Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= B0432_13
         (558 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17531337|ref|NP_493698.1| c-type lectin precursor family memb...   403   e-111
gi|17540466|ref|NP_500450.1| c-type lectin family member (65.9 k...   123   2e-27
gi|39583020|emb|CAE71799.1| Hypothetical protein CBG18810 [Caeno...   114   2e-24
gi|17543488|ref|NP_500445.1| c-type lectin family member (65.9 k...   112   3e-24
gi|17541836|ref|NP_500560.1| c-type lectin precursor family memb...    69   6e-11
gi|32452984|gb|AAC48075.2| Hypothetical protein R08C7.6 [Caenorh...    69   6e-11
gi|17536959|ref|NP_494450.1| c-type lectin precursor family memb...    67   2e-10
gi|17553032|ref|NP_497944.1| predicted CDS, c-type lectin family...    62   5e-09
gi|17554888|ref|NP_497956.1| predicted CDS, c-type lectin family...    59   6e-08
gi|17553034|ref|NP_497946.1| c-type lectin precursor family memb...    56   4e-07
gi|39587766|emb|CAE67784.1| Hypothetical protein CBG13360 [Caeno...    55   6e-07
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae...    53   4e-06
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)...    52   5e-06
gi|37619781|emb|CAA84655.3| Hypothetical protein F10F2.5 [Caenor...    52   7e-06
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno...    52   9e-06
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb...    50   2e-05
gi|17553028|ref|NP_497947.1| putative protein family member (3F7...    49   5e-05
gi|17553030|ref|NP_497945.1| c-type lectin family member (3F723)...    49   6e-05
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno...    49   8e-05
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor...    48   1e-04
gi|39587765|emb|CAE67783.1| Hypothetical protein CBG13359 [Caeno...    48   1e-04
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab...    48   1e-04
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ...    48   1e-04
gi|17536719|ref|NP_493771.1| c-type lectin family member (2A900)...    47   2e-04
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ...    47   2e-04
gi|39583019|emb|CAE71798.1| Hypothetical protein CBG18809 [Caeno...    46   4e-04
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family...    45   7e-04
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi...    45   7e-04
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family...    44   0.002
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6...    44   0.002
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family...    42   0.006
gi|6912282|ref|NP_036204.1| complement component 1, q subcompone...    42   0.007
gi|21759074|sp|Q9NPY3|CD93_HUMAN Complement component C1q recept...    42   0.007
gi|24421055|emb|CAC82720.1| C1q receptor protein [Homo sapiens]        42   0.007
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno...    42   0.007
gi|48097396|ref|XP_393774.1| similar to CG9134-PB [Apis mellifera]     42   0.007
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ...    42   0.009
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)...    42   0.009
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur...    41   0.012
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae...    41   0.012
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb...    41   0.012
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur...    41   0.016
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family...    41   0.016
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb...    40   0.021
gi|24655071|ref|NP_728586.1| CG9134-PA [Drosophila melanogaster]...    40   0.021
gi|24655067|ref|NP_612091.1| CG9134-PB [Drosophila melanogaster]...    40   0.021
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k...    40   0.036
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb...    40   0.036
gi|39591912|emb|CAE75132.1| Hypothetical protein CBG23060 [Caeno...    40   0.036
gi|47208698|emb|CAF89942.1| unnamed protein product [Tetraodon n...    39   0.047
gi|39580171|emb|CAE56379.1| Hypothetical protein CBG24059 [Caeno...    39   0.062
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb...    39   0.080
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family...    38   0.10
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno...    38   0.14
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family...    38   0.14
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb...    38   0.14
gi|28573526|ref|NP_788395.1| CG33006-PE [Drosophila melanogaster...    37   0.18
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno...    37   0.18
gi|1902921|dbj|BAA18917.1| lectin-related protein [Periplaneta a...    37   0.18
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family...    37   0.18
gi|31198961|ref|XP_308428.1| ENSANGP00000017928 [Anopheles gambi...    37   0.31
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]...    37   0.31
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus]                      37   0.31
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur...    37   0.31
gi|1902929|dbj|BAA18919.1| similar to LPS-binding protein [Perip...    36   0.40
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb...    36   0.40
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno...    36   0.40
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa]            36   0.52
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h...    36   0.52
gi|31212723|ref|XP_315346.1| ENSANGP00000020938 [Anopheles gambi...    35   0.68
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb...    35   0.68
gi|39591271|emb|CAE73324.1| Hypothetical protein CBG20753 [Caeno...    35   0.89
gi|17562684|ref|NP_507837.1| putative protein family member (5U2...    35   0.89
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa...    35   0.89
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb...    35   0.89
gi|17506689|ref|NP_493310.1| putative protein family member (1N7...    35   0.89
gi|31208841|ref|XP_313387.1| ENSANGP00000011890 [Anopheles gambi...    35   1.2
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family...    35   1.2
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ...    35   1.2
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno...    35   1.2
gi|17539326|ref|NP_503090.1| versican family member, possibly N-...    35   1.2
gi|16923244|gb|AAL29937.1| scarf1 [Girardia tigrina]                   35   1.2
gi|47778940|ref|NP_775806.2| C-type lectin, superfamily member 1...    35   1.2
gi|31198959|ref|XP_308427.1| ENSANGP00000018514 [Anopheles gambi...    35   1.2
gi|16758588|ref|NP_446205.1| C-type lectin, superfamily member 1...    35   1.2
gi|21755922|dbj|BAC04786.1| unnamed protein product [Homo sapiens]     35   1.2
gi|34098769|sp|Q9YGG9|MMHA_AGKHA Mamushigin alpha chain precurso...    35   1.2
gi|50750175|ref|XP_426556.1| PREDICTED: similar to feather beta ...    34   1.5
gi|126121|sp|P05047|LECA_SARPE Lectin, alpha subunit precursor >...    34   1.5
gi|18857993|ref|NP_572491.1| CG12111-PA [Drosophila melanogaster...    34   1.5
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f...    34   1.5
gi|39597703|emb|CAE68394.1| Hypothetical protein CBG14163 [Caeno...    34   2.0
gi|1902919|dbj|BAA18916.1| lectin-related protein [Periplaneta a...    34   2.0
gi|47230594|emb|CAF99787.1| unnamed protein product [Tetraodon n...    34   2.0
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica]        34   2.0
gi|47226570|emb|CAG08586.1| unnamed protein product [Tetraodon n...    34   2.0
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas...    34   2.0
gi|31560464|ref|NP_058031.2| C-type lectin, superfamily member 1...    34   2.0
gi|2497642|sp|P70194|KUCR_MOUSE C-type lectin 13 (Kupffer cell r...    34   2.0
gi|22024114|ref|NP_610685.2| CG7763-PA [Drosophila melanogaster]...    34   2.0
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ...    33   2.6
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n...    33   2.6
gi|16758114|ref|NP_445835.1| lymphocyte antigen 68 [Rattus norve...    33   2.6
gi|21541989|sp|Q9ET61|CD93_RAT Complement component C1q receptor...    33   2.6
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica]        33   2.6
gi|24585211|ref|NP_609962.1| CG9978-PA [Drosophila melanogaster]...    33   2.6
gi|17537259|ref|NP_496854.1| agkisacutacin like (2N882) [Caenorh...    33   2.6
gi|38422761|emb|CAE54926.1| Hypothetical protein Y48E1B.16 [Caen...    33   2.6
gi|38422762|emb|CAB07697.2| Hypothetical protein Y48E1B.9 [Caeno...    33   3.4
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;...    33   3.4
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno...    33   3.4
gi|10120636|pdb|1EGG|A Chain A, Structure Of A C-Type Carbohydra...    33   3.4
gi|50304603|ref|XP_452257.1| unnamed protein product [Kluyveromy...    33   3.4
gi|16923236|gb|AAL29939.1| scarf3a [Girardia tigrina]                  33   4.4
gi|29833652|ref|NP_828286.1| putative secreted tripeptidylaminop...    33   4.4
gi|38503140|sp|Q95LG1|LEM2_HORSE E-selectin precursor (Endotheli...    33   4.4
gi|45580692|ref|NP_987099.1| C-type lectin, superfamily member 7...    33   4.4
gi|554190|gb|AAA75651.1| lymphocyte homing receptor                    33   4.4
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb...    33   4.4
gi|691753|dbj|BAA06444.1| phospholipase A2 receptor [Homo sapiens]     33   4.4
gi|5835693|ref|NP_008509.1|ND1_15044 NADH dehydrogenase subunit ...    33   4.4
gi|6755454|ref|NP_035476.1| selectin, lymphocyte [Mus musculus] ...    33   4.4
gi|37181558|gb|AAQ88590.1| CLECSF11 [Homo sapiens]                     33   4.4
gi|18466806|ref|NP_569708.1| C-type lectin, superfamily member 7...    33   4.4
gi|4090874|gb|AAD09286.1| putative lectin [Hyphantria cunea]           33   4.4
gi|1655437|dbj|BAA13567.1| TC14-1 [Polyandrocarpa misakiensis]         32   5.8
gi|35191217|ref|XP_354420.1| OJ1484_G09.29 [Oryza sativa (japoni...    32   5.8
gi|5381155|dbj|BAA82265.1| Regenectin [Periplaneta americana]          32   5.8
gi|10641056|dbj|BAB16304.1| C-type lectin TC14-1 [Polyandrocarpa...    32   5.8
gi|6754578|ref|NP_034870.1| complement component 1, q subcompone...    32   5.8
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu...    32   5.8
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s...    32   5.8
gi|126126|sp|P16108|LECC_POLMI Lectin >gnl|BL_ORD_ID|951175 gi|1...    32   5.8
gi|17536121|ref|NP_494002.1| predicted CDS, tolloid-like family ...    32   7.5
gi|126181|sp|P27113|LEM2_RABIT E-selectin precursor (Endothelial...    32   7.5
gi|2136974|pir||I46709 endothelial leukocyte adhesion molecule 1...    32   7.5
gi|39590319|emb|CAE66058.1| Hypothetical protein CBG11271 [Caeno...    32   7.5
gi|10641064|dbj|BAB16306.1| C-type lectin TC14-3 [Polyandrocarpa...    32   7.5
gi|34146974|gb|AAQ62451.1| Guanylyl cyclase protein 7, isoform b...    32   7.5
gi|1902923|dbj|BAA18918.1| lectin-related protein [Periplaneta a...    32   7.5
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|...    32   7.5
gi|22958663|ref|ZP_00006330.1| COG3552: Protein containing von W...    32   7.5
gi|34146973|gb|AAQ62450.1| Guanylyl cyclase protein 7, isoform a...    32   7.5
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam...    32   7.5
gi|17561796|ref|NP_505166.1| guanylyl cyclase (gcy-7) [Caenorhab...    32   7.5
gi|17553738|ref|NP_499125.1| reverse transcriptase like family m...    32   9.8
gi|16923238|gb|AAL29935.1| scarf3b [Girardia tigrina]                  32   9.8
gi|1902915|dbj|BAA18914.1| lectin-related protein [Periplaneta a...    32   9.8
gi|50507459|emb|CAA80162.2| Hypothetical protein F58A4.5 [Caenor...    32   9.8
gi|2134245|pir||JC5059 bitiscetin beta chain - puff adder >gnl|B...    32   9.8
gi|16923242|gb|AAL29943.1| scarf2a [Girardia tigrina]                  32   9.8
gi|4337052|gb|AAD18056.1| fibrinogen clotting inhibitor B chain ...    32   9.8
gi|47209097|emb|CAF91609.1| unnamed protein product [Tetraodon n...    32   9.8
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8...    32   9.8
gi|18307446|emb|CAA91440.2| C-type lectin-like protein [Girardia...    32   9.8
gi|16923234|gb|AAL29933.1| scarf2 [Girardia tigrina]                   32   9.8
gi|126449|sp|P26305|LPSB_PERAM Hemolymph lipopolysaccharide-bind...    32   9.8


>gi|17531337|ref|NP_493698.1| c-type lectin precursor family member
           (2A586) [Caenorhabditis elegans]
 gi|7494943|pir||T25463 hypothetical protein B0432.12 -
           Caenorhabditis elegans
 gi|1707145|gb|AAB37896.1| Hypothetical protein B0432.12
           [Caenorhabditis elegans]
          Length = 185

 Score =  403 bits (1036), Expect = e-111
 Identities = 185/185 (100%), Positives = 185/185 (100%)
 Frame = -1

Query: 558 MLKALLPLLLWISTGSTAPAGVATYLRSNGIVAFHKLYHLKMNFPRAKKHCEQNGAHLAG 379
           MLKALLPLLLWISTGSTAPAGVATYLRSNGIVAFHKLYHLKMNFPRAKKHCEQNGAHLAG
Sbjct: 1   MLKALLPLLLWISTGSTAPAGVATYLRSNGIVAFHKLYHLKMNFPRAKKHCEQNGAHLAG 60

Query: 378 ITSREEAQKLIDLANEAGESNEQYWLGGQRKGECYGMRNYDKDHGLNATCSLSNVVQWLD 199
           ITSREEAQKLIDLANEAGESNEQYWLGGQRKGECYGMRNYDKDHGLNATCSLSNVVQWLD
Sbjct: 61  ITSREEAQKLIDLANEAGESNEQYWLGGQRKGECYGMRNYDKDHGLNATCSLSNVVQWLD 120

Query: 198 NVAETIDPDWWKIPGPSHIPFNMPQQCLSFVHGDRDWTTPNDPGFLDDIGCDVPRKFFCT 19
           NVAETIDPDWWKIPGPSHIPFNMPQQCLSFVHGDRDWTTPNDPGFLDDIGCDVPRKFFCT
Sbjct: 121 NVAETIDPDWWKIPGPSHIPFNMPQQCLSFVHGDRDWTTPNDPGFLDDIGCDVPRKFFCT 180

Query: 18  ELHEW 4
           ELHEW
Sbjct: 181 ELHEW 185




[DB home][top]