Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= B0432_13
(558 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531337|ref|NP_493698.1| c-type lectin precursor family memb... 403 e-111
gi|17540466|ref|NP_500450.1| c-type lectin family member (65.9 k... 123 2e-27
gi|39583020|emb|CAE71799.1| Hypothetical protein CBG18810 [Caeno... 114 2e-24
gi|17543488|ref|NP_500445.1| c-type lectin family member (65.9 k... 112 3e-24
gi|17541836|ref|NP_500560.1| c-type lectin precursor family memb... 69 6e-11
gi|32452984|gb|AAC48075.2| Hypothetical protein R08C7.6 [Caenorh... 69 6e-11
gi|17536959|ref|NP_494450.1| c-type lectin precursor family memb... 67 2e-10
gi|17553032|ref|NP_497944.1| predicted CDS, c-type lectin family... 62 5e-09
gi|17554888|ref|NP_497956.1| predicted CDS, c-type lectin family... 59 6e-08
gi|17553034|ref|NP_497946.1| c-type lectin precursor family memb... 56 4e-07
gi|39587766|emb|CAE67784.1| Hypothetical protein CBG13360 [Caeno... 55 6e-07
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae... 53 4e-06
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)... 52 5e-06
gi|37619781|emb|CAA84655.3| Hypothetical protein F10F2.5 [Caenor... 52 7e-06
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno... 52 9e-06
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb... 50 2e-05
gi|17553028|ref|NP_497947.1| putative protein family member (3F7... 49 5e-05
gi|17553030|ref|NP_497945.1| c-type lectin family member (3F723)... 49 6e-05
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno... 49 8e-05
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor... 48 1e-04
gi|39587765|emb|CAE67783.1| Hypothetical protein CBG13359 [Caeno... 48 1e-04
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab... 48 1e-04
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ... 48 1e-04
gi|17536719|ref|NP_493771.1| c-type lectin family member (2A900)... 47 2e-04
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ... 47 2e-04
gi|39583019|emb|CAE71798.1| Hypothetical protein CBG18809 [Caeno... 46 4e-04
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family... 45 7e-04
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi... 45 7e-04
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family... 44 0.002
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6... 44 0.002
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family... 42 0.006
gi|6912282|ref|NP_036204.1| complement component 1, q subcompone... 42 0.007
gi|21759074|sp|Q9NPY3|CD93_HUMAN Complement component C1q recept... 42 0.007
gi|24421055|emb|CAC82720.1| C1q receptor protein [Homo sapiens] 42 0.007
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno... 42 0.007
gi|48097396|ref|XP_393774.1| similar to CG9134-PB [Apis mellifera] 42 0.007
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ... 42 0.009
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)... 42 0.009
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur... 41 0.012
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae... 41 0.012
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb... 41 0.012
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur... 41 0.016
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family... 41 0.016
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb... 40 0.021
gi|24655071|ref|NP_728586.1| CG9134-PA [Drosophila melanogaster]... 40 0.021
gi|24655067|ref|NP_612091.1| CG9134-PB [Drosophila melanogaster]... 40 0.021
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k... 40 0.036
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb... 40 0.036
gi|39591912|emb|CAE75132.1| Hypothetical protein CBG23060 [Caeno... 40 0.036
gi|47208698|emb|CAF89942.1| unnamed protein product [Tetraodon n... 39 0.047
gi|39580171|emb|CAE56379.1| Hypothetical protein CBG24059 [Caeno... 39 0.062
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb... 39 0.080
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family... 38 0.10
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno... 38 0.14
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family... 38 0.14
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb... 38 0.14
gi|28573526|ref|NP_788395.1| CG33006-PE [Drosophila melanogaster... 37 0.18
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno... 37 0.18
gi|1902921|dbj|BAA18917.1| lectin-related protein [Periplaneta a... 37 0.18
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family... 37 0.18
gi|31198961|ref|XP_308428.1| ENSANGP00000017928 [Anopheles gambi... 37 0.31
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]... 37 0.31
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus] 37 0.31
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur... 37 0.31
gi|1902929|dbj|BAA18919.1| similar to LPS-binding protein [Perip... 36 0.40
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb... 36 0.40
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno... 36 0.40
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa] 36 0.52
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h... 36 0.52
gi|31212723|ref|XP_315346.1| ENSANGP00000020938 [Anopheles gambi... 35 0.68
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 35 0.68
gi|39591271|emb|CAE73324.1| Hypothetical protein CBG20753 [Caeno... 35 0.89
gi|17562684|ref|NP_507837.1| putative protein family member (5U2... 35 0.89
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa... 35 0.89
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb... 35 0.89
gi|17506689|ref|NP_493310.1| putative protein family member (1N7... 35 0.89
gi|31208841|ref|XP_313387.1| ENSANGP00000011890 [Anopheles gambi... 35 1.2
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family... 35 1.2
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ... 35 1.2
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno... 35 1.2
gi|17539326|ref|NP_503090.1| versican family member, possibly N-... 35 1.2
gi|16923244|gb|AAL29937.1| scarf1 [Girardia tigrina] 35 1.2
gi|47778940|ref|NP_775806.2| C-type lectin, superfamily member 1... 35 1.2
gi|31198959|ref|XP_308427.1| ENSANGP00000018514 [Anopheles gambi... 35 1.2
gi|16758588|ref|NP_446205.1| C-type lectin, superfamily member 1... 35 1.2
gi|21755922|dbj|BAC04786.1| unnamed protein product [Homo sapiens] 35 1.2
gi|34098769|sp|Q9YGG9|MMHA_AGKHA Mamushigin alpha chain precurso... 35 1.2
gi|50750175|ref|XP_426556.1| PREDICTED: similar to feather beta ... 34 1.5
gi|126121|sp|P05047|LECA_SARPE Lectin, alpha subunit precursor >... 34 1.5
gi|18857993|ref|NP_572491.1| CG12111-PA [Drosophila melanogaster... 34 1.5
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f... 34 1.5
gi|39597703|emb|CAE68394.1| Hypothetical protein CBG14163 [Caeno... 34 2.0
gi|1902919|dbj|BAA18916.1| lectin-related protein [Periplaneta a... 34 2.0
gi|47230594|emb|CAF99787.1| unnamed protein product [Tetraodon n... 34 2.0
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica] 34 2.0
gi|47226570|emb|CAG08586.1| unnamed protein product [Tetraodon n... 34 2.0
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas... 34 2.0
gi|31560464|ref|NP_058031.2| C-type lectin, superfamily member 1... 34 2.0
gi|2497642|sp|P70194|KUCR_MOUSE C-type lectin 13 (Kupffer cell r... 34 2.0
gi|22024114|ref|NP_610685.2| CG7763-PA [Drosophila melanogaster]... 34 2.0
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ... 33 2.6
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n... 33 2.6
gi|16758114|ref|NP_445835.1| lymphocyte antigen 68 [Rattus norve... 33 2.6
gi|21541989|sp|Q9ET61|CD93_RAT Complement component C1q receptor... 33 2.6
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica] 33 2.6
gi|24585211|ref|NP_609962.1| CG9978-PA [Drosophila melanogaster]... 33 2.6
gi|17537259|ref|NP_496854.1| agkisacutacin like (2N882) [Caenorh... 33 2.6
gi|38422761|emb|CAE54926.1| Hypothetical protein Y48E1B.16 [Caen... 33 2.6
gi|38422762|emb|CAB07697.2| Hypothetical protein Y48E1B.9 [Caeno... 33 3.4
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;... 33 3.4
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno... 33 3.4
gi|10120636|pdb|1EGG|A Chain A, Structure Of A C-Type Carbohydra... 33 3.4
gi|50304603|ref|XP_452257.1| unnamed protein product [Kluyveromy... 33 3.4
gi|16923236|gb|AAL29939.1| scarf3a [Girardia tigrina] 33 4.4
gi|29833652|ref|NP_828286.1| putative secreted tripeptidylaminop... 33 4.4
gi|38503140|sp|Q95LG1|LEM2_HORSE E-selectin precursor (Endotheli... 33 4.4
gi|45580692|ref|NP_987099.1| C-type lectin, superfamily member 7... 33 4.4
gi|554190|gb|AAA75651.1| lymphocyte homing receptor 33 4.4
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb... 33 4.4
gi|691753|dbj|BAA06444.1| phospholipase A2 receptor [Homo sapiens] 33 4.4
gi|5835693|ref|NP_008509.1|ND1_15044 NADH dehydrogenase subunit ... 33 4.4
gi|6755454|ref|NP_035476.1| selectin, lymphocyte [Mus musculus] ... 33 4.4
gi|37181558|gb|AAQ88590.1| CLECSF11 [Homo sapiens] 33 4.4
gi|18466806|ref|NP_569708.1| C-type lectin, superfamily member 7... 33 4.4
gi|4090874|gb|AAD09286.1| putative lectin [Hyphantria cunea] 33 4.4
gi|1655437|dbj|BAA13567.1| TC14-1 [Polyandrocarpa misakiensis] 32 5.8
gi|35191217|ref|XP_354420.1| OJ1484_G09.29 [Oryza sativa (japoni... 32 5.8
gi|5381155|dbj|BAA82265.1| Regenectin [Periplaneta americana] 32 5.8
gi|10641056|dbj|BAB16304.1| C-type lectin TC14-1 [Polyandrocarpa... 32 5.8
gi|6754578|ref|NP_034870.1| complement component 1, q subcompone... 32 5.8
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu... 32 5.8
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s... 32 5.8
gi|126126|sp|P16108|LECC_POLMI Lectin >gnl|BL_ORD_ID|951175 gi|1... 32 5.8
gi|17536121|ref|NP_494002.1| predicted CDS, tolloid-like family ... 32 7.5
gi|126181|sp|P27113|LEM2_RABIT E-selectin precursor (Endothelial... 32 7.5
gi|2136974|pir||I46709 endothelial leukocyte adhesion molecule 1... 32 7.5
gi|39590319|emb|CAE66058.1| Hypothetical protein CBG11271 [Caeno... 32 7.5
gi|10641064|dbj|BAB16306.1| C-type lectin TC14-3 [Polyandrocarpa... 32 7.5
gi|34146974|gb|AAQ62451.1| Guanylyl cyclase protein 7, isoform b... 32 7.5
gi|1902923|dbj|BAA18918.1| lectin-related protein [Periplaneta a... 32 7.5
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|... 32 7.5
gi|22958663|ref|ZP_00006330.1| COG3552: Protein containing von W... 32 7.5
gi|34146973|gb|AAQ62450.1| Guanylyl cyclase protein 7, isoform a... 32 7.5
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam... 32 7.5
gi|17561796|ref|NP_505166.1| guanylyl cyclase (gcy-7) [Caenorhab... 32 7.5
gi|17553738|ref|NP_499125.1| reverse transcriptase like family m... 32 9.8
gi|16923238|gb|AAL29935.1| scarf3b [Girardia tigrina] 32 9.8
gi|1902915|dbj|BAA18914.1| lectin-related protein [Periplaneta a... 32 9.8
gi|50507459|emb|CAA80162.2| Hypothetical protein F58A4.5 [Caenor... 32 9.8
gi|2134245|pir||JC5059 bitiscetin beta chain - puff adder >gnl|B... 32 9.8
gi|16923242|gb|AAL29943.1| scarf2a [Girardia tigrina] 32 9.8
gi|4337052|gb|AAD18056.1| fibrinogen clotting inhibitor B chain ... 32 9.8
gi|47209097|emb|CAF91609.1| unnamed protein product [Tetraodon n... 32 9.8
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8... 32 9.8
gi|18307446|emb|CAA91440.2| C-type lectin-like protein [Girardia... 32 9.8
gi|16923234|gb|AAL29933.1| scarf2 [Girardia tigrina] 32 9.8
gi|126449|sp|P26305|LPSB_PERAM Hemolymph lipopolysaccharide-bind... 32 9.8
>gi|17531337|ref|NP_493698.1| c-type lectin precursor family member
(2A586) [Caenorhabditis elegans]
gi|7494943|pir||T25463 hypothetical protein B0432.12 -
Caenorhabditis elegans
gi|1707145|gb|AAB37896.1| Hypothetical protein B0432.12
[Caenorhabditis elegans]
Length = 185
Score = 403 bits (1036), Expect = e-111
Identities = 185/185 (100%), Positives = 185/185 (100%)
Frame = -1
Query: 558 MLKALLPLLLWISTGSTAPAGVATYLRSNGIVAFHKLYHLKMNFPRAKKHCEQNGAHLAG 379
MLKALLPLLLWISTGSTAPAGVATYLRSNGIVAFHKLYHLKMNFPRAKKHCEQNGAHLAG
Sbjct: 1 MLKALLPLLLWISTGSTAPAGVATYLRSNGIVAFHKLYHLKMNFPRAKKHCEQNGAHLAG 60
Query: 378 ITSREEAQKLIDLANEAGESNEQYWLGGQRKGECYGMRNYDKDHGLNATCSLSNVVQWLD 199
ITSREEAQKLIDLANEAGESNEQYWLGGQRKGECYGMRNYDKDHGLNATCSLSNVVQWLD
Sbjct: 61 ITSREEAQKLIDLANEAGESNEQYWLGGQRKGECYGMRNYDKDHGLNATCSLSNVVQWLD 120
Query: 198 NVAETIDPDWWKIPGPSHIPFNMPQQCLSFVHGDRDWTTPNDPGFLDDIGCDVPRKFFCT 19
NVAETIDPDWWKIPGPSHIPFNMPQQCLSFVHGDRDWTTPNDPGFLDDIGCDVPRKFFCT
Sbjct: 121 NVAETIDPDWWKIPGPSHIPFNMPQQCLSFVHGDRDWTTPNDPGFLDDIGCDVPRKFFCT 180
Query: 18 ELHEW 4
ELHEW
Sbjct: 181 ELHEW 185