Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= B0414_2
(906 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508667|ref|NP_491679.1| RuNT related (33.9 kD) (rnt-1) [Cae... 516 e-145
gi|7494935|pir||T15229 hypothetical protein B0414.2 - Caenorhabd... 468 e-131
gi|39595422|emb|CAE60460.1| Hypothetical protein CBG04068 [Caeno... 406 e-112
gi|33589634|gb|AAM51942.2| GH02614p [Drosophila melanogaster] 134 2e-30
gi|3348004|gb|AAC27765.1| runt [Drosophila simulans] >gnl|BL_ORD... 134 4e-30
gi|3348024|gb|AAC27775.1| runt [Drosophila simulans] 134 4e-30
gi|722345|gb|AAB52378.1| runt 134 4e-30
gi|24643559|ref|NP_523424.2| CG1849-PA [Drosophila melanogaster]... 134 4e-30
gi|3348034|gb|AAC27780.1| runt [Drosophila melanogaster] 134 4e-30
gi|3348026|gb|AAC27776.1| runt [Drosophila melanogaster] >gnl|BL... 134 4e-30
gi|3348032|gb|AAC27779.1| runt [Drosophila melanogaster] 134 4e-30
gi|3348028|gb|AAC27777.1| runt [Drosophila melanogaster] >gnl|BL... 134 4e-30
gi|3348042|gb|AAC27784.1| runt [Drosophila melanogaster] 134 4e-30
gi|47551189|ref|NP_999779.1| SpRunt-1 protein [Strongylocentrotu... 132 1e-29
gi|3378112|gb|AAC28443.1| HeRunt-1 [Heliocidaris erythrogramma] 131 2e-29
gi|134120|sp|P22814|RUNT_DROME Segmentation protein Runt >gnl|BL... 131 2e-29
gi|48098215|ref|XP_394013.1| similar to ENSANGP00000000623 [Apis... 131 2e-29
gi|48098219|ref|XP_394015.1| similar to ENSANGP00000014116 [Apis... 131 2e-29
gi|722347|gb|AAA91784.1| runt 130 4e-29
gi|48098217|ref|XP_394014.1| similar to ENSANGP00000000623 [Apis... 130 4e-29
gi|9789899|ref|NP_062706.1| runt related transcription factor 3;... 130 5e-29
gi|18426856|ref|NP_569109.1| Runt related transcription factor 3... 130 5e-29
gi|34335166|gb|AAN08565.1| runt protein [Branchiostoma lanceolatum] 130 5e-29
gi|15426512|gb|AAH13362.1| RUNX3 protein [Homo sapiens] 130 5e-29
gi|4757918|ref|NP_004341.1| runt-related transcription factor 3;... 130 5e-29
gi|1082204|pir||B55563 AML2a protein - human 130 5e-29
gi|34335170|gb|AAN08567.1| runt protein [Branchiostoma floridae] 130 5e-29
gi|37722081|gb|AAN65187.1| runt-like protein [Tetranychus urticae] 129 7e-29
gi|24643542|ref|NP_608398.1| CG15455-PA [Drosophila melanogaster... 129 1e-28
gi|7671524|emb|CAB89493.1| runt-1 protein [Cupiennius salei] 128 2e-28
gi|37142398|gb|AAQ88389.1| transcription factor Runx2a [Danio re... 128 2e-28
gi|47086321|ref|NP_998023.1| runt-related transcription factor 2... 128 2e-28
gi|17368460|sp|Q13950|RUN2_HUMAN Runt-related transcription fact... 128 2e-28
gi|34874765|ref|XP_346017.1| similar to PEBP2a1 protein [Rattus ... 128 2e-28
gi|2580612|gb|AAB82419.1| PEBP2alphaA major til-1 isoform [Mus m... 128 2e-28
gi|539914|pir||A48233 polyomavirus enhancer-binding protein 2 al... 128 2e-28
gi|11182388|dbj|BAB17903.1| runt-related transcription factor b ... 128 2e-28
gi|40254693|ref|NP_571679.2| runt-related transcription factor 3... 128 2e-28
gi|20806530|ref|NP_033950.1| runt related transcription factor 2... 128 2e-28
gi|17368427|sp|Q08775|RUN2_MOUSE Runt-related transcription fact... 128 2e-28
gi|11182390|dbj|BAB17904.1| runt-related transcription factor b ... 128 2e-28
gi|391769|dbj|BAA03486.1| PEBP2a2 protein [Mus musculus] 128 2e-28
gi|735898|gb|AAA89072.1| core-binding factor, runt domain, alpha... 128 2e-28
gi|10863885|ref|NP_004339.1| runt-related transcription factor 2... 128 2e-28
gi|47206482|emb|CAG12345.1| unnamed protein product [Tetraodon n... 127 3e-28
gi|24158594|pdb|1EAN|A Chain A, The Runx1 Runt Domain At 1.25a R... 127 3e-28
gi|24640810|ref|NP_511099.2| CG1689-PA [Drosophila melanogaster]... 127 3e-28
gi|4713925|gb|AAC47196.2| Lozenge [Drosophila melanogaster] 127 3e-28
gi|17149215|gb|AAL35944.1| transcription factor RUNX2/CBFA1 [Gal... 127 3e-28
gi|45383854|ref|NP_989459.1| runt-related transcription factor 2... 127 3e-28
gi|47086313|ref|NP_998027.1| runt-related transcription factor 2... 127 3e-28
gi|34784676|gb|AAH57739.1| MGC69003 protein [Xenopus laevis] 127 3e-28
gi|39598911|gb|AAR28999.1| transcription factor Runx2b P1 isofor... 127 3e-28
gi|6730183|pdb|1CMO|A Chain A, Immunoglobulin Motif Dna-Recognit... 127 3e-28
gi|2981317|gb|AAC41269.1| Xaml [Xenopus laevis] 127 4e-28
gi|22531375|emb|CAD44571.1| runt protein 1b [Pacifastacus lenius... 127 4e-28
gi|22531373|emb|CAD44570.1| runt protein 1a [Pacifastacus lenius... 127 4e-28
gi|31210893|ref|XP_314413.1| ENSANGP00000000623 [Anopheles gambi... 127 4e-28
gi|18859331|ref|NP_571678.1| runt-related transcription factor 1... 127 4e-28
gi|24158597|pdb|1EAQ|A Chain A, The Runx1 Runt Domain At 1.25a R... 126 8e-28
gi|1172254|gb|AAB35729.1| AML1/MDS1(AML1, MDS1) {translocation b... 125 1e-27
gi|400341|gb|AAA03086.1| AML1/EAP 125 1e-27
gi|105206|pir||A39998 transcription factor CBF alpha 2, splice f... 125 1e-27
gi|1172253|gb|AAB35728.1| AML1/EAP(EAP, AML1) {translocation bre... 125 1e-27
gi|19923198|ref|NP_001745.2| runt-related transcription factor 1... 125 1e-27
gi|1085284|pir||S41704 AML1 protein - human 125 1e-27
gi|26342190|dbj|BAC34757.1| unnamed protein product [Mus musculus] 125 1e-27
gi|557639|emb|CAA56092.1| acute myeloid leukemia gene no 1 [Homo... 125 1e-27
gi|8392900|ref|NP_059021.1| runt related transcription factor 1;... 125 1e-27
gi|49574546|ref|NP_001001890.1| runt-related transcription facto... 125 1e-27
gi|2506974|sp|Q01196|RUN1_HUMAN Runt-related transcription facto... 125 1e-27
gi|6753298|ref|NP_033951.1| runt related transcription factor 1;... 125 1e-27
gi|38112666|gb|AAR11381.1| transcription factor Runx3 [Raja egla... 125 1e-27
gi|407727|dbj|BAA03089.1| AML1-MTG8 fusion protein [Homo sapiens] 125 1e-27
gi|631030|pir||S47469 Runt protein homolog isoform B - chicken 125 1e-27
gi|45382567|ref|NP_990558.1| ch-runtB2 [Gallus gallus] >gnl|BL_O... 125 1e-27
gi|545408|gb|AAB29907.1| AML1-EVI-1 fusion protein [Homo sapiens] 125 1e-27
gi|12082791|gb|AAG48615.1| AML1/AMP19 fusion protein [Homo sapiens] 125 1e-27
gi|10765095|gb|AAF97984.2| AML1/AMP19 fusion protein [Homo sapiens] 125 1e-27
gi|47124133|gb|AAH69929.1| Runx1 protein [Mus musculus] 125 1e-27
gi|16303808|gb|AAL16813.1| AML1/USP25 fusion protein [Homo sapiens] 125 1e-27
gi|2498127|sp|Q03347|RUN1_MOUSE Runt-related transcription facto... 125 1e-27
gi|12082789|gb|AAG48614.1| AML1/AMP19 fusion protein [Homo sapiens] 125 1e-27
gi|13786789|pdb|1H9D|A Chain A, Aml1CBF-BetaDNA COMPLEX >gnl|BL_... 125 1e-27
gi|24987616|pdb|1LJM|A Chain A, Dna Recognition Is Mediated By C... 125 1e-27
gi|11559275|dbj|BAB18764.1| core binding factor alpha1 subunit p... 125 1e-27
gi|13787146|pdb|1IO4|C Chain C, Crystal Structure Of Runx-1AML1C... 125 1e-27
gi|21667344|gb|AAM74030.1| transcription factor runx2 [Takifugu ... 125 1e-27
gi|23507172|gb|AAN38000.1| transcription factor Cbfa1 [Tetraodon... 125 1e-27
gi|3901266|gb|AAC78626.1| Cbfa1/Osf2 transcription factor isofor... 125 2e-27
gi|45478484|gb|AAS66454.1| runt-related transcription factor 2 [... 125 2e-27
gi|24643548|ref|NP_608401.1| CG1379-PA [Drosophila melanogaster]... 125 2e-27
gi|31230110|ref|XP_318339.1| ENSANGP00000014116 [Anopheles gambi... 124 2e-27
gi|48098221|ref|XP_394016.1| similar to CG1689-PA [Apis mellifera] 124 2e-27
gi|47219563|emb|CAG09917.1| unnamed protein product [Tetraodon n... 124 3e-27
gi|11641118|gb|AAG38239.1| core binding factor alpha 1 [Gallus g... 124 4e-27
gi|8569246|pdb|1CO1|A Chain A, Fold Of The Cbfa 124 4e-27
gi|38230700|gb|AAR14314.1| transcription factor Runx2 [Raja egla... 123 6e-27
gi|31206933|ref|XP_312433.1| ENSANGP00000022044 [Anopheles gambi... 122 1e-26
gi|47224736|emb|CAG00330.1| unnamed protein product [Tetraodon n... 114 3e-24
gi|7671526|emb|CAB89494.1| runt-2 protein [Cupiennius salei] 107 3e-22
gi|21362910|sp||Q9Z2J9_2 [Segment 2 of 2] Runt-related transcrip... 104 3e-21
gi|3514107|gb|AAC34127.1| core binding factor alpha 3 subunit [M... 102 1e-20
gi|38079315|ref|XP_355559.1| similar to transcription factor AML... 97 6e-19
gi|1752817|dbj|BAA14020.1| AML1 [Homo sapiens] >gnl|BL_ORD_ID|10... 86 1e-15
gi|34925143|sp|Q25520|RUNT_MANSE Segmentation protein Runt >gnl|... 86 1e-15
gi|1363250|pir||A56843 transcription factor Cbfa3 - mouse (fragm... 67 7e-10
gi|41349753|dbj|BAD08306.1| core binding factor alpha1 subunit t... 55 2e-06
gi|41349751|dbj|BAD08305.1| core binding factor alpha1 subunit t... 55 2e-06
gi|2134750|pir||I54076 acute myeloid leukemia 1 protein AML1 - h... 52 2e-05
gi|2134751|pir||I68188 acute myeloid leukemia 1 protein AML1 - h... 52 2e-05
gi|29569960|gb|AAO84961.1| runt [Drosophila miranda] >gnl|BL_ORD... 47 6e-04
gi|29569970|gb|AAO84966.1| runt [Drosophila miranda] 47 6e-04
gi|50759928|ref|XP_425774.1| PREDICTED: similar to Runt-related ... 44 0.005
gi|38079312|ref|XP_357440.1| similar to Runt related transcripti... 41 0.032
gi|39582682|emb|CAE73786.1| Hypothetical protein CBG21336 [Caeno... 38 0.36
gi|471122|dbj|BAA03560.1| chimeric protein [Homo sapiens] 37 0.46
gi|471123|dbj|BAA03559.1| chimeric protein [Homo sapiens] 37 0.46
gi|34854507|ref|XP_341782.1| similar to B430201G11Rik protein [R... 35 1.8
gi|1363249|pir||A56842 transcription factor Cbfa3 - mouse (fragm... 35 1.8
gi|39578758|emb|CAE57148.1| Hypothetical protein CBG25081 [Caeno... 35 1.8
gi|38108474|gb|EAA54484.1| hypothetical protein MG02469.4 [Magna... 35 2.3
gi|1934954|emb|CAA65976.1| CBFA2 [Mus musculus] 35 2.3
gi|27377893|ref|NP_769422.1| bsl2782 [Bradyrhizobium japonicum U... 34 3.9
gi|34853781|ref|XP_341758.1| similar to PARK2 co-regulated; park... 34 5.1
gi|27378825|ref|NP_770354.1| bll3714 [Bradyrhizobium japonicum U... 34 5.1
gi|23489933|gb|EAA21825.1| unnamed protein product-related [Plas... 29 5.9
gi|25407966|pir||E84682 hypothetical protein At2g28240 [imported... 33 6.7
gi|42569409|ref|NP_180391.2| hydroxyproline-rich glycoprotein fa... 33 6.7
gi|50747286|ref|XP_420820.1| PREDICTED: similar to regulator of ... 33 6.7
gi|15237201|ref|NP_197697.1| expressed protein [Arabidopsis thal... 33 8.8
gi|28839555|gb|AAH47798.1| Zgc:55983 protein [Danio rerio] 33 8.8
gi|28850398|gb|AAO53167.1| similar to Homo sapiens (Human). KIAA... 33 8.8
gi|50418339|gb|AAH77994.1| Unknown (protein for MGC:82339) [Xeno... 33 8.8
>gi|17508667|ref|NP_491679.1| RuNT related (33.9 kD) (rnt-1)
[Caenorhabditis elegans]
gi|7511590|pir||T37326 probable transcription factor rnt-1 -
Caenorhabditis elegans
gi|4877406|dbj|BAA77765.1| RNT-1 [Caenorhabditis elegans]
gi|5880861|gb|AAD54940.1| transcription factor RUN [Caenorhabditis
elegans]
gi|6671807|gb|AAB57715.2| Runt related protein 1 [Caenorhabditis
elegans]
Length = 301
Score = 516 bits (1328), Expect = e-145
Identities = 261/280 (93%), Positives = 261/280 (93%)
Frame = +1
Query: 1 MTNVFHHVRNFIEQQPAPAKTLEKSSSPNILYTALPKHWRSNKSFQEPFYVVLLTPVPDN 180
MTNVFHHVRNFIEQQPAPAKTLEKSSSPNILYTALPKHWRSNKSFQEPFYVVLLTPVPDN
Sbjct: 1 MTNVFHHVRNFIEQQPAPAKTLEKSSSPNILYTALPKHWRSNKSFQEPFYVVLLTPVPDN 60
Query: 181 TEVSIWAGNDEKPCEEVRNEKAKVHRQVAKFNDLRFVGRSGRGRKFHLTIVIHSAPMMVA 360
TEVSIWAGNDEKPCEEVRNEKAKVHRQVAKFNDLRFVGRSGRGRKFHLTIVIHSAPMMVA
Sbjct: 61 TEVSIWAGNDEKPCEEVRNEKAKVHRQVAKFNDLRFVGRSGRGRKFHLTIVIHSAPMMVA 120
Query: 361 TVKNVIKVTVDGPRDARIPKPQGSLKRQAEQQTIFPNDIIRTXXXXXXXXXXXXXXXXXX 540
TVKNVIKVTVDGPRDARIPKPQGSLKRQAEQQTIFPNDIIRT
Sbjct: 121 TVKNVIKVTVDGPRDARIPKPQGSLKRQAEQQTIFPNDIIRTPGPPMPMTMIPPPWFPLP 180
Query: 541 XTQTFPPSFFPLISPGPHPSISAALWKIHSESMKTPIKQKVEQENVSLNTSTCLSSPSIF 720
TQTFPPSFFPLISPGPHPSISAALWKIHSESMKTPIKQKVEQENVSLNTSTCLSSPSIF
Sbjct: 181 MTQTFPPSFFPLISPGPHPSISAALWKIHSESMKTPIKQKVEQENVSLNTSTCLSSPSIF 240
Query: 721 ITPTSDDRKLKRPSSPRSITKSSETSINLIQETPESVESK 840
ITPTSDDRKLKRPSSPRSITKSSETSINLIQETPESVESK
Sbjct: 241 ITPTSDDRKLKRPSSPRSITKSSETSINLIQETPESVESK 280