Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= B0563_4
(831 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25147532|ref|NP_509543.2| putative protein, with at least 6 t... 522 e-147
gi|7495027|pir||T15360 hypothetical protein B0563.3 - Caenorhabd... 239 9e-87
gi|7495028|pir||T15358 hypothetical protein B0563.4 - Caenorhabd... 195 9e-49
gi|40018604|ref|NP_954547.1| Unknown (protein for MGC:73002) [Ra... 155 1e-36
gi|18640240|ref|NP_570396.1| NMDA receptor-like protein; CMLV006... 154 3e-36
gi|19717936|gb|AAG37461.1| CMP6L [Camelpox virus CMS] 153 5e-36
gi|49670629|gb|AAH75267.1| Unknown (protein for MGC:88883) [Xeno... 152 7e-36
gi|21311865|ref|NP_080893.1| RIKEN cDNA 0610007H07 [Mus musculus... 150 3e-35
gi|10441002|gb|AAG16898.1| z-protein [Homo sapiens] 146 5e-34
gi|7706335|ref|NP_057140.1| CGI-119 protein [Homo sapiens] >gnl|... 146 6e-34
gi|15214407|sp|Q9HC24|ZPRO_HUMAN Z-protein (CGI-119) (S1R protei... 146 6e-34
gi|10197628|gb|AAG14950.1| MDS013 [Homo sapiens] 142 1e-32
gi|19075931|ref|NP_588431.1| putative receptor-associated protei... 135 1e-30
gi|18414455|ref|NP_567466.1| expressed protein [Arabidopsis thal... 125 1e-27
gi|47085895|ref|NP_998303.1| zgc:64112 [Danio rerio] >gnl|BL_ORD... 120 5e-26
gi|46850169|gb|AAT02516.1| unknown [Chlamydomonas reinhardtii] 118 1e-25
gi|30519577|emb|CAD90752.1| T1R protein [Cowpox virus] 117 4e-25
gi|49068778|ref|XP_398678.1| hypothetical protein UM01063.1 [Ust... 114 3e-24
gi|50545972|ref|XP_500523.1| hypothetical protein [Yarrowia lipo... 112 8e-24
gi|19922136|ref|NP_610824.1| CG3814-PA [Drosophila melanogaster]... 111 2e-23
gi|24653219|ref|NP_725236.1| CG3814-PB [Drosophila melanogaster]... 111 2e-23
gi|15218701|ref|NP_171806.1| expressed protein [Arabidopsis thal... 110 4e-23
gi|50878377|gb|AAT85152.1| unknown protein [Oryza sativa (japoni... 110 5e-23
gi|46431126|gb|EAK90759.1| hypothetical protein CaO19.916 [Candi... 109 6e-23
gi|50418763|ref|XP_457902.1| unnamed protein product [Debaryomyc... 109 8e-23
gi|6841576|gb|AAF29141.1| HSPC178 [Homo sapiens] 109 8e-23
gi|50257059|gb|EAL19774.1| hypothetical protein CNBG0670 [Crypto... 107 2e-22
gi|48097206|ref|XP_391854.1| similar to CG3814-PA [Apis mellifera] 107 3e-22
gi|38100757|gb|EAA47846.1| hypothetical protein MG03089.4 [Magna... 106 7e-22
gi|24653227|ref|NP_725240.1| CG3798-PF [Drosophila melanogaster]... 105 2e-21
gi|24653221|ref|NP_725237.1| CG3798-PA [Drosophila melanogaster]... 105 2e-21
gi|17647735|ref|NP_523722.1| CG3798-PC [Drosophila melanogaster]... 105 2e-21
gi|46135813|ref|XP_389598.1| hypothetical protein FG09422.1 [Gib... 103 6e-21
gi|42566799|ref|NP_193209.2| transmembrane protein-related [Arab... 102 1e-20
gi|15235466|ref|NP_192178.1| hypothetical protein [Arabidopsis t... 102 1e-20
gi|50728296|ref|XP_416075.1| PREDICTED: similar to Z-protein (06... 102 1e-20
gi|24646768|ref|NP_650341.1| CG9722-PA [Drosophila melanogaster]... 102 1e-20
gi|49086452|ref|XP_405270.1| conserved hypothetical protein [Asp... 101 2e-20
gi|32422437|ref|XP_331662.1| hypothetical protein [Neurospora cr... 101 2e-20
gi|15229411|ref|NP_191890.1| expressed protein [Arabidopsis thal... 100 3e-20
gi|14626300|gb|AAK71568.1| putative receptor-associated protein ... 100 4e-20
gi|21312892|ref|NP_083417.1| RIKEN cDNA 4930511M11 [Mus musculus... 100 4e-20
gi|23509157|ref|NP_701825.1| P. falciparum homolog of Drosophila... 99 1e-19
gi|34393841|dbj|BAC83445.1| putative z-protein [Oryza sativa (ja... 99 1e-19
gi|1079108|pir||S53708 N-methyl-D-aspartate receptor-associated ... 96 7e-19
gi|47225500|emb|CAG11983.1| unnamed protein product [Tetraodon n... 96 1e-18
gi|12854220|dbj|BAB29963.1| unnamed protein product [Mus musculus] 94 5e-18
gi|23478216|gb|EAA15362.1| Drosophila melanogaster CG3814 gene p... 94 5e-18
gi|41055066|ref|NP_957502.1| similar to glutamate receptor, iono... 92 2e-17
gi|24586434|ref|NP_724626.1| CG30379-PA [Drosophila melanogaster... 92 2e-17
gi|27503256|gb|AAH42223.1| Grina-prov protein [Xenopus laevis] 91 2e-17
gi|50400036|gb|AAT76424.1| expressed protein [Oryza sativa (japo... 91 3e-17
gi|15810201|gb|AAL07001.1| AT4g15470/dl3775w [Arabidopsis thaliana] 90 7e-17
gi|49256498|gb|AAH74272.1| Unknown (protein for MGC:84041) [Xeno... 89 1e-16
gi|45430023|ref|NP_991367.1| responsive to centrifugal force and... 87 6e-16
gi|27469806|gb|AAH41788.1| GRINA protein [Homo sapiens] 86 1e-15
gi|31455507|dbj|BAC77379.1| putative MAPK activating protein [Ho... 86 1e-15
gi|41148478|ref|XP_291268.3| NMDA receptor glutamate-binding cha... 86 1e-15
gi|50806769|ref|XP_424507.1| PREDICTED: similar to neuromembrane... 86 1e-15
gi|49256307|gb|AAH74388.1| Unknown (protein for MGC:84338) [Xeno... 86 1e-15
gi|21754493|dbj|BAC04516.1| unnamed protein product [Homo sapiens] 85 2e-15
gi|17560790|ref|NP_505501.1| lifeguard (27.5 kD) (5K188) [Caenor... 85 2e-15
gi|34189346|gb|AAH26693.1| PP1201 protein [Homo sapiens] 84 3e-15
gi|38503362|sp|Q969X1|RECS_HUMAN RECS1 protein homolog (PP1201) ... 84 3e-15
gi|50593008|ref|NP_071435.2| PP1201 protein [Homo sapiens] >gnl|... 84 3e-15
gi|12963551|ref|NP_075657.1| NMDA receptor glutamate-binding cha... 84 5e-15
gi|34876803|ref|XP_237311.2| similar to RECS1 [Rattus norvegicus] 83 6e-15
gi|34393840|dbj|BAC83444.1| putative z-protein [Oryza sativa (ja... 83 6e-15
gi|38303820|gb|AAH62074.1| Grina protein [Rattus norvegicus] 83 8e-15
gi|37360156|dbj|BAC98056.1| mKIAA0950 protein [Mus musculus] 82 1e-14
gi|12850853|dbj|BAB28874.1| unnamed protein product [Mus musculu... 82 1e-14
gi|34328312|ref|NP_082500.2| lifeguard [Mus musculus] >gnl|BL_OR... 82 1e-14
gi|21311561|gb|AAM46781.1| lifeguard [Mus musculus] 82 1e-14
gi|4589544|dbj|BAA76794.1| KIAA0950 protein [Homo sapiens] 82 1e-14
gi|34101290|ref|NP_036438.2| neuromembrane protein 35 [Homo sapi... 82 1e-14
gi|50308569|ref|XP_454287.1| unnamed protein product [Kluyveromy... 82 2e-14
gi|21426783|ref|NP_653357.1| lifeguard; neural membrane protein ... 82 2e-14
gi|26453457|dbj|BAC43762.1| RECS1 [Mus musculus] 82 2e-14
gi|15791608|ref|NP_281431.1| putative integral membrane protein ... 81 3e-14
gi|112064|pir||S19586 N-methyl-D-aspartate receptor glutamate-bi... 80 5e-14
gi|23463297|ref|NP_695220.1| NMDA receptor glutamate-binding cha... 80 5e-14
gi|6273281|gb|AAF06327.1| lifeguard [Homo sapiens] 79 1e-13
gi|31980814|ref|NP_081430.2| RIKEN cDNA 2310061B02 [Mus musculus... 79 1e-13
gi|39594657|emb|CAE72235.1| Hypothetical protein CBG19350 [Caeno... 78 2e-13
gi|39588043|emb|CAE57275.1| Hypothetical protein CBG00177 [Caeno... 78 3e-13
gi|50294203|ref|XP_449513.1| unnamed protein product [Candida gl... 78 3e-13
gi|50400021|gb|AAT76409.1| expressed protein [Oryza sativa (japo... 78 3e-13
gi|29840919|gb|AAP05920.1| similar to GenBank Accession Number B... 74 3e-12
gi|12802207|gb|AAK07769.1| putative N-methyl-aspartate receptor ... 72 1e-11
gi|47228664|emb|CAG07396.1| unnamed protein product [Tetraodon n... 71 3e-11
gi|17975097|ref|NP_536611.1| R1R [Monkeypox virus] >gnl|BL_ORD_I... 71 3e-11
gi|47215026|emb|CAG01850.1| unnamed protein product [Tetraodon n... 70 4e-11
gi|31213171|ref|XP_315529.1| ENSANGP00000021232 [Anopheles gambi... 70 6e-11
gi|47229542|emb|CAG06738.1| unnamed protein product [Tetraodon n... 69 1e-10
gi|15645536|ref|NP_207712.1| conserved hypothetical integral mem... 69 1e-10
gi|23100144|ref|NP_693610.1| hypothetical protein OB2689 [Oceano... 69 1e-10
gi|50750622|ref|XP_422067.1| PREDICTED: similar to PP1201 protei... 69 2e-10
gi|39594656|emb|CAE72234.1| Hypothetical protein CBG19349 [Caeno... 68 2e-10
gi|22537744|ref|NP_688595.1| membrane protein, putative [Strepto... 68 2e-10
gi|15611921|ref|NP_223572.1| putative [Helicobacter pylori J99] ... 68 3e-10
gi|2737880|gb|AAB94292.1| NMDA receptor glutamate-binding chain 67 4e-10
gi|15594884|ref|NP_212673.1| conserved hypothetical integral mem... 66 1e-09
gi|32566995|ref|NP_505500.2| lifeguard (33.2 kD) (5K187) [Caenor... 65 2e-09
gi|39580623|emb|CAE69438.1| Hypothetical protein CBG15624 [Caeno... 64 3e-09
gi|24380095|ref|NP_722050.1| putative integral membrane protein ... 64 3e-09
gi|25146463|ref|NP_741597.1| lifeguard (33.1 kD) (5K187) [Caenor... 64 5e-09
gi|7503077|pir||T22049 hypothetical protein F40F9.1 - Caenorhabd... 63 7e-09
gi|46226967|gb|EAK87933.1| N-methyl-D-aspartate receptor-associa... 63 9e-09
gi|15641370|ref|NP_231002.1| conserved hypothetical protein [Vib... 63 9e-09
gi|37679737|ref|NP_934346.1| integral membrane protein [Vibrio v... 63 9e-09
gi|34854311|ref|XP_342637.1| similar to RIKEN cDNA 4930500J03 [R... 62 1e-08
gi|28898398|ref|NP_798003.1| putative TEGT family carrier/transp... 62 1e-08
gi|16077787|ref|NP_388601.1| yetJ [Bacillus subtilis subsp. subt... 62 2e-08
gi|6324024|ref|NP_014094.1| Hypothetical ORF; Ynl305cp [Saccharo... 61 3e-08
gi|22957240|ref|ZP_00004951.1| COG0670: Integral membrane protei... 60 4e-08
gi|34556781|ref|NP_906596.1| conserved hypothetical protein [Wol... 59 1e-07
gi|23024911|ref|ZP_00064099.1| COG0670: Integral membrane protei... 59 1e-07
gi|16272019|ref|NP_438217.1| hypothetical protein HI0044 [Haemop... 59 1e-07
gi|15597800|ref|NP_251294.1| conserved hypothetical protein [Pse... 59 1e-07
gi|24373922|ref|NP_717965.1| membrane protein, putative [Shewane... 59 1e-07
gi|19704201|ref|NP_603763.1| Integral membrane protein [Fusobact... 59 2e-07
gi|31213169|ref|XP_315528.1| ENSANGP00000025350 [Anopheles gambi... 58 2e-07
gi|49078672|gb|AAT49808.1| PA2604 [synthetic construct] 58 2e-07
gi|31378073|gb|AAP50723.1| rh202 [Rhesus cytomegalovirus strain ... 58 3e-07
gi|15966975|ref|NP_387328.1| HYPOTHETICAL TRANSMEMBRANE PROTEIN ... 58 3e-07
gi|46228338|gb|EAK89237.1| hypothetical protein with 7 transmemb... 58 3e-07
gi|28378221|ref|NP_785113.1| integral membrane protein [Lactobac... 57 4e-07
gi|33593409|ref|NP_881053.1| putative integral membrane protein ... 57 5e-07
gi|14042670|dbj|BAB55346.1| unnamed protein product [Homo sapien... 57 6e-07
gi|15901795|ref|NP_346399.1| membrane protein [Streptococcus pne... 56 8e-07
gi|15903829|ref|NP_359379.1| Conserved hypothetical protein [Str... 56 8e-07
gi|23105341|ref|ZP_00091797.1| COG0670: Integral membrane protei... 56 1e-06
gi|47229389|emb|CAF99377.1| unnamed protein product [Tetraodon n... 55 1e-06
gi|23472980|ref|ZP_00128299.1| COG0670: Integral membrane protei... 55 1e-06
gi|15889937|ref|NP_355618.1| AGR_C_4861p [Agrobacterium tumefaci... 55 2e-06
gi|15896086|ref|NP_349435.1| Conserved membrane protein, YccA fa... 55 2e-06
gi|41722599|ref|ZP_00149594.1| COG0670: Integral membrane protei... 55 2e-06
gi|42519089|ref|NP_965019.1| hypothetical protein LJ1163 [Lactob... 55 2e-06
gi|47575666|ref|ZP_00245701.1| COG0670: Integral membrane protei... 54 3e-06
gi|48729439|ref|ZP_00263190.1| COG0670: Integral membrane protei... 54 3e-06
gi|17543360|ref|NP_501350.1| lifeguard family member (4I863) [Ca... 54 4e-06
gi|47228030|emb|CAF97659.1| unnamed protein product [Tetraodon n... 54 5e-06
gi|27365998|ref|NP_761526.1| Integral membrane protein [Vibrio v... 54 5e-06
gi|33519803|ref|NP_878635.1| putative permease [Candidatus Bloch... 53 7e-06
gi|12832258|dbj|BAB22027.1| unnamed protein product [Mus musculus] 53 7e-06
gi|44903340|gb|AAS49019.1| US21 [Human herpesvirus 5] 53 9e-06
gi|39842166|gb|AAR31710.1| US21 [Human herpesvirus 5] 53 9e-06
gi|15674509|ref|NP_268683.1| conserved hypothetical protein (put... 53 9e-06
gi|9625857|ref|NP_040106.1| US21 [Human herpesvirus 5] >gnl|BL_O... 53 9e-06
gi|15602267|ref|NP_245339.1| unknown [Pasteurella multocida Pm70... 53 9e-06
gi|33152822|ref|NP_874175.1| probable transport protein [Haemoph... 53 9e-06
gi|46201126|ref|ZP_00055766.2| COG0670: Integral membrane protei... 53 9e-06
gi|46580874|ref|YP_011682.1| membrane protein, putaive [Desulfov... 52 1e-05
gi|19745517|ref|NP_606653.1| conserved hypothetical protein [Str... 52 1e-05
gi|23002505|ref|ZP_00046181.1| COG0670: Integral membrane protei... 52 1e-05
gi|39590150|emb|CAE61148.1| Hypothetical protein CBG04910 [Caeno... 52 1e-05
gi|9965379|gb|AAG10066.1| transmembrane protein OTMP [Ovis aries] 52 2e-05
gi|25504453|pir||JC7692 oligodendrocyte transmembrane protein - ... 52 2e-05
gi|21909796|ref|NP_664064.1| conserved hypothetical protein [Str... 52 2e-05
gi|49473696|ref|YP_031738.1| hypothetical protein BQ00080 [Barto... 52 2e-05
gi|46202998|ref|ZP_00052253.2| COG0670: Integral membrane protei... 52 2e-05
gi|16121459|ref|NP_404772.1| putative membrane protein [Yersinia... 52 2e-05
gi|26990695|ref|NP_746120.1| membrane protein, putative [Pseudom... 52 2e-05
gi|42520766|ref|NP_966681.1| membrane protein, putative [Wolbach... 51 3e-05
gi|23474056|ref|ZP_00129351.1| COG0670: Integral membrane protei... 51 4e-05
gi|20026752|ref|NP_612794.1| US21 [Chimpanzee cytomegalovirus] >... 51 4e-05
gi|16801374|ref|NP_471642.1| similar to unknown protein [Listeri... 51 4e-05
gi|17988142|ref|NP_540776.1| INTEGRAL MEMBRANE PROTEIN [Brucella... 51 4e-05
gi|45521820|ref|ZP_00173337.1| COG0670: Integral membrane protei... 50 6e-05
gi|46321925|ref|ZP_00222298.1| COG0670: Integral membrane protei... 50 6e-05
gi|48865906|ref|ZP_00319764.1| COG0670: Integral membrane protei... 50 6e-05
gi|3348079|gb|AAC27790.1| unknown [Rhesus cytomegalovirus] 50 8e-05
gi|48833084|ref|ZP_00290108.1| COG0670: Integral membrane protei... 50 8e-05
gi|49474839|ref|YP_032880.1| hypothetical protein BH00080 [Barto... 50 8e-05
gi|48787780|ref|ZP_00283759.1| COG0670: Integral membrane protei... 50 8e-05
gi|50120696|ref|YP_049863.1| putative membrane protein [Erwinia ... 50 8e-05
gi|22958985|ref|ZP_00006645.1| COG0670: Integral membrane protei... 49 1e-04
gi|13473668|ref|NP_105236.1| hypothetical protein, hypothetical ... 49 1e-04
gi|16804246|ref|NP_465731.1| similar to unknown protein [Listeri... 49 2e-04
gi|46908441|ref|YP_014830.1| membrane protein, putative [Listeri... 49 2e-04
gi|26246758|ref|NP_752798.1| Hypothetical protein ybhL [Escheric... 49 2e-04
gi|46324263|ref|ZP_00224624.1| COG0670: Integral membrane protei... 49 2e-04
gi|46323580|ref|ZP_00223944.1| COG0670: Integral membrane protei... 49 2e-04
gi|46315505|ref|ZP_00216087.1| COG0670: Integral membrane protei... 49 2e-04
gi|33861839|ref|NP_893400.1| conserved hypothetical protein [Pro... 49 2e-04
gi|48769588|ref|ZP_00273933.1| COG0670: Integral membrane protei... 48 2e-04
gi|24112154|ref|NP_706664.1| orf, conserved hypothetical protein... 48 2e-04
gi|5354188|gb|AAD42397.1| conserved hypothetical integral membra... 48 2e-04
gi|15800537|ref|NP_286549.1| orf, hypothetical protein [Escheric... 48 2e-04
gi|16764170|ref|NP_459785.1| putative permease [Salmonella typhi... 48 2e-04
gi|30062271|ref|NP_836442.1| hypothetical protein S0777 [Shigell... 48 2e-04
gi|16128754|ref|NP_415307.1| orf, hypothetical protein; putative... 48 2e-04
gi|20380353|gb|AAH27637.1| 0610007H07Rik protein [Mus musculus] 48 2e-04
gi|32266411|ref|NP_860443.1| conserved hypothetical protein [Hel... 48 2e-04
gi|45916810|ref|ZP_00195842.2| COG0670: Integral membrane protei... 48 3e-04
gi|27382433|ref|NP_773962.1| bll7322 [Bradyrhizobium japonicum U... 47 4e-04
gi|27375573|ref|NP_767102.1| blr0462 [Bradyrhizobium japonicum U... 47 5e-04
gi|15892112|ref|NP_359826.1| unknown [Rickettsia conorii str. Ma... 47 5e-04
gi|34580857|ref|ZP_00142337.1| hypothetical protein [Rickettsia ... 47 5e-04
gi|50121736|ref|YP_050903.1| putative membrane protein [Erwinia ... 47 5e-04
gi|46913804|emb|CAG20586.1| putative carrier/transport protein [... 47 5e-04
gi|22298005|ref|NP_681252.1| ORF_ID:tlr0462~hypothetical protein... 47 7e-04
gi|39933275|ref|NP_945551.1| possible acetate transporter, stati... 47 7e-04
gi|23002708|ref|ZP_00046382.1| COG0670: Integral membrane protei... 46 9e-04
gi|46143361|ref|ZP_00135381.2| COG0670: Integral membrane protei... 46 9e-04
gi|45515488|ref|ZP_00167043.1| COG0670: Integral membrane protei... 46 0.001
gi|46308153|ref|ZP_00210349.1| COG0670: Integral membrane protei... 46 0.001
gi|39595267|emb|CAE60304.1| Hypothetical protein CBG03891 [Caeno... 45 0.001
gi|42519583|ref|NP_965513.1| hypothetical protein LJ1706 [Lactob... 45 0.002
gi|48870481|ref|ZP_00323203.1| COG0670: Integral membrane protei... 45 0.002
gi|24112383|ref|NP_706893.1| putative carrier-transport protein ... 45 0.003
gi|16764444|ref|NP_460059.1| putative transport protein [Salmone... 45 0.003
gi|15800829|ref|NP_286845.1| putative carrier/transport protein ... 45 0.003
gi|16759966|ref|NP_455583.1| putative membrane protein [Salmonel... 45 0.003
gi|16128937|ref|NP_415490.1| putative carrier/transport protein;... 44 0.003
gi|33866149|ref|NP_897708.1| conserved hypothetical protein [Syn... 44 0.004
gi|37519708|ref|NP_923085.1| hypothetical protein gll0139 [Gloeo... 44 0.004
gi|17545929|ref|NP_519331.1| HYPOTHETICAL TRANSMEMBRANE PROTEIN ... 44 0.006
gi|34540578|ref|NP_905057.1| membrane protein, putative [Porphyr... 44 0.006
gi|7485070|pir||C71419 hypothetical protein - Arabidopsis thalia... 43 0.007
gi|48851272|ref|ZP_00305514.1| COG0670: Integral membrane protei... 43 0.007
gi|15214335|sp|Q9A2A3|Y0G3_CAUCR Hypothetical protein CC3663 43 0.007
gi|15214405|sp|Q9CEU8|YRJE_LACLA Hypothetical protein yrjE 43 0.007
gi|32472512|ref|NP_865506.1| conserved hypothetical protein [Pir... 43 0.007
gi|16127893|ref|NP_422457.1| conserved hypothetical protein [Cau... 43 0.007
gi|31234098|ref|XP_319002.1| ENSANGP00000014774 [Anopheles gambi... 43 0.007
gi|15673718|ref|NP_267892.1| transport permease [Lactococcus lac... 43 0.007
gi|33240806|ref|NP_875748.1| Uncharacterized conserved membrane ... 43 0.007
gi|12229685|sp|Q9MBD8|BI1_ORYSA Bax inhibitor-1 (BI-1) (OsBI-1) ... 43 0.010
gi|23127850|ref|ZP_00109711.1| COG0670: Integral membrane protei... 43 0.010
gi|29376434|ref|NP_815588.1| conserved hypothetical protein [Ent... 43 0.010
gi|13811671|gb|AAK40236.1| glutamate-rich protein [Plasmodium re... 43 0.010
gi|41053063|dbj|BAD08007.1| putative Bax inhibitor-1 (BI-1) (OsB... 43 0.010
gi|50876561|emb|CAG36401.1| conserved hypothetical membrane prot... 43 0.010
gi|24641180|ref|NP_572681.1| CG2076-PA [Drosophila melanogaster]... 42 0.013
gi|48101809|ref|XP_392713.1| similar to ENSANGP00000014774 [Apis... 42 0.013
gi|15805918|ref|NP_294617.1| conserved hypothetical protein [Dei... 42 0.013
gi|32491279|ref|NP_871533.1| yccA [Wigglesworthia glossinidia en... 42 0.013
gi|45525805|ref|ZP_00177026.1| COG2814: Arabinose efflux permeas... 42 0.016
gi|34498097|ref|NP_902312.1| probable membrane protein [Chromoba... 42 0.016
gi|37525454|ref|NP_928798.1| hypothetical protein [Photorhabdus ... 42 0.021
gi|15604023|ref|NP_220538.1| unknown [Rickettsia prowazekii str.... 42 0.021
gi|3171165|gb|AAC18360.1| putative membrane spanning protein [La... 41 0.028
gi|47209795|emb|CAF94306.1| unnamed protein product [Tetraodon n... 41 0.028
gi|4507433|ref|NP_003208.1| testis enhanced gene transcript (BAX... 41 0.028
gi|25141343|ref|NP_490949.2| ATP-binding cassette transporter (a... 41 0.028
gi|46130110|ref|ZP_00164857.2| hypothetical protein Selo021109 [... 41 0.036
gi|27370864|gb|AAH41226.1| Ghitm-prov protein [Xenopus laevis] 41 0.036
gi|16330437|ref|NP_441165.1| hypothetical protein [Synechocystis... 41 0.036
gi|42629226|ref|ZP_00154774.1| COG0670: Integral membrane protei... 41 0.036
gi|24371736|ref|NP_715778.1| hypothetical protein SO0136 [Shewan... 40 0.048
gi|47224083|emb|CAG12912.1| unnamed protein product [Tetraodon n... 40 0.048
gi|20981681|sp|P55061|BI1_HUMAN Bax inhibitor-1 (BI-1) (Testis e... 40 0.048
gi|1870163|emb|CAB05927.1| unknown [Streptococcus pneumoniae] 40 0.048
gi|20026751|ref|NP_612793.1| US20 [Chimpanzee cytomegalovirus] >... 40 0.048
gi|21311961|ref|NP_080945.1| testis enhanced gene transcript; Ba... 40 0.062
gi|26331690|dbj|BAC29575.1| unnamed protein product [Mus musculu... 40 0.062
gi|28850443|gb|AAO53207.1| hypothetical protein [Dictyostelium d... 40 0.081
gi|13940165|emb|CAC37797.1| BAX inhibitor 1 [Hordeum vulgare sub... 40 0.081
gi|14719274|gb|AAK73101.1| Bax inhibitor 1 [Brassica napus] >gnl... 39 0.14
gi|48860698|ref|ZP_00314608.1| COG0670: Integral membrane protei... 39 0.14
gi|17981376|gb|AAL50980.1| bax inhibitor-like protein [Brassica ... 39 0.18
gi|33862625|ref|NP_894185.1| conserved hypothetical protein [Pro... 39 0.18
gi|38103832|gb|EAA50483.1| hypothetical protein MG04242.4 [Magna... 39 0.18
gi|23619450|ref|NP_705412.1| hypothetical protein, conserved [Pl... 39 0.18
gi|42658146|ref|XP_377956.1| similar to RIKEN cDNA 4930511M11 [H... 38 0.24
gi|17233175|ref|NP_490265.1| hypothetical protein [Nostoc sp. PC... 38 0.24
gi|32527701|gb|AAP86252.1| Ac1-149 [Rattus norvegicus] >gnl|BL_O... 38 0.31
gi|48892503|ref|ZP_00325871.1| COG0670: Integral membrane protei... 38 0.31
gi|45268987|gb|AAS55906.1| Bax inhibitor-1 [Sus scrofa] 38 0.31
gi|34762501|ref|ZP_00143499.1| Integral membrane protein [Fusoba... 38 0.31
gi|34849859|gb|AAH58478.1| Unknown (protein for MGC:72852) [Ratt... 38 0.31
gi|23613778|ref|NP_704799.1| protein kinase, putative [Plasmodiu... 37 0.40
gi|34533807|dbj|BAC86810.1| unnamed protein product [Homo sapiens] 37 0.40
gi|14719276|gb|AAK73102.1| Bax inhibitor 1 [Nicotiana tabacum] 37 0.53
gi|45826265|gb|AAS77774.1| cytochrome b [Dialeurodes sp. PB-2004] 37 0.53
gi|46126509|ref|XP_387808.1| hypothetical protein FG07632.1 [Gib... 37 0.53
gi|21593125|gb|AAM65074.1| Bax inhibitor-1 like [Arabidopsis tha... 37 0.69
gi|50344874|ref|NP_001002109.1| zgc:85944 [Danio rerio] >gnl|BL_... 37 0.69
gi|13471650|ref|NP_103216.1| probable oxalate/formate antiporter... 37 0.69
gi|38105775|gb|EAA52158.1| hypothetical protein MG04850.4 [Magna... 37 0.69
gi|23509787|ref|NP_702454.1| hypothetical protein [Plasmodium fa... 36 0.90
gi|23510021|ref|NP_702687.1| hypothetical protein [Plasmodium fa... 36 0.90
gi|1729892|sp|P55062|BI1_RAT Bax inhibitor-1 (BI-1) (Testis enha... 36 0.90
gi|456209|emb|CAA53471.1| TEGT [Rattus norvegicus] 36 0.90
gi|34396040|gb|AAQ65222.1| K+-channel protein PAK3.1 [Paramecium... 36 0.90
gi|29653567|ref|NP_819259.1| membrane protein, putative [Coxiell... 36 0.90
gi|32405068|ref|XP_323147.1| hypothetical protein [Neurospora cr... 36 0.90
gi|28502868|gb|AAH47131.1| Tegt-prov protein [Xenopus laevis] 36 0.90
gi|23479081|gb|EAA16009.1| hypothetical protein [Plasmodium yoel... 36 1.2
gi|15238017|ref|NP_199523.1| Bax inhibitor-1 putative / BI-1 put... 36 1.2
gi|47575060|ref|ZP_00245095.1| COG0670: Integral membrane protei... 36 1.2
gi|23957786|ref|NP_473347.2| hypothetical protein [Plasmodium fa... 35 1.5
gi|12001984|gb|AAG43135.1| My021 protein [Homo sapiens] 35 1.5
gi|15213977|sp|Q9H3K2|GHIT_HUMAN Growth hormone inducible transm... 35 1.5
gi|12052946|emb|CAB66648.1| hypothetical protein [Homo sapiens] ... 35 1.5
gi|23612448|ref|NP_704009.1| hypothetical protein [Plasmodium fa... 35 1.5
gi|16331481|ref|NP_442209.1| diacylglycerol kinase [Synechocysti... 35 1.5
gi|23508608|ref|NP_701277.1| hypothetical protein [Plasmodium fa... 35 2.0
gi|50749148|ref|XP_421506.1| PREDICTED: similar to Ghitm-prov pr... 35 2.0
gi|23509165|ref|NP_701833.1| hypothetical protein [Plasmodium fa... 35 2.0
gi|23508065|ref|NP_700735.1| hypothetical protein [Plasmodium fa... 35 2.0
gi|23508424|ref|NP_701093.1| hypothetical protein [Plasmodium fa... 35 2.0
gi|23613739|ref|NP_704760.1| ubiquitin-like protein, putative [P... 35 2.6
gi|23509780|ref|NP_702447.1| hypothetical protein [Plasmodium fa... 35 2.6
gi|13473683|ref|NP_105251.1| hypothetical protein mll4363 [Mesor... 34 3.4
gi|46229460|gb|EAK90278.1| Low complexity protein, possible plas... 34 3.4
gi|23509125|ref|NP_701793.1| kinesin-like protein, putative [Pla... 34 3.4
gi|17530603|ref|NP_511201.1| TraI [IncN plasmid R46] >gnl|BL_ORD... 34 3.4
gi|29654938|ref|NP_820630.1| DotA protein, putative [Coxiella bu... 34 3.4
gi|23481204|gb|EAA17552.1| hypothetical protein [Plasmodium yoel... 34 3.4
gi|23489947|gb|EAA21835.1| CCAAT-box DNA binding protein subunit... 34 3.4
gi|17505218|ref|NP_510963.1| growth hormone inducible transmembr... 34 3.4
gi|38090197|ref|XP_357976.1| similar to hypothetical protein [Mu... 34 4.5
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass... 34 4.5
gi|34866659|ref|XP_236722.2| similar to hypothetical protein [Ra... 34 4.5
gi|39579116|gb|AAR28754.1| Bax inhibitor [Lycopersicon esculentum] 34 4.5
gi|7485043|pir||B71410 hypothetical protein - Arabidopsis thalia... 34 4.5
gi|24251264|gb|AAN46184.1| unknown protein [Synechococcus sp. PC... 34 4.5
gi|24371693|ref|NP_715735.1| NupC family protein [Shewanella one... 34 4.5
gi|28828782|gb|AAO51377.1| similar to Plasmodium falciparum (iso... 34 4.5
gi|46447520|ref|YP_008885.1| conserved hypothetical protein [Par... 29 5.3
gi|28210172|ref|NP_781116.1| Na+ driven multidrug efflux pump [C... 33 5.8
gi|23593332|ref|NP_473112.2| hypothetical protein [Plasmodium fa... 33 5.8
gi|23508286|ref|NP_700955.1| hypothetical protein [Plasmodium fa... 33 5.8
gi|45914281|ref|ZP_00192650.2| COG1295: Predicted membrane prote... 33 5.8
gi|46115422|ref|XP_383729.1| hypothetical protein FG03553.1 [Gib... 33 5.8
gi|7494396|pir||H71602 protein with DnaJ domain (RESA-like) PFB0... 33 5.8
gi|18766344|gb|AAL78969.1| sarco/endoplasmic reticulum Ca2+ ATPa... 33 7.6
gi|46107866|ref|XP_380992.1| hypothetical protein FG00816.1 [Gib... 33 7.6
gi|42561284|ref|NP_975735.1| Sodium transport protein [Mycoplasm... 33 7.6
gi|20094332|ref|NP_614179.1| Fe-S oxidoreductase fused to a meta... 33 7.6
gi|17507229|ref|NP_492472.1| CUB sushi multiple domains 1 (1J826... 33 7.6
gi|46311552|ref|ZP_00212157.1| COG0477: Permeases of the major f... 33 7.6
gi|18202604|sp|Q64518|ATA3_MOUSE Sarcoplasmic/endoplasmic reticu... 33 7.6
gi|31542159|ref|NP_058025.2| ATPase, Ca++ transporting, ubiquito... 33 7.6
gi|28192486|gb|AAM77999.1| transmembrane transporter [Streptomyc... 33 7.6
gi|7500676|pir||T21888 hypothetical protein F36H2.3a - Caenorhab... 33 7.6
gi|23485072|gb|EAA20190.1| myosin heavy chain [Plasmodium yoelii... 33 7.6
gi|17507227|ref|NP_492473.1| e-selectin (1J826) [Caenorhabditis ... 33 7.6
gi|21402470|ref|NP_658455.1| hypothetical protein predicted by G... 33 7.6
gi|1438541|gb|AAB04099.1| sarcoendoplasmic reticulum Ca2+ ATPase... 33 7.6
gi|6978555|ref|NP_037046.1| ATPase, Ca++ transporting, ubiquitou... 33 7.6
gi|20072778|gb|AAH26147.1| Atp2a3 protein [Mus musculus] 33 7.6
gi|49187317|ref|YP_030569.1| hypothetical protein BAS4322 [Bacil... 33 7.6
gi|7500677|pir||T21889 hypothetical protein F36H2.3b - Caenorhab... 33 7.6
gi|23509793|ref|NP_702460.1| hypothetical protein [Plasmodium fa... 33 7.6
gi|46324797|ref|ZP_00225157.1| COG2807: Cyanate permease [Burkho... 33 9.9
gi|50411482|ref|XP_457050.1| unnamed protein product [Debaryomyc... 33 9.9
gi|1086953|gb|AAB35067.1| homeobox protein [Hirudo medicinalis] 33 9.9
gi|3024221|sp|Q24332|NT56_DROVI Lethal(2)neighbour of Tid protei... 33 9.9
gi|48859769|ref|ZP_00313699.1| COG1295: Predicted membrane prote... 33 9.9
gi|4680168|gb|AAD27542.1| mobilization protein TraI [Escherichia... 33 9.9
gi|23490835|gb|EAA22516.1| hypothetical protein [Plasmodium yoel... 33 9.9
gi|14601480|ref|NP_148018.1| hypothetical protein APE1555 [Aerop... 33 9.9
gi|34870437|ref|XP_221910.2| similar to zinc finger protein 95 [... 33 9.9
gi|34877074|ref|XP_214285.2| similar to growth hormone inducible... 33 9.9
gi|42521955|ref|NP_967335.1| ampG protein [Bdellovibrio bacterio... 33 9.9
gi|8925558|gb|AAF81520.1| light-harvesting complex protein LHCC4... 33 9.9
>gi|25147532|ref|NP_509543.2| putative protein, with at least 6
transmembrane domains, of ancient origin (30.4 kD)
(XJ777) [Caenorhabditis elegans]
gi|32172450|sp|Q11080|YT64_CAEEL Hypothetical protein B0563.4 in
chromosome X
gi|21392625|gb|AAA68319.2| Hypothetical protein B0563.4
[Caenorhabditis elegans]
Length = 276
Score = 522 bits (1345), Expect = e-147
Identities = 267/276 (96%), Positives = 267/276 (96%)
Frame = +1
Query: 1 MATINSHLREPERVNLLXXXXXXXXXEVHVKRNPQMWPMSMASSAHAEAGIVDADGILPG 180
MATINSHLREPERVNLL EVHVKRNPQMWPMSMASSAHAEAGIVDADGILPG
Sbjct: 1 MATINSHLREPERVNLLSDHDDSDDDEVHVKRNPQMWPMSMASSAHAEAGIVDADGILPG 60
Query: 181 CVGKANRMIRIAFLRKVLGIVGFQLLFTIGICAAIYNIPNSNQLLQKHAWIVFPNLLGSI 360
CVGKANRMIRIAFLRKVLGIVGFQLLFTIGICAAIYNIPNSNQLLQKHAWIVFPNLLGSI
Sbjct: 61 CVGKANRMIRIAFLRKVLGIVGFQLLFTIGICAAIYNIPNSNQLLQKHAWIVFPNLLGSI 120
Query: 361 ALIIALHVYAREVPLNYVLLAAFTAVQAVTMGCVVTLFEAKVVLEAAVITGLVVASLFAY 540
ALIIALHVYAREVPLNYVLLAAFTAVQAVTMGCVVTLFEAKVVLEAAVITGLVVASLFAY
Sbjct: 121 ALIIALHVYAREVPLNYVLLAAFTAVQAVTMGCVVTLFEAKVVLEAAVITGLVVASLFAY 180
Query: 541 TLQNKRDFSVGYASMGSLLCVLLWAGIFQMFFMSPAVNFVINVFGAGLFCVLLVIDLDMI 720
TLQNKRDFSVGYASMGSLLCVLLWAGIFQMFFMSPAVNFVINVFGAGLFCVLLVIDLDMI
Sbjct: 181 TLQNKRDFSVGYASMGSLLCVLLWAGIFQMFFMSPAVNFVINVFGAGLFCVLLVIDLDMI 240
Query: 721 MYRFSPEDYICACVSLYMDILNLFIRILQIVAEANK 828
MYRFSPEDYICACVSLYMDILNLFIRILQIVAEANK
Sbjct: 241 MYRFSPEDYICACVSLYMDILNLFIRILQIVAEANK 276