Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= B0412_2
(171 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17554782|ref|NP_497263.1| ribosomal Protein, Small subunit (r... 127 5e-29
gi|7494926|pir||T25449 hypothetical protein B0412.4 - Caenorhabd... 124 7e-28
gi|39586170|emb|CAE69246.1| Hypothetical protein CBG15290 [Caeno... 123 1e-27
gi|30267905|gb|AAP21827.1| ribosomal protein S29 [Branchiostoma ... 105 2e-22
gi|49532852|dbj|BAD26661.1| Ribosomal protein S29 [Plutella xylo... 100 1e-20
gi|28316886|gb|AAL68340.2| RH06643p [Drosophila melanogaster] 99 2e-20
gi|24645515|ref|NP_649946.1| CG8495-PA [Drosophila melanogaster]... 99 2e-20
gi|18253059|gb|AAL62474.1| ribosomal protein S29 [Spodoptera fru... 99 3e-20
gi|8575714|gb|AAF78063.1| ribsomal protein S29 [Culex pipiens qu... 99 3e-20
gi|31242157|ref|XP_321509.1| ENSANGP00000018161 [Anopheles gambi... 97 1e-19
gi|22001966|sp|Q90YP2|RS29_ICTPU 40S ribosomal protein S29 >gnl|... 96 2e-19
gi|19577384|emb|CAD27766.1| putative ribosomal protein [Anophele... 96 2e-19
gi|4506717|ref|NP_001023.1| ribosomal protein S29; 40S ribosomal... 96 2e-19
gi|47086133|ref|NP_998118.1| ribosomal protein S29 [Danio rerio]... 95 4e-19
gi|48675937|ref|NP_001001633.1| ribosomal protein S29 [Sus scrof... 93 1e-18
gi|45190658|ref|NP_984912.1| AER052Wp [Eremothecium gossypii] >g... 93 1e-18
gi|6323420|ref|NP_013492.1| Protein component of the small (40S)... 93 2e-18
gi|32400973|gb|AAP80692.1| ribosome protein S29 [Griffithsia jap... 92 2e-18
gi|50749078|ref|XP_426478.1| PREDICTED: similar to ribosomal pro... 92 3e-18
gi|50286045|ref|XP_445451.1| unnamed protein product [Candida gl... 91 7e-18
gi|6320142|ref|NP_010222.1| Protein component of the small (40S)... 91 9e-18
gi|50409045|ref|XP_456833.1| unnamed protein product [Debaryomyc... 89 3e-17
gi|15229840|ref|NP_189984.1| 40S ribosomal protein S29 (RPS29A) ... 88 6e-17
gi|34915198|ref|NP_919056.1| putative ribosomal protein S29 [Ory... 86 3e-16
gi|32401334|gb|AAP80839.1| ribosomal S29-like protein [Griffiths... 86 3e-16
gi|42733647|gb|AAS38610.1| similar to Homology to rat S29; Rps29... 84 1e-15
gi|19852048|gb|AAL99979.1| 40S ribosomal protein S29 [Aplysia ca... 84 1e-15
gi|2350978|dbj|BAA22015.1| ribosomal protein S29 [Entamoeba hist... 81 6e-15
gi|46228856|gb|EAK89726.1| ribosomal protein S29 [Cryptosporidiu... 81 7e-15
gi|50259478|gb|EAL22151.1| hypothetical protein CNBC2890 [Crypto... 81 7e-15
gi|50308349|ref|XP_454176.1| unnamed protein product [Kluyveromy... 80 9e-15
gi|32404854|ref|XP_323040.1| hypothetical protein [Neurospora cr... 80 2e-14
gi|38111646|gb|EAA57194.1| hypothetical protein MG08163.4 [Magna... 79 2e-14
gi|50546269|ref|XP_500652.1| hypothetical protein [Yarrowia lipo... 76 2e-13
gi|13811954|ref|NP_113083.1| 40S ribosomal protein S29A [Guillar... 76 2e-13
gi|19112005|ref|NP_595213.1| 40s ribosomal protein S29 [Schizosa... 71 6e-12
gi|50405062|ref|YP_054154.1| 40S ribosomal protein S29, putative... 70 2e-11
gi|24645517|ref|NP_731407.1| CG8495-PC [Drosophila melanogaster]... 63 2e-09
gi|25009774|gb|AAN71060.1| AT13329p [Drosophila melanogaster] 63 2e-09
gi|15678048|ref|NP_275162.1| ribosomal protein S29 (E.coli S14) ... 63 2e-09
gi|20094658|ref|NP_614505.1| Ribosomal protein S14 [Methanopyrus... 62 3e-09
gi|15669881|ref|NP_247445.1| SSU ribosomal protein S14P [Methano... 60 1e-08
gi|49258833|pdb|1S1H|N Chain N, Structure Of The Ribosomal 80s-E... 59 3e-08
gi|133780|sp|P14041|RS14_METVA 30S RIBOSOMAL PROTEIN S14P >gnl|B... 59 4e-08
gi|11499495|ref|NP_070736.1| SSU ribosomal protein S14P (rps14P)... 58 7e-08
gi|45358976|ref|NP_988533.1| SSU ribosomal protein S14P [Methano... 57 1e-07
gi|41615021|ref|NP_963519.1| NEQ227 [Nanoarchaeum equitans Kin4-... 56 2e-07
gi|15920628|ref|NP_376297.1| 57aa long hypothetical 30S ribosoma... 56 2e-07
gi|15897610|ref|NP_342215.1| SSU ribosomal protein S14AB (rps14A... 55 4e-07
gi|19074090|ref|NP_584696.1| 40S RIBOSOMAL PROTEIN S29 [Encephal... 54 7e-07
gi|14520543|ref|NP_126018.1| SSU ribosomal protein S14P [Pyrococ... 54 9e-07
gi|29249383|gb|EAA40896.1| GLP_79_44835_45248 [Giardia lamblia A... 53 2e-06
gi|18978182|ref|NP_579539.1| SSU ribosomal protein S14P [Pyrococ... 53 2e-06
gi|14602186|ref|NP_147173.1| S ribosomal protein S14 [Aeropyrum ... 52 4e-06
gi|7388125|sp|O05635|RS14_SULAC 30S ribosomal protein S14P >gnl|... 52 5e-06
gi|18313094|ref|NP_559761.1| ribosomal protein S14 [Pyrobaculum ... 51 8e-06
gi|20089956|ref|NP_616031.1| ribosomal protein S14p [Methanosarc... 51 8e-06
gi|48838697|ref|ZP_00295637.1| COG0199: Ribosomal protein S14 [M... 51 8e-06
gi|13541170|ref|NP_110858.1| 30S ribosomal protein S14 [Thermopl... 50 1e-05
gi|21228240|ref|NP_634162.1| SSU ribosomal protein S14P [Methano... 50 1e-05
gi|48477726|ref|YP_023432.1| small subunit ribosomal protein S14... 50 2e-05
gi|16082259|ref|NP_394713.1| probable 30S ribosomal protein S14 ... 49 3e-05
gi|15790646|ref|NP_280470.1| 30S ribosomal protein S14P; Rps14p ... 48 7e-05
gi|3088344|dbj|BAA25827.1| ribosomal protein S29 [Homo sapiens] 47 1e-04
gi|133775|sp|P26816|RS14_HALMA 30S RIBOSOMAL PROTEIN S14P (HMAS1... 45 6e-04
gi|15896370|ref|NP_349719.1| Ribosomal protein S14 [Clostridium ... 36 0.20
gi|18311374|ref|NP_563308.1| 30S ribosomal protein S14 [Clostrid... 35 0.59
gi|41202717|ref|XP_372494.1| similar to chromosome 15 open readi... 34 1.0
gi|17541672|ref|NP_502254.1| nuclear Hormone Receptor (51.5 kD) ... 33 1.3
gi|10197997|gb|AAG15133.1| nuclear receptor NHR-43 [Caenorhabdit... 33 1.3
gi|49235638|ref|ZP_00329705.1| COG0199: Ribosomal protein S14 [M... 33 2.2
gi|23336514|ref|ZP_00121728.1| COG0199: Ribosomal protein S14 [B... 32 2.9
gi|30147721|ref|XP_060104.2| similar to RIKEN cDNA 5430400H23 [H... 32 3.8
gi|14211847|ref|NP_115940.1| G protein-coupled receptor 54; meta... 32 5.0
gi|14330413|emb|CAC40817.1| G protein-coupled receptor [Homo sap... 32 5.0
gi|48857567|ref|ZP_00311561.1| COG0199: Ribosomal protein S14 [C... 31 6.5
gi|47459083|ref|YP_015945.1| 30S ribosomal protein s14 [Mycoplas... 31 6.5
gi|9632147|ref|NP_048970.1| RPQT-like (9x) [Paramecium bursaria ... 31 6.5
gi|2231329|gb|AAB62000.1| bactinecin 11 [Ovis aries] 31 8.5
gi|23121312|ref|ZP_00103652.1| COG4953: Membrane carboxypeptidas... 31 8.5
gi|5139355|emb|CAB45523.1| Bac7.5 protein [Capra hircus] 31 8.5
gi|1705447|sp|P50415|BCT7_SHEEP Bactenecin 7 precursor (BAC7) >g... 31 8.5
gi|1890247|gb|AAB49713.1| 7.5 kDa bactinecin precursor [Ovis aries] 31 8.5
gi|46125607|ref|XP_387357.1| hypothetical protein FG07181.1 [Gib... 31 8.5
>gi|17554782|ref|NP_497263.1| ribosomal Protein, Small subunit
(rps-29) [Caenorhabditis elegans]
gi|14550328|gb|AAB52557.2| Ribosomal protein, small subunit protein
29 [Caenorhabditis elegans]
Length = 56
Score = 127 bits (320), Expect = 5e-29
Identities = 56/56 (100%), Positives = 56/56 (100%)
Frame = +1
Query: 1 MGFQNLWFSHPRKFGPGSRSCRVCAGHHGLIRKYGLDLCRRCFREQARDIGFKKLD 168
MGFQNLWFSHPRKFGPGSRSCRVCAGHHGLIRKYGLDLCRRCFREQARDIGFKKLD
Sbjct: 1 MGFQNLWFSHPRKFGPGSRSCRVCAGHHGLIRKYGLDLCRRCFREQARDIGFKKLD 56