402|ref|NP_143481.1| 30S ribosomal protein S2 [Pyrococcu... 158 2e-37
gi|12231015|sp|O59295|RS2_PYRHO 30S ribosomal protein S2P 158 2e-37
gi|18978012|ref|NP_579369.1| SSU ribosomal protein S2P [Pyrococc... 156 5e-37
gi|14520753|ref|NP_126228.1| SSU ribosomal protein S2P (rps2P) [... 156 6e-37
gi|38075585|ref|XP_195827.2| similar to 40S ribosomal protein SA... 155 1e-36
gi|41146531|ref|XP_371658.1| similar to laminin receptor 1 (ribo... 150 3e-35
gi|40716462|gb|AAR88769.1| DMRT1 isoform e [Gallus gallus] 149 6e-35
gi|42658158|ref|XP_377964.1| similar to 40S RIBOSOMAL PROTEIN SA... 149 7e-35
gi|16082199|ref|NP_394646.1| probable 30S ribosomal protein S2 [... 149 9e-35
gi|15897033|ref|NP_341638.1| SSU ribosomal protein S2AB (rps2AB)... 146 6e-34
gi|19074122|ref|NP_584728.1| 40S RIBOSOMAL PROTEIN SA or P40 [En... 145 1e-33
gi|14324616|dbj|BAB59543.1| ribosomal protein small subunit S0 [... 144 2e-33
gi|13541230|ref|NP_110918.1| 30S ribosomal protein S2 [Thermopla... 144 2e-33
gi|26344606|dbj|BAC35952.1| unnamed protein product [Mus musculu... 143 4e-33
gi|15678073|ref|NP_275187.1| ribosomal protein Sa (E.coli S2) [M... 143 4e-33
gi|20095014|ref|NP_614861.1| Ribosomal protein S2 [Methanopyrus ... 143 5e-33
gi|2129246|pir||F64422 ribosomal protein HS2 homolog - Methanoco... 142 7e-33
gi|15669172|ref|NP_247977.1| SSU ribosomal protein S2P [Methanoc... 142 7e-33
gi|41202575|ref|XP_370710.1| similar to protein 40kD [Homo sapiens] 138 2e-31
gi|45358230|ref|NP_987787.1| SSU Ribosomal protein S2 [Methanoco... 137 2e-31
gi|34878135|ref|XP_344249.1| similar to 40S ribosomal protein SA... 135 8e-31
gi|15922383|ref|NP_378052.1| 225aa long hypothetical 30S ribosom... 134 3e-30
gi|40889982|pdb|1VI6|A Chain A, Crystal Structure Of Ribosomal P... 132 1e-29
gi|41191511|ref|XP_372966.1| similar to protein 40kD [Homo sapiens] 132 1e-29
gi|11498733|ref|NP_069962.1| SSU ribosomal protein S2P (rps2P) [... 132 1e-29
gi|41150360|ref|XP_370988.1| similar to protein 40kD [Homo sapiens] 129 6e-29
gi|40889978|pdb|1VI5|A Chain A, Crystal Structure Of Ribosomal P... 129 1e-28
gi|18312202|ref|NP_558869.1| ribosomal protein S2 [Pyrobaculum a... 128 1e-28
gi|48477589|ref|YP_023295.1| small subunit ribosomal protein S2P... 127 4e-28
gi|48852991|ref|ZP_00307172.1| COG0052: Ribosomal protein S2 [Fe... 126 7e-28
gi|46141950|ref|ZP_00147460.2| COG0052: Ribosomal protein S2 [Me... 124 3e-27
gi|23822120|sp|Q8TT39|RS2_METAC 30S ribosomal protein S2P 122 7e-27
gi|20089489|ref|NP_615564.1| ribosomal protein S2p [Methanosarci... 122 7e-27
gi|14601603|ref|NP_148143.1| 30S ribosomal protein S2 [Aeropyrum... 122 1e-26
gi|21227862|ref|NP_633784.1| SSU ribosomal protein S2P [Methanos... 122 1e-26
gi|42656754|ref|XP_377797.1| similar to laminin receptor-like pr... 121 2e-26
gi|48840231|ref|ZP_00297158.1| COG0052: Ribosomal protein S2 [Me... 119 1e-25
gi|34864279|ref|XP_345658.1| similar to 40S ribosomal protein SA... 115 9e-25
gi|49080362|ref|XP_403710.1| hypothetical protein UM06095.1 [Ust... 115 1e-24
gi|15790223|ref|NP_280047.1| 30S ribosomal protein S2P; Rps2p [H... 115 1e-24
gi|28189637|dbj|BAC56433.1| similar to 40S ribosomal protein P40... 112 8e-24
gi|41615290|ref|NP_963788.1| NEQ508 [Nanoarchaeum equitans Kin4-... 112 8e-24
gi|140627|sp|P29202|RS2_HALMA 30S ribosomal protein S2P (HS2) (O... 111 2e-23
gi|38074994|ref|XP_356675.1| similar to heterogeneous nuclear ri... 105 2e-21
gi|41151481|ref|XP_372204.1| similar to 40S ribosomal protein SA... 103 5e-21
gi|6010099|emb|CAB57256.1| hypothetical protein [Entodinium caud... 102 1e-20
gi|34861943|ref|XP_345000.1| similar to 40S RIBOSOMAL PROTEIN SA... 87 7e-18
gi|386857|gb|AAA36165.1| laminin receptor 91 4e-17
gi|730653|sp|P39478|RS2_SULAC 30S ribosomal protein S2P >gnl|BL_... 79 9e-14
gi|41148688|ref|XP_373263.1| similar to laminin-binding protein ... 78 3e-13
gi|28189204|dbj|BAC56293.1| similar to C10 protein [Bos taurus] 77 5e-13
gi|38082849|ref|XP_357574.1| similar to laminin receptor 1 (ribo... 76 8e-13
gi|34855926|ref|XP_342697.1| similar to 60S ribosomal protein L7... 75 1e-12
gi|28551258|ref|XP_285291.1| similar to 40S RIBOSOMAL PROTEIN SA... 70 4e-11
gi|21436535|emb|CAD32469.1| 67kD laminin receptor/ribosomal prot... 68 3e-10
gi|46439762|gb|EAK99076.1| hypothetical protein CaO19.13170 [Can... 67 5e-10
gi|41191524|ref|XP_065722.3| similar to 40S ribosomal protein SA... 67 5e-10
gi|50304367|ref|XP_452133.1| unnamed protein product [Kluyveromy... 67 6e-10
gi|15618606|ref|NP_224892.1| S2 Ribosomal Protein [Chlamydophila... 62 2e-08
gi|34874528|ref|XP_214237.2| similar to KIAA0564 protein [Rattus... 60 8e-08
gi|6321782|ref|NP_011859.1| Mitochondrial ribosomal protein of t... 59 1e-07
gi|15829004|ref|NP_326364.1| 30S RIBOSOMAL PROTEIN S2 [Mycoplasm... 58 2e-07
gi|34537145|gb|AAQ74032.1| ribosomal protein 40 [Amazona aestiva... 56 8e-07
gi|31544727|ref|NP_853305.1| RpsB [Mycoplasma gallisepticum R] >... 55 2e-06
gi|13357582|ref|NP_077856.1| ribosomal protein S2 [Ureaplasma pa... 54 3e-06
gi|34537223|gb|AAQ74071.1| ribosomal protein 40 [Aratinga aurica... 54 5e-06
gi|21430060|gb|AAM50708.1| GM15484p [Drosophila melanogaster] 53 7e-06
gi|46445770|ref|YP_007135.1| probable 30S ribosomal protein S2 [... 52 1e-05
gi|19114947|ref|NP_594035.1| putative mitochondrial 40s ribosoma... 52 1e-05
gi|26554414|ref|NP_758348.1| ribosomal protein S2 [Mycoplasma pe... 52 2e-05
gi|30021915|ref|NP_833546.1| SSU ribosomal protein S2P [Bacillus... 51 3e-05
gi|15603964|ref|NP_220479.1| 30S RIBOSOMAL PROTEIN S2 (rpsB) [Ri... 51 4e-05
gi|21674595|ref|NP_662660.1| ribosomal protein S2 [Chlorobium te... 50 6e-05
gi|30263831|ref|NP_846208.1| ribosomal protein S2 [Bacillus anth... 50 6e-05
gi|21401811|ref|NP_657796.1| Ribosomal_S2, Ribosomal protein S2 ... 50 8e-05
gi|34540206|ref|NP_904685.1| ribosomal protein S2 [Porphyromonas... 50 8e-05
gi|23025114|ref|ZP_00064287.1| COG0052: Ribosomal protein S2 [Le... 49 1e-04
gi|16330739|ref|NP_441467.1| 30S ribosomal protein S2 [Synechocy... 49 1e-04
gi|46106260|ref|ZP_00186850.2| COG0052: Ribosomal protein S2 [Ru... 49 1e-04
gi|29839814|ref|NP_828920.1| ribosomal protein S2 [Chlamydophila... 49 1e-04
gi|15924246|ref|NP_371780.1| 30S ribosomal protein S2 [Staphyloc... 49 1e-04
gi|50423181|ref|XP_460171.1| unnamed protein product [Debaryomyc... 49 1e-04
gi|49093854|ref|XP_408388.1| hypothetical protein AN4251.2 [Aspe... 49 1e-04
gi|27467850|ref|NP_764487.1| 30S ribosomal protein S2 [Staphyloc... 49 1e-04
gi|11467370|ref|NP_043227.1| ribosomal protein S2 [Cyanophora pa... 49 2e-04
gi|15895063|ref|NP_348412.1| Ribosomal protein S2 [Clostridium a... 49 2e-04
gi|37590165|gb|AAH58822.1| LOC204010 protein [Homo sapiens] 49 2e-04
gi|15605413|ref|NP_220199.1| S2 Ribosomal Protein [Chlamydia tra... 49 2e-04
gi|34580930|ref|ZP_00142410.1| 30S ribosomal protein S2 [Rickett... 49 2e-04
gi|12044922|ref|NP_072732.1| ribosomal protein S2 (rpS2) [Mycopl... 48 2e-04
gi|15834676|ref|NP_296435.1| ribosomal protein S2 [Chlamydia mur... 48 2e-04
gi|1518660|gb|AAB07069.1| ribosomal protein S2 [Chlamydia tracho... 48 3e-04
gi|42519372|ref|NP_965302.1| 30S ribosomal protein S2 [Lactobaci... 47 4e-04
gi|15892035|ref|NP_359749.1| 30S ribosomal protein S2 [Rickettsi... 47 4e-04
gi|13507947|ref|NP_109896.1| ribosomal protein S2 [Mycoplasma pn... 47 4e-04
gi|37521399|ref|NP_924776.1| 30S ribosomal protein S2 [Gloeobact... 47 5e-04
gi|15674135|ref|NP_268310.1| 30S ribosomal protein S2 [Lactococc... 47 7e-04
gi|15643525|ref|NP_228571.1| ribosomal protein S2 [Thermotoga ma... 47 7e-04
gi|32476535|ref|NP_869529.1| ribosomal protein S2 [Pirellula sp.... 47 7e-04
gi|41146967|ref|XP_373100.1| similar to 60S ribosomal protein L1... 46 9e-04
gi|48869771|ref|ZP_00322513.1| COG0052: Ribosomal protein S2 [Pe... 46 9e-04
gi|16078712|ref|NP_389531.1| ribosomal protein S2 [Bacillus subt... 46 9e-04
gi|20514053|gb|AAM22906.1| 37LRP/p40 [Ficedula hypoleuca] >gnl|B... 46 9e-04
gi|15639594|ref|NP_219044.1| ribosomal protein S2 (rpsB) [Trepon... 46 0.001
gi|42453271|ref|ZP_00153178.1| hypothetical protein Rick010901 [... 46 0.001
gi|45532586|ref|ZP_00183589.1| COG0052: Ribosomal protein S2 [Ex... 46 0.001
gi|24215997|ref|NP_713478.1| ribosomal protein S2 [Leptospira in... 45 0.001
gi|23099041|ref|NP_692507.1| 30S ribosomal protein S2 [Oceanobac... 45 0.001
gi|46579287|ref|YP_010095.1| ribosomal protein S2 [Desulfovibrio... 45 0.001
gi|21911318|ref|NP_665586.1| 30S ribosomal protein S2 [Streptoco... 45 0.002
gi|15675849|ref|NP_270023.1| 30S ribosomal protein S2 [Streptoco... 45 0.002
gi|28210947|ref|NP_781891.1| SSU ribosomal protein S2P [Clostrid... 45 0.002
gi|24380374|ref|NP_722329.1| 30S ribosomal protein S2 [Streptoco... 45 0.002
gi|30468231|ref|NP_849118.1| ribosomal protein S2 [Cyanidioschyz... 45 0.002
gi|23002921|ref|ZP_00046593.1| COG0052: Ribosomal protein S2 [La... 45 0.003
gi|23128817|ref|ZP_00110656.1| COG0052: Ribosomal protein S2 [No... 45 0.003
gi|19704941|ref|NP_602436.1| SSU ribosomal protein S2P [Fusobact... 45 0.003
gi|20807856|ref|NP_623027.1| Ribosomal protein S2 [Thermoanaerob... 45 0.003
gi|46123861|ref|XP_386484.1| hypothetical protein FG06308.1 [Gib... 45 0.003
gi|1350975|sp|P49668|RS2_PEDAC 30S ribosomal protein S2 >gnl|BL_... 45 0.003
gi|22537971|ref|NP_688822.1| ribosomal protein S2 [Streptococcus... 45 0.003
gi|29829169|ref|NP_823803.1| putative ribosomal protein S2 [Stre... 44 0.003
gi|17232284|ref|NP_488832.1| 30S ribosomal protein S2 [Nostoc sp... 44 0.003
gi|34762366|ref|ZP_00143368.1| SSU ribosomal protein S2P [Fusoba... 44 0.003
gi|18310682|ref|NP_562616.1| 30S ribosomal protein S2 [Clostridi... 44 0.004
gi|42525107|ref|NP_970487.1| 30S ribosomal protein S2 [Bdellovib... 44 0.004
gi|15902019|ref|NP_346623.1| ribosomal protein S2 [Streptococcus... 44 0.004
gi|15904061|ref|NP_359611.1| 30S Ribosomal protein S2 [Streptoco... 44 0.004
gi|23111621|ref|ZP_00097230.1| COG0052: Ribosomal protein S2 [De... 44 0.006
gi|50555890|ref|XP_505353.1| hypothetical protein [Yarrowia lipo... 44 0.006
gi|14278531|pdb|1I94|B Chain B, Crystal Structures Of The Small ... 43 0.007
gi|16803698|ref|NP_465183.1| 30S ribosomal protein S2 [Listeria ... 43 0.007
gi|16800835|ref|NP_471103.1| 30S ribosomal protein S2 [Listeria ... 43 0.007
gi|15594468|ref|NP_212257.1| ribosomal protein S2 (rpsB) [Borrel... 43 0.007
gi|46198817|ref|YP_004484.1| SSU ribosomal protein S2P [Thermus ... 43 0.007
gi|50590033|ref|ZP_00331473.1| COG0052: Ribosomal protein S2 [St... 43 0.007
gi|33240275|ref|NP_875217.1| Ribosomal protein S2 [Prochlorococc... 43 0.010
gi|22974388|ref|ZP_00020653.1| hypothetical protein [Chloroflexu... 43 0.010
gi|48865047|ref|ZP_00318913.1| COG0052: Ribosomal protein S2 [Oe... 43 0.010
gi|11467687|ref|NP_050739.1| ribosomal protein S2 [Guillardia th... 43 0.010
gi|33865624|ref|NP_897183.1| 30S ribosomal protein S2 [Synechoco... 43 0.010
gi|34811530|pdb|1PNS|B Chain B, Crystal Structure Of A Streptomy... 43 0.010
gi|15806525|ref|NP_295236.1| ribosomal protein S2 [Deinococcus r... 42 0.013
gi|34556640|ref|NP_906455.1| 30S RIBOSOMAL PROTEIN S2 [Wolinella... 42 0.013
gi|33862857|ref|NP_894417.1| 30S ribosomal protein S2 [Prochloro... 42 0.013
gi|50657735|gb|AAT79720.1| 30S ribosomal protein S2 [Gracilaria ... 42 0.013
gi|48853631|ref|ZP_00307799.1| COG0052: Ribosomal protein S2 [Cy... 42 0.013
gi|46914523|emb|CAG21302.1| putative 30S ribosomal protein S2 [P... 42 0.016
gi|38103937|gb|EAA50572.1| hypothetical protein MG04331.4 [Magna... 42 0.016
gi|28572473|ref|NP_789253.1| 30s ribosomal protein S2 [Tropherym... 42 0.021
gi|28378686|ref|NP_785578.1| ribosomal protein S2 [Lactobacillus... 42 0.021
gi|39938651|ref|NP_950417.1| ribosomal protein S2 [Onion yellows... 42 0.021
gi|23475053|ref|ZP_00130343.1| COG0052: Ribosomal protein S2 [De... 42 0.021
gi|21223979|ref|NP_629758.1| 30S ribosomal protein S2 [Streptomy... 42 0.021
gi|28493416|ref|NP_787577.1| 30S ribosomal protein S2 [Tropherym... 42 0.021
gi|38234087|ref|NP_939854.1| 30S ribosomal protein S2 [Corynebac... 41 0.028
gi|11466379|ref|NP_038382.1| ribosomal protein S2 [Mesostigma vi... 41 0.028
gi|39997019|ref|NP_952970.1| ribosomal protein S2 [Geobacter sul... 41 0.028
gi|22299231|ref|NP_682478.1| 30S ribosomal protein S2 [Thermosyn... 41 0.028
gi|15614990|ref|NP_243293.1| 30S ribosomal protein S2; ribosomal... 41 0.028
gi|29376895|ref|NP_816049.1| ribosomal protein S2 [Enterococcus ... 41 0.028
gi|34878139|ref|XP_214056.2| similar to 40S RIBOSOMAL PROTEIN SA... 41 0.028
gi|29349285|ref|NP_812788.1| 30S ribosomal protein S2 (BS1) [Bac... 41 0.036
gi|6066156|gb|AAF03174.1| ribosomal protein S2 [Nephroselmis oli... 41 0.036
gi|6226896|sp|O31212|RS2_STRCO 30S ribosomal protein S2 >gnl|BL_... 41 0.036
gi|38638298|ref|NP_943699.1| ribosomal protein S2 [Chara vulgari... 41 0.036
gi|50365378|ref|YP_053803.1| 30S ribosomal protein S2 [Mesoplasm... 41 0.036
gi|45526400|ref|ZP_00177606.1| COG0052: Ribosomal protein S2 [Cr... 41 0.036
gi|48846013|ref|ZP_00300281.1| COG0052: Ribosomal protein S2 [Ge... 40 0.048
gi|46130564|ref|ZP_00165490.2| COG0052: Ribosomal protein S2 [Sy... 40 0.048
gi|23470506|ref|ZP_00125839.1| COG0052: Ribosomal protein S2 [Ps... 40 0.048
gi|28868740|ref|NP_791359.1| ribosomal protein S2 [Pseudomonas s... 40 0.048
gi|23466059|ref|NP_696662.1| 30S ribosomal protein S2 [Bifidobac... 40 0.048
gi|11467570|ref|NP_043716.1| ribosomal protein S2 [Odontella sin... 40 0.062
gi|15616847|ref|NP_240060.1| 30S ribosomal protein S2 [Buchnera ... 40 0.062
gi|50842999|ref|YP_056226.1| 30S ribosomal protein S2 [Propionib... 40 0.062
gi|3123267|sp|P19679|RS2_SPICI 30S ribosomal protein S2 >gnl|BL_... 40 0.062
gi|49234934|ref|ZP_00329015.1| COG0052: Ribosomal protein S2 [Mo... 40 0.081
gi|33861310|ref|NP_892871.1| 30S ribosomal protein S2 [Prochloro... 40 0.081
gi|48836435|ref|ZP_00293431.1| COG0052: Ribosomal protein S2 [Th... 39 0.11
gi|11465715|ref|NP_053859.1| ribosomal protein S2 [Porphyra purp... 39 0.11
gi|18272396|sp|P81289|RS2_BACST 30S ribosomal protein S2 (BS2a) 39 0.11
gi|243181|gb|AAB21092.1| ribosomal protein S2 [Bacillus stearoth... 39 0.11
gi|440797|gb|AAB60453.1| laminin receptor 39 0.11
gi|48732721|ref|ZP_00266464.1| COG0052: Ribosomal protein S2 [Ps... 39 0.11
gi|26988323|ref|NP_743748.1| ribosomal protein S2 [Pseudomonas p... 39 0.11
gi|15598852|ref|NP_252346.1| 30S ribosomal protein S2 [Pseudomon... 39 0.14
gi|2734649|gb|AAB93677.1| ribosomal protein subunit 2 [Buchnera ... 39 0.14
gi|3417446|dbj|BAA32342.1| ribosomal protein S2 [Pseudomonas aer... 39 0.14
gi|46308645|ref|ZP_00210837.1| COG0052: Ribosomal protein S2 [Eh... 39 0.14
gi|48891019|ref|ZP_00324603.1| COG0052: Ribosomal protein S2 [Tr... 39 0.14
gi|49082262|gb|AAT50531.1| PA3656 [synthetic construct] 39 0.14
gi|22711971|ref|NP_683777.1| ribosomal protein S2 [Chaetosphaeri... 39 0.14
gi|47569105|ref|ZP_00239794.1| ribosomal protein S2 [Bacillus ce... 39 0.14
gi|7524612|ref|NP_042366.1| ribosomal protein S2 [Pinus thunberg... 39 0.14
gi|47933792|gb|AAT39476.1| 37LRP [Alectoris rufa] >gnl|BL_ORD_ID... 39 0.14
gi|11467163|ref|NP_054464.1| rps2 [Marchantia polymorpha] >gnl|B... 39 0.14
gi|32266571|ref|NP_860603.1| ribosomal protein S2 [Helicobacter ... 39 0.18
gi|21536611|gb|AAM60943.1| putative ribosomal protein S2 [Arabid... 39 0.18
gi|2734655|gb|AAB93680.1| ribosomal protein subunit 2 [Conopholi... 38 0.24
gi|2734693|gb|AAB93698.1| ribosomal protein subunit 2 [Sopubia c... 38 0.24
gi|46141382|ref|ZP_00203939.1| COG0052: Ribosomal protein S2 [Ps... 38 0.31
gi|16603928|gb|AAL27210.1| ribosomal protein subunit 2 [Arbutus ... 38 0.31
gi|30352023|ref|NP_848049.1| ribosomal protein S2 [Adiantum capi... 38 0.31
gi|16603934|gb|AAL27213.1| ribosomal protein subunit 2 [Comarost... 38 0.31
gi|11466956|ref|NP_054377.1| ribosomal protein S2 [Epifagus virg... 38 0.31
gi|16603930|gb|AAL27211.1| ribosomal protein subunit 2 [Arctosta... 38 0.31
gi|16603932|gb|AAL27212.1| ribosomal protein subunit 2 [Arctosta... 38 0.31
gi|48995172|gb|AAP29381.3| ribosomal protein S2 [Adiantum capill... 37 0.40
gi|22995059|ref|ZP_00039542.1| COG0052: Ribosomal protein S2 [Xy... 37 0.40
gi|17129600|dbj|BAB72238.1| ribosomal protein subunit 2 [Cistanc... 37 0.40
gi|17129602|dbj|BAB72239.1| ribosomal protein subunit 2 [Cistanc... 37 0.40
gi|15839169|ref|NP_299857.1| 30S ribosomal protein S2 [Xylella f... 37 0.53
gi|11465574|ref|NP_045034.1| ribosomal protein S2 [Cyanidium cal... 37 0.53
gi|14017565|ref|NP_114252.1| ribosomal protein S2 [Triticum aest... 37 0.53
gi|11467185|ref|NP_043018.1| ribosomal protein S2 [Zea mays] >gn... 37 0.53
gi|48478766|ref|YP_024374.1| ribosomal protein S2 [Saccharum hyb... 37 0.53
gi|7525022|ref|NP_051048.1| ribosomal protein S2 [Arabidopsis th... 37 0.53
gi|13518330|ref|NP_084689.1| ribosomal protein S2 [Oenothera ela... 37 0.53
gi|70861|pir||R3WT2 ribosomal protein S2, chloroplast - wheat ch... 37 0.53
gi|2734677|gb|AAB93690.1| ribosomal protein subunit 2 [Ligustrum... 37 0.53
gi|22997177|ref|ZP_00041413.1| COG0052: Ribosomal protein S2 [Xy... 37 0.53
gi|17129596|dbj|BAB72236.1| ribosomal protein subunit 2 [Cistanc... 37 0.53
gi|2734689|gb|AAB93696.1| ribosomal protein subunit 2 [Rhinanthu... 37 0.69
gi|2734661|gb|AAB93683.1| ribosomal protein subunit 2 [Cycnium r... 37 0.69
gi|32480832|ref|NP_862743.1| ribosomal protein S2 [Calycanthus f... 37 0.69
gi|34501433|ref|NP_904220.1| ribosomal protein S2 [Physcomitrell... 37 0.69
gi|31616542|gb|AAP55715.1| ribosomal protein S2 [Chenopodium rub... 37 0.69
gi|39573654|dbj|BAD04078.1| ribosomal protein subunit 2 [Cistanc... 37 0.69
gi|13518439|ref|NP_084799.1| ribosomal protein S2 [Lotus cornicu... 37 0.69
gi|10179752|gb|AAG13868.1| ribosomal protein subunit 2 [Zaluzian... 37 0.69
gi|10179718|gb|AAG13851.1| ribosomal protein subunit 2 [Amphiant... 37 0.69
gi|6650156|gb|AAF21746.1| ribosomal protein subunit 2 [Selago th... 37 0.69
gi|2734681|gb|AAB93692.1| ribosomal protein subunit 2 [Orobanche... 37 0.69
gi|2734687|gb|AAB93695.1| ribosomal protein subunit 2 [Parentuce... 37 0.69
gi|2734665|gb|AAB93685.1| ribosomal protein subunit 2 [Euphrasia... 37 0.69
gi|2734699|gb|AAB93701.1| ribosomal protein subunit 2 [Tozzia al... 37 0.69
gi|39573650|dbj|BAD04076.1| ribosomal protein subunit 2 [Cistanc... 37 0.69
gi|16603946|gb|AAL27219.1| ribosomal protein subunit 2 [Pieris p... 37 0.69
gi|17129594|dbj|BAB72235.1| ribosomal protein subunit 2 [Cistanc... 37 0.69
gi|39573642|dbj|BAD04072.1| ribosomal protein subunit 2 [Cistanc... 37 0.69
gi|17129592|dbj|BAB72234.1| ribosomal protein subunit 2 [Cistanc... 37 0.69
gi|50876043|emb|CAG35883.1| probable 30S ribosomal protein S2 [D... 37 0.69
gi|34500903|ref|NP_904088.1| ribosomal protein S2 [Amborella tri... 36 0.90
gi|16603896|gb|AAL27196.1| ribosomal protein subunit 2 [Pleurico... 36 0.90
gi|15612510|ref|NP_224163.1| 30S RIBOSOMAL PROTEIN S2 [Helicobac... 36 0.90
gi|6650150|gb|AAF21743.1| ribosomal protein subunit 2 [Paulownia... 36 0.90
gi|21242175|ref|NP_641757.1| 30S ribosomal protein S2 [Xanthomon... 36 0.90
gi|11497513|ref|NP_054921.1| ribosomal protein S2 [Spinacia oler... 36 0.90
gi|11466682|ref|NP_039278.1| ribosomal protein S2 [Marchantia po... 36 0.90
gi|10179746|gb|AAG13865.1| ribosomal protein subunit 2 [Aptosimu... 36 0.90
gi|6650168|gb|AAF21752.1| ribosomal protein subunit 2 [Kohleria ... 36 0.90
gi|10179732|gb|AAG13858.1| ribosomal protein subunit 2 [Catalpa ... 36 0.90
gi|10179722|gb|AAG13853.1| ribosomal protein subunit 2 [Bacopa c... 36 0.90
gi|6650136|gb|AAF21736.1| ribosomal protein subunit 2 [Melampyru... 36 0.90
gi|6650152|gb|AAF21744.1| ribosomal protein subunit 2 [Leucophyl... 36 0.90
gi|6650162|gb|AAF21749.1| ribosomal protein subunit 2 [Hemiphrag... 36 0.90
gi|10179730|gb|AAG13857.1| ribosomal protein subunit 2 [Tetranem... 36 0.90
gi|10179736|gb|AAG13860.1| ribosomal protein subunit 2 [Jovellan... 36 0.90
gi|10179714|gb|AAG13849.1| ribosomal protein subunit 2 [Barleria... 36 0.90
gi|6650154|gb|AAF21745.1| ribosomal protein subunit 2 [Myoporum ... 36 0.90
gi|10179742|gb|AAG13863.1| ribosomal protein subunit 2 [Sesamum ... 36 0.90
gi|6650118|gb|AAF21727.1| ribosomal protein subunit 2 [Macranthe... 36 0.90
gi|6650164|gb|AAF21750.1| ribosomal protein subunit 2 [Calceolar... 36 0.90
gi|6650148|gb|AAF21742.1| ribosomal protein subunit 2 [Mimulus a... 36 0.90
gi|6650160|gb|AAF21748.1| ribosomal protein subunit 2 [Hippuris ... 36 0.90
gi|6650144|gb|AAF21740.1| ribosomal protein subunit 2 [Schlegeli... 36 0.90
gi|10179754|gb|AAG13869.1| ribosomal protein subunit 2 [Halleria... 36 0.90
gi|6650142|gb|AAF21739.1| ribosomal protein subunit 2 [Lindenber... 36 0.90
gi|6650158|gb|AAF21747.1| ribosomal protein subunit 2 [Callitric... 36 0.90
gi|10179716|gb|AAG13850.1| ribosomal protein subunit 2 [Thunberg... 36 0.90
gi|6650116|gb|AAF21726.1| ribosomal protein subunit 2 [Lamouroux... 36 0.90
gi|6650114|gb|AAF21725.1| ribosomal protein subunit 2 [Triphysar... 36 0.90
gi|10179726|gb|AAG13855.1| ribosomal protein subunit 2 [Globular... 36 0.90
gi|10179756|gb|AAG13870.1| ribosomal protein subunit 2 [Stachyta... 36 0.90
gi|6650124|gb|AAF21730.1| ribosomal protein subunit 2 [Harveya c... 36 0.90
gi|10179750|gb|AAG13867.1| ribosomal protein subunit 2 [Nemesia ... 36 0.90
gi|2734679|gb|AAB93691.1| ribosomal protein subunit 2 [Melasma s... 36 0.90
gi|46191254|ref|ZP_00120409.2| COG0052: Ribosomal protein S2 [Bi... 36 0.90
gi|2734669|gb|AAB93687.1| ribosomal protein subunit 2 [Hyobanche... 36 0.90
gi|2734659|gb|AAB93682.1| ribosomal protein subunit 2 [Chelone o... 36 0.90
gi|2734643|gb|AAB93674.1| ribosomal protein subunit 2 [Agalinis ... 36 0.90
gi|2734651|gb|AAB93678.1| ribosomal protein subunit 2 [Boschniak... 36 0.90
gi|2734645|gb|AAB93675.1| ribosomal protein subunit 2 [Alectra s... 36 0.90
gi|2734675|gb|AAB93689.1| ribosomal protein subunit 2 [Lathraea ... 36 0.90
gi|2734695|gb|AAB93699.1| ribosomal protein subunit 2 [Scrophula... 36 0.90
gi|2734639|gb|AAB93672.1| ribosomal protein subunit 2 [Antirrhin... 36 0.90
gi|2734683|gb|AAB93693.1| ribosomal protein subunit 2 [Orobanche... 36 0.90
gi|2734703|gb|AAB93703.1| ribosomal protein subunit 2 [Verbascum... 36 0.90
gi|2734653|gb|AAB93679.1| ribosomal protein subunit 2 [Boschniak... 36 0.90
gi|2734657|gb|AAB93681.1| ribosomal protein subunit 2 [Castillej... 36 0.90
gi|2734671|gb|AAB93688.1| ribosomal protein subunit 2 [Hemimeris... 36 0.90
gi|2734663|gb|AAB93684.1| ribosomal protein subunit 2 [Digitalis... 36 0.90
gi|10179724|gb|AAG13854.1| ribosomal protein subunit 2 [Collinsi... 36 0.90
gi|17129598|dbj|BAB72237.1| ribosomal protein subunit 2 [Cistanc... 36 0.90
gi|46362816|ref|ZP_00225650.1| COG0052: Ribosomal protein S2 [Ki... 36 1.2
gi|17546123|ref|NP_519525.1| PROBABLE 30S RIBOSOMAL PROTEIN S2 [... 36 1.2
gi|50346771|ref|YP_053144.1| ribosomal protein S2 [Nymphaea alba... 36 1.2
gi|6650166|gb|AAF21751.1| ribosomal protein subunit 2 [Gratiola ... 36 1.2
gi|6650138|gb|AAF21737.1| ribosomal protein subunit 2 [Pedicular... 36 1.2
gi|2734641|gb|AAB93673.1| ribosomal protein subunit 2 [Alectra o... 36 1.2
gi|42795482|gb|AAS46049.1| ribosomal protein S2; rps2 [Oryza sat... 35 1.5
gi|50233964|ref|YP_052742.1| ribosomal protein S2 [Oryza nivara]... 35 1.5
gi|37533316|ref|NP_920960.1| putative ribosomal protein S2 from ... 35 1.5
gi|133913|sp|P08241|RR2_PEA Chloroplast 30S ribosomal protein S2... 35 1.5
gi|11466780|ref|NP_039376.1| ribosomal protein S2 [Oryza sativa ... 35 1.5
gi|2734691|gb|AAB93697.1| ribosomal protein subunit 2 [Striga as... 35 1.5
gi|46319041|ref|ZP_00219461.1| COG0052: Ribosomal protein S2 [Bu... 35 1.5
gi|2734701|gb|AAB93702.1| ribosomal protein subunit 2 [Veronica ... 35 1.5
gi|21230832|ref|NP_636749.1| 30S ribosomal protein S2 [Xanthomon... 35 2.0
gi|16603903|gb|AAL27198.1| ribosomal protein subunit 2 [Monotrop... 35 2.0
gi|48787694|ref|ZP_00283673.1| COG0052: Ribosomal protein S2 [Bu... 35 2.0
gi|48768189|ref|ZP_00272540.1| COG0052: Ribosomal protein S2 [Ra... 35 2.0
gi|16603952|gb|AAL27222.1| ribosomal protein subunit 2 [Ledum gr... 35 2.0
gi|16603950|gb|AAL27221.1| ribosomal protein subunit 2 [Rhododen... 35 2.0
gi|11465943|ref|NP_054485.1| ribosomal protein S2 [Nicotiana tab... 35 2.0
gi|31580890|dbj|BAC77547.1| ribosomal protein S2 [Nicotiana sylv... 35 2.0
gi|46311939|ref|ZP_00212540.1| COG0052: Ribosomal protein S2 [Bu... 35 2.0
gi|10179740|gb|AAG13862.1| ribosomal protein subunit 2 [Probosci... 35 2.0
gi|6650132|gb|AAF21734.1| ribosomal protein subunit 2 [Orobanche... 35 2.0
gi|6650146|gb|AAF21741.1| ribosomal protein subunit 2 [Verbena b... 35 2.0
gi|2734673|gb|AAC73011.1| ribosomal protein subunit 2 [Kigelia a... 35 2.0
gi|16603942|gb|AAL27217.1| ribosomal protein subunit 2 [Pernetty... 35 2.0
gi|16603938|gb|AAL27215.1| ribosomal protein subunit 2 [Gaulther... 35 2.0
gi|39573652|dbj|BAD04077.1| ribosomal protein subunit 2 [Cistanc... 35 2.0
gi|2734667|gb|AAB93686.1| ribosomal protein subunit 2 [Harveya p... 35 2.0
gi|16603924|gb|AAL27208.1| ribosomal protein subunit 2 [Pyrola a... 35 2.0
gi|16603936|gb|AAL27214.1| ribosomal protein subunit 2 [Gaulther... 35 2.0
gi|16603901|gb|AAL27197.1| ribosomal protein subunit 2 [Pityopus... 35 2.6
gi|31580934|dbj|BAC77570.1| ribosomal protein S2 [Nicotiana tome... 35 2.6
gi|21672506|ref|NP_660573.1| 30S ribosomal protein S2 [Buchnera ... 35 2.6
gi|6650134|gb|AAF21735.1| ribosomal protein subunit 2 [Orobanche... 35 2.6
gi|10179720|gb|AAG13852.1| ribosomal protein subunit 2 [Angeloni... 35 2.6
gi|2734647|gb|AAB93676.1| ribosomal protein subunit 2 [Bartsia a... 35 2.6
gi|45515282|ref|ZP_00166837.1| COG0052: Ribosomal protein S2 [Ra... 35 2.6
gi|2734685|gb|AAB93694.1| ribosomal protein subunit 2 [Pedicular... 35 2.6
gi|16603948|gb|AAL27220.1| ribosomal protein subunit 2 [Oxydendr... 35 2.6
gi|16603940|gb|AAL27216.1| ribosomal protein subunit 2 [Vacciniu... 35 2.6
gi|16603944|gb|AAL27218.1| ribosomal protein subunit 2 [Leucotho... 35 2.6
gi|15646161|ref|NP_208345.1| ribosomal protein S2 (rps2) [Helico... 34 3.4
gi|50288227|ref|XP_446542.1| unnamed protein product [Candida gl... 34 3.4
gi|2734697|gb|AAB93700.1| ribosomal protein subunit 2 [Striga ge... 34 3.4
gi|11467791|ref|NP_050842.1| ribosomal protein S2 [Nephroselmis ... 34 4.5
gi|45520332|ref|ZP_00171866.1| COG0052: Ribosomal protein S2 [Me... 34 4.5
gi|42524471|ref|NP_969851.1| NADH dehydrogenase I chain I [Bdell... 34 4.5
gi|16603908|gb|AAL27200.1| ribosomal protein subunit 2 [Hemitome... 33 7.6
gi|41148269|ref|XP_374636.1| similar to acyl CoA:monoacylglycero... 33 7.6
gi|20379255|gb|AAF21733.2| ribosomal protein subunit 2 [Orobanch... 33 7.6
gi|7440110|pir||S51053 ribosomal protein S2 - Thermus aquaticus ... 33 7.6
gi|17549764|ref|NP_523104.1| PUTATIVE HEMAGGLUTININ-RELATED PROT... 33 7.6
gi|39997051|ref|NP_953002.1| asparagine synthase, glutamine-hydr... 33 7.6
gi|15792506|ref|NP_282329.1| 30S ribosomal protein S2 [Campyloba... 33 9.9
gi|16603956|gb|AAL27224.1| ribosomal protein subunit 2 [Enkianth... 33 9.9
gi|619569|emb|CAA58577.1| ribosomal protein S2 [Thermus thermoph... 33 9.9
gi|15679677|ref|NP_276794.1| alanyl-tRNA synthetase [Methanother... 33 9.9
gi|16603954|gb|AAL27223.1| ribosomal protein subunit 2 [Enkianth... 33 9.9
gi|17547907|ref|NP_521309.1| PUTATIVE HEMAGGLUTININ-RELATED PROT... 33 9.9
>gi|17554768|ref|NP_497978.1| ribosomal Protein, Small subunit (30.7
kD) (rps-0) [Caenorhabditis elegans]
gi|1173295|sp|P46769|RSP4_CAEEL PROBABLE 40S RIBOSOMAL PROTEIN SA
(P40)
gi|7494910|pir||T18742 hypothetical protein B0393.1 -
Caenorhabditis elegans
gi|3873741|emb|CAA86061.1| Hypothetical protein B0393.1
[Caenorhabditis elegans]
Length = 276
Score = 508 bits (1308), Expect = e-143
Identities = 256/276 (92%), Positives = 256/276 (92%)
Frame = -1
Query: 831 MSGGAAHSALTEEDVMKLLATQAHLGSTNLNFQMQQYVYKRRFDGPNIINVKKTWEKLLL 652
MSGGAAHSALTEEDVMKLLATQAHLGSTNLNFQMQQYVYKRRFDGPNIINVKKTWEKLLL
Sbjct: 1 MSGGAAHSALTEEDVMKLLATQAHLGSTNLNFQMQQYVYKRRFDGPNIINVKKTWEKLLL 60
Query: 651 AARAIAAVENPADVVVVSARPYAQRALLKFAAHTGATAIFGRFSPGCLTNQIQKTFKEPR 472
AARAIAAVENPADVVVVSARPYAQRALLKFAAHTGATAIFGRFSPGCLTNQIQKTFKEPR
Sbjct: 61 AARAIAAVENPADVVVVSARPYAQRALLKFAAHTGATAIFGRFSPGCLTNQIQKTFKEPR 120
Query: 471 LLVISDPRIDHQAVTEASYVGVPVISFVNTESPLKLIDIGVPCNNKGERSIGLMWWMLAR 292
LLVISDPRIDHQAVTEASYVGVPVISFVNTESPLKLIDIGVPCNNKGERSIGLMWWMLAR
Sbjct: 121 LLVISDPRIDHQAVTEASYVGVPVISFVNTESPLKLIDIGVPCNNKGERSIGLMWWMLAR 180
Query: 291 EILILRGKISRQTGFVLEGKEIMPDLYFYRDPTETEKEETGAHADVAEAQEYQQPTDIDF 112
EILILRGKISRQTGFVLEGKEIMPDLYFYRDPTETEKEETGAHADVAEAQEYQQPTDIDF
Sbjct: 181 EILILRGKISRQTGFVLEGKEIMPDLYFYRDPTETEKEETGAHADVAEAQEYQQPTDIDF 240
Query: 111 TTQGGKVDDXXXXXXXXXXXXXXXXXXXXAPTQSNW 4
TTQGGKVDD APTQSNW
Sbjct: 241 TTQGGKVDDWAAETATWTAETKTTEEWANAPTQSNW 276