Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C01B12_6
(897 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 313 4e-84
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 306 5e-82
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 144 2e-33
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 144 2e-33
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 139 1e-31
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 130 3e-29
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 126 7e-28
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 125 1e-27
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 110 4e-23
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 107 3e-22
gi|17551704|ref|NP_508747.1| COLlagen structural gene (33.9 kD) ... 105 1e-21
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 105 2e-21
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 100 3e-20
gi|39597872|emb|CAE68564.1| Hypothetical protein CBG14399 [Caeno... 100 3e-20
gi|39595798|emb|CAE67301.1| Hypothetical protein CBG12754 [Caeno... 100 6e-20
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [... 99 1e-19
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 94 3e-18
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 93 9e-18
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 92 1e-17
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 92 2e-17
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 91 3e-17
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 91 3e-17
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 91 3e-17
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 91 3e-17
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 91 3e-17
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 88 3e-16
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 87 4e-16
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 84 3e-15
gi|15077111|gb|AAK83075.1| collagen [Meloidogyne javanica] 82 1e-14
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 81 4e-14
gi|32453015|gb|AAP82656.1| Collagen protein 172, isoform b [Caen... 79 1e-13
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 79 1e-13
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 79 2e-13
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl... 78 2e-13
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40 78 2e-13
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 78 3e-13
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 77 5e-13
gi|687634|gb|AAA62504.1| collagen 76 9e-13
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 76 1e-12
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 75 3e-12
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 73 1e-11
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 73 1e-11
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 72 1e-11
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 72 2e-11
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 72 2e-11
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 72 2e-11
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 72 2e-11
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 72 2e-11
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 71 3e-11
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 71 3e-11
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno... 71 4e-11
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [... 71 4e-11
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 70 5e-11
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 70 8e-11
gi|1222642|emb|CAA63070.1| collagen [Brugia pahangi] 69 1e-10
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 69 1e-10
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 69 1e-10
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 69 2e-10
gi|320995|pir||A44982 collagen UCOL1 - pig roundworm (fragment) ... 69 2e-10
gi|32567349|ref|NP_872207.1| COLlagen structural gene (col-42) [... 68 2e-10
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 68 2e-10
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 68 3e-10
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 68 3e-10
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [... 67 4e-10
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 67 4e-10
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 67 5e-10
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ... 67 7e-10
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 66 9e-10
gi|39579438|emb|CAE56766.1| Hypothetical protein CBG24569 [Caeno... 66 9e-10
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 66 1e-09
gi|419944|pir||B44982 collagen COLA4 - pig roundworm >gnl|BL_ORD... 65 2e-09
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 65 2e-09
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 65 3e-09
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 64 6e-09
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 64 6e-09
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 64 6e-09
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 63 8e-09
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 63 1e-08
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 63 1e-08
gi|39595279|emb|CAE60316.1| Hypothetical protein CBG03907 [Caeno... 62 1e-08
gi|17507553|ref|NP_490679.1| COLlagen structural gene (col-45) [... 62 2e-08
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 61 4e-08
gi|17551374|ref|NP_510617.1| COLlagen structural gene (col-186) ... 61 4e-08
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 60 9e-08
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno... 60 9e-08
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ... 60 9e-08
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ... 60 9e-08
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 59 1e-07
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 59 1e-07
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e... 59 1e-07
gi|50511151|dbj|BAD32561.1| mKIAA1870 protein [Mus musculus] 59 2e-07
gi|37202117|ref|NP_079961.2| procollagen, type XXVII, alpha 1 [M... 59 2e-07
gi|28172191|emb|CAD62259.1| bM340H1.1 (novel collagen triple hel... 59 2e-07
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno... 59 2e-07
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno... 59 2e-07
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 58 2e-07
gi|14017957|dbj|BAB47499.1| KIAA1870 protein [Homo sapiens] 58 2e-07
gi|32140760|ref|NP_116277.2| collagen, type XXVII, alpha 1 [Homo... 58 2e-07
gi|21910274|ref|NP_664542.1| collagen-like protein SclB [Strepto... 58 2e-07
gi|17536751|ref|NP_495952.1| predicted CDS, COLlagen structural ... 58 2e-07
gi|33589142|emb|CAE45096.1| Hypothetical protein Y51H4A.28 [Caen... 58 3e-07
gi|4502961|ref|NP_000085.1| alpha 1 type VII collagen precursor;... 58 3e-07
gi|17533645|ref|NP_496367.1| COLlagen structural gene (col-83) [... 58 3e-07
gi|627406|pir||A54849 collagen alpha 1(VII) chain precursor - human 58 3e-07
gi|28895851|ref|NP_802201.1| SclB protein [Streptococcus pyogene... 58 3e-07
gi|495866|gb|AAA58965.1| collagen type VII [Homo sapiens] 58 3e-07
gi|33589138|emb|CAB82206.2| C. elegans COL-83 protein (correspon... 58 3e-07
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 58 3e-07
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 58 3e-07
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 58 3e-07
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 58 3e-07
gi|47214275|emb|CAG01332.1| unnamed protein product [Tetraodon n... 51 3e-07
gi|22027607|ref|NP_543004.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|22027603|ref|NP_543002.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|22027568|ref|NP_542988.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|22027587|ref|NP_542994.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|22027605|ref|NP_543003.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|22027577|ref|NP_542991.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|22027565|ref|NP_005194.3| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|9650749|emb|CAC00688.1| type XIII collagen [Homo sapiens] 57 6e-07
gi|22027571|ref|NP_542989.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|22027589|ref|NP_542995.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|22027591|ref|NP_542996.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|22027599|ref|NP_543000.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab... 57 6e-07
gi|22027593|ref|NP_542997.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ... 57 6e-07
gi|22027574|ref|NP_542990.2| alpha 1 type XIII collagen isoform ... 57 6e-07
gi|180374|gb|AAA51987.1| collagen (type XIII) alpha-1 chain 57 7e-07
gi|180756|gb|AAA52754.1| alpha-1 type XIII collagen 57 7e-07
gi|1360742|pir||B40983 collagen alpha 1(XIII) chain precursor - ... 57 7e-07
gi|5174770|gb|AAC35289.2| fibrillar collagen chain FAp1 alpha [A... 56 9e-07
gi|3777559|gb|AAC64934.1| collagen-like [Griffithsia japonica] 56 9e-07
gi|7505851|pir||T25835 hypothetical protein M01A12.1 - Caenorhab... 56 1e-06
gi|32565355|ref|NP_491651.2| predicted CDS, COLlagen structural ... 56 1e-06
gi|7441214|pir||S59513 collagen II A1 protein - zebra fish (frag... 56 1e-06
gi|48097742|ref|XP_391942.1| similar to ENSANGP00000021001 [Apis... 56 1e-06
gi|39594122|emb|CAE70232.1| Hypothetical protein CBG16719 [Caeno... 56 1e-06
gi|31240941|ref|XP_320884.1| ENSANGP00000019179 [Anopheles gambi... 56 1e-06
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 56 1e-06
gi|487070|pir||S37749 collagen alpha 2(XIV) chain - human (fragm... 55 2e-06
gi|283868|pir||S28791 collagen alpha 1(XI) chain - chicken (frag... 55 2e-06
gi|42658932|ref|XP_044622.3| collagen, type XIV, alpha 1 (unduli... 55 2e-06
gi|2119174|pir||S46657 collagen alpha 1(XIV) chain - human (frag... 55 2e-06
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ... 55 2e-06
gi|3242649|dbj|BAA29028.1| alpha 1 type I collagen [Rana catesbe... 55 2e-06
gi|975685|emb|CAA62496.1| alpha 1 type XI collagen [Mus musculus] 55 2e-06
gi|15779150|gb|AAH14640.1| COL14A1 protein [Homo sapiens] 55 2e-06
gi|2065167|emb|CAA72402.1| collagen type XIV [Homo sapiens] 55 2e-06
gi|39598239|emb|CAE68931.1| Hypothetical protein CBG14911 [Caeno... 55 2e-06
gi|807119|gb|AAB33149.1| type XIV collagen, collagen XIV {Col1 a... 55 2e-06
gi|37498968|gb|AAQ91575.1| collagen-like protein 3 [Streptococcu... 55 2e-06
gi|50751232|ref|XP_422303.1| PREDICTED: similar to alpha-1 type ... 55 2e-06
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 55 2e-06
gi|14280020|gb|AAK58847.1| collagen type XX alpha 1 precursor [G... 55 3e-06
gi|50758787|ref|XP_417417.1| PREDICTED: similar to collagen type... 55 3e-06
gi|17551340|ref|NP_509274.1| DumPY : shorter than wild-type DPY-... 55 3e-06
gi|39597352|emb|CAE59580.1| Hypothetical protein CBG02980 [Caeno... 54 4e-06
gi|38454234|ref|NP_942042.1| collagen, type XXVII, alpha 1; coll... 54 4e-06
gi|38014150|gb|AAH08760.3| COL5A1 protein [Homo sapiens] 54 4e-06
gi|115313|sp|P20908|CA15_HUMAN Collagen alpha 1(V) chain precurs... 54 4e-06
gi|1360669|pir||CGHU1V collagen alpha 1(V) chain precursor - hum... 54 4e-06
gi|16554579|ref|NP_000084.2| alpha 1 type V collagen preproprote... 54 4e-06
gi|38234407|ref|NP_940174.1| collagen-like repeat protein [Coryn... 54 4e-06
gi|26327181|dbj|BAC27334.1| unnamed protein product [Mus musculus] 54 5e-06
gi|29436389|gb|AAH49829.1| Col1a1-prov protein [Xenopus laevis] 54 5e-06
gi|29179577|gb|AAH49287.1| Col1a2-prov protein [Xenopus laevis] 54 5e-06
gi|6680962|ref|NP_031757.1| procollagen, type XIII, alpha 1; typ... 54 5e-06
gi|30021454|ref|NP_833085.1| Collagen-like triple helix repeat p... 54 5e-06
gi|48762667|ref|NP_892013.2| collagen, type I, alpha 2 [Danio re... 54 5e-06
gi|15209312|emb|CAC51030.1| procollagen type I alpha 2 chain [Da... 54 5e-06
gi|5739073|gb|AAD50327.1| type XIII collagen [Mus musculus] 54 5e-06
gi|11096155|gb|AAG30217.1| collagen-like surface protein [Strept... 54 5e-06
gi|71405|pir||CGCH1S collagen alpha 1(I) chain - chicken (tentat... 54 6e-06
gi|13242529|ref|NP_077542.1| EsV-1-57 [Ectocarpus siliculosus vi... 54 6e-06
gi|50749308|ref|XP_421581.1| PREDICTED: similar to type XIII col... 54 6e-06
gi|22027580|ref|NP_542992.2| alpha 1 type XIII collagen isoform ... 54 6e-06
gi|27924402|gb|AAH44962.1| LOC397739 protein [Xenopus laevis] 54 6e-06
gi|214044|gb|AAA49679.1| alpha-1 type II' collagen 54 6e-06
gi|85719|pir||A40333 collagen alpha 1'(II) chain precursor - Afr... 54 6e-06
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno... 54 6e-06
gi|45361285|ref|NP_989220.1| hypothetical protein MGC75588 [Xeno... 54 6e-06
gi|2119160|pir||I50629 collagen - chicken (fragment) >gnl|BL_ORD... 54 6e-06
gi|159960|gb|AAA29439.1| collagen-like protein 54 6e-06
gi|22027601|ref|NP_543001.2| alpha 1 type XIII collagen isoform ... 54 6e-06
gi|115268|sp|P02457|CA11_CHICK Collagen alpha 1(I) chain precursor 54 6e-06
gi|29387355|gb|AAH48221.1| COL2A1 protein [Xenopus laevis] 54 6e-06
gi|214042|gb|AAA49678.1| alpha-1 type II collagen 54 6e-06
gi|104010|pir||B40333 collagen alpha 1(II) chain precursor - Afr... 54 6e-06
gi|22027609|ref|NP_543005.2| alpha 1 type XIII collagen isoform ... 54 6e-06
gi|22027597|ref|NP_542999.2| alpha 1 type XIII collagen isoform ... 54 6e-06
gi|178320|gb|AAA51685.1| alpha-1 type XIII collagen 54 6e-06
gi|31340542|gb|AAO33039.2| alpha 1 type II procollagen [Gallus g... 53 8e-06
gi|26343131|dbj|BAC35222.1| unnamed protein product [Mus musculus] 53 8e-06
gi|31231975|ref|XP_318626.1| ENSANGP00000020977 [Anopheles gambi... 53 8e-06
gi|20380052|gb|AAH28178.1| COL3A1 protein [Homo sapiens] 53 8e-06
gi|1070603|pir||CGHU7L collagen alpha 1(III) chain precursor - h... 53 8e-06
gi|4502951|ref|NP_000081.1| alpha 1 type III collagen; Collagen ... 53 8e-06
gi|33417084|gb|AAH55991.1| MGC68894 protein [Xenopus laevis] 53 8e-06
gi|33563380|ref|NP_851794.1| procollagen, type XIV, alpha 1 [Mus... 53 8e-06
gi|50796210|ref|XP_423849.1| PREDICTED: alpha 1 type IIA collage... 53 8e-06
gi|2137076|pir||I48103 type VII collagen - Chinese hamster (frag... 53 8e-06
gi|45383309|ref|NP_989757.1| alpha 1 type IIA collagen precursor... 53 8e-06
gi|180829|gb|AAA52047.1| alpha-2 type IV collagen 53 8e-06
gi|47218417|emb|CAG12688.1| unnamed protein product [Tetraodon n... 53 8e-06
gi|104588|pir||S07133 collagen alpha 1(II) chain precursor - chi... 53 8e-06
gi|115286|sp|P02460|CA12_CHICK Collagen alpha 1(II) chain precursor 53 8e-06
gi|1072000|pir||S18251 collagen alpha 1(XI) chain - bovine (frag... 53 1e-05
gi|16357503|ref|NP_378667.1| type IV alpha 6 collagen isoform B ... 53 1e-05
gi|1674441|gb|AAB19039.1| collagen type IV a6 chain [Homo sapiens] 53 1e-05
gi|18202034|sp|O42350|CA21_RANCA Collagen alpha 2(I) chain precu... 53 1e-05
gi|15831485|ref|NP_310258.1| putative tail fiber protein [Escher... 53 1e-05
gi|211616|gb|AAA48705.1| type VI collagen, alpha-2 subunit 53 1e-05
gi|11096149|gb|AAG30214.1| collagen-like surface protein [Strept... 53 1e-05
gi|45384382|ref|NP_990679.1| type VI collagen alpha-2 subunit [G... 53 1e-05
gi|2833342|sp|Q28083|CA1B_BOVIN Collagen alpha 1(XI) chain >gnl|... 53 1e-05
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno... 53 1e-05
gi|30076|emb|CAA29076.1| unnamed protein product [Homo sapiens] 53 1e-05
gi|34866357|ref|XP_238554.2| similar to type VII collagen [Rattu... 53 1e-05
gi|17986277|ref|NP_001837.1| alpha 2 type IV collagen preproprot... 53 1e-05
gi|1850097|dbj|BAA09791.1| a6(IV) collagen [Homo sapiens] 53 1e-05
gi|48895223|ref|ZP_00328207.1| COG4675: Microcystin-dependent pr... 53 1e-05
gi|23468133|ref|ZP_00123691.1| COG5295: Autotransporter adhesin ... 53 1e-05
gi|30354436|gb|AAH52161.1| Procollagen, type XI, alpha 1 [Mus mu... 53 1e-05
gi|6680958|ref|NP_031755.1| procollagen, type XI, alpha 1; pro-a... 53 1e-05
gi|212861|gb|AAA49132.1| type VI collagen 53 1e-05
gi|39597664|emb|CAE68355.1| Hypothetical protein CBG14092 [Caeno... 53 1e-05
gi|8953371|emb|CAB96748.1| bA448E12.1 (collagen, type IV, alpha ... 53 1e-05
gi|104612|pir||S23377 collagen alpha 2(VI) chain short form prec... 53 1e-05
gi|7532790|gb|AAF63232.1| ORF-401-like protein [prophage P-EibA] 53 1e-05
gi|28202250|sp|Q14031|CA64_HUMAN Collagen alpha 6(IV) chain prec... 53 1e-05
gi|1674440|gb|AAB19038.1| collagen type IV a6 chain [Homo sapiens] 53 1e-05
gi|16357501|ref|NP_001838.1| type IV alpha 6 collagen isoform A ... 53 1e-05
gi|456277|gb|AAA16338.1| alpha-6 type IV collagen 53 1e-05
gi|466538|dbj|BAA04809.1| collagen [Homo sapiens] 53 1e-05
gi|37498977|gb|AAQ91579.1| collagen-like protein 3 [Streptococcu... 53 1e-05
gi|18157524|dbj|BAB83839.1| collagen type XI alpha 2~partially s... 53 1e-05
gi|21706756|gb|AAH34164.1| Col13a1 protein [Mus musculus] 53 1e-05
gi|15149479|ref|NP_149162.1| alpha 1 type II collagen isoform 2,... 52 1e-05
gi|115287|sp|P02458|CA12_HUMAN Collagen alpha 1(II) chain precur... 52 1e-05
gi|5360532|dbj|BAA82043.1| alpha1 type II collagen [Cynops pyrrh... 52 1e-05
gi|6680972|ref|NP_031764.1| procollagen, type VII, alpha 1 [Mus ... 52 1e-05
gi|34866496|ref|XP_235308.2| similar to collagen type XIV [Rattu... 52 1e-05
gi|50757087|ref|XP_429250.1| PREDICTED: hypothetical protein XP_... 52 1e-05
gi|7670050|dbj|BAA94972.1| type I collagen alpha 1 [Xenopus laevis] 52 1e-05
gi|15830098|ref|NP_308871.1| putative tail fiber protein [Escher... 52 1e-05
gi|930050|emb|CAA32030.1| alpha-1 type 2 collagen (714 AA) [Homo... 52 1e-05
gi|13435125|ref|NP_001835.2| alpha 1 type II collagen isoform 1;... 52 1e-05
gi|1070602|pir||CGHU6C collagen alpha 1(II) chain precursor [val... 52 1e-05
gi|9632525|ref|NP_049519.1| putative tail fiber protein [Bacteri... 52 1e-05
gi|7649887|dbj|BAA94165.1| tail fiber protein [Escherichia coli ... 52 1e-05
gi|31239125|ref|XP_319976.1| ENSANGP00000022392 [Anopheles gambi... 52 1e-05
gi|13235586|emb|CAC33776.1| SclB protein [Streptococcus pyogenes] 52 1e-05
gi|15830377|ref|NP_309150.1| putative tail fiber protein [Escher... 52 1e-05
gi|46048885|ref|NP_990121.1| alpha 1 (V) collagen [Gallus gallus... 52 1e-05
gi|115326|sp|P08125|CA1A_CHICK Collagen alpha 1(X) chain precursor 52 1e-05
gi|19745166|ref|NP_604447.1| collagen, type V, alpha 1 [Rattus n... 52 1e-05
gi|15801584|ref|NP_287601.1| putative tail fiber protein of prop... 52 1e-05
gi|30041|emb|CAA34683.1| COL2A1 [Homo sapiens] 52 1e-05
gi|191151|gb|AAA37002.1| pro-alpha-1 type V collagen 52 1e-05
gi|551558|gb|AAA62386.1| type V collagen 52 1e-05
gi|258774|gb|AAB23914.1| type II collagen alpha 1 chain, COL2A1 ... 52 1e-05
gi|7656987|ref|NP_056549.1| procollagen, type V, alpha 1; pro-al... 52 1e-05
gi|7441219|pir||S18803 collagen alpha 1(V) chain - hamster 52 1e-05
gi|17481334|dbj|BAB79229.1| type I collagen alpha 2 chain [Oncor... 52 1e-05
gi|15801943|ref|NP_287964.1| putative tail fiber protein of cryp... 52 1e-05
gi|19848530|gb|AAK15783.1| collagen IV alpha 1 chain precursor [... 52 1e-05
gi|476846|pir||A45748 collagen alpha 1(VII) chain - mouse (fragm... 52 1e-05
gi|20065816|ref|NP_612899.1| hypothetical protein Stx2Ip020 [Stx... 52 1e-05
gi|18202250|sp|O93484|CA21_ONCMY Collagen alpha 2(I) chain precu... 52 1e-05
gi|34859865|ref|XP_342326.1| similar to type XI collagen alpha-1... 52 1e-05
gi|211700|gb|AAA48736.1| type X collagen 52 1e-05
gi|11096143|gb|AAG30211.1| collagen-like surface protein [Strept... 52 1e-05
gi|31745150|ref|NP_853667.1| procollagen, type XXIII, alpha 1 [R... 52 1e-05
gi|34852653|ref|XP_228282.2| similar to collagen type XIII alpha... 52 1e-05
gi|180396|gb|AAA51997.1| collagen alpha-1(II) 52 2e-05
gi|21410158|gb|AAH30913.1| Col2a1 protein [Mus musculus] 52 2e-05
gi|11276913|pir||T45467 collagen alpha 1(II) chain precursor [im... 52 2e-05
gi|47550915|ref|NP_999631.1| 3 alpha procollagen [Strongylocentr... 52 2e-05
gi|24210303|emb|CAD54661.1| SI:dZ12F11.3 (collagen type XI alpha... 52 2e-05
gi|422532|pir||A45407 collagen alpha 3(IV) chain - sea urchin (S... 52 2e-05
gi|109679|pir||B41182 collagen alpha 1(II) chain precursor (long... 52 2e-05
gi|10947027|gb|AAC62178.2| type IIA procollagen [Canis familiaris] 52 2e-05
gi|11096141|gb|AAG30210.1| collagen-like surface protein [Strept... 52 2e-05
gi|4140029|dbj|BAA36973.1| alpha 1 type I collagen [Cynops pyrrh... 52 2e-05
gi|6165883|gb|AAF04726.1| collagen type XI alpha-a isoform B [Ho... 52 2e-05
gi|18375520|ref|NP_542196.1| alpha 1 type XI collagen isoform B ... 52 2e-05
gi|6165881|gb|AAF04724.1| collagen type XI alpha-1 [Homo sapiens] 52 2e-05
gi|13624305|ref|NP_112440.1| procollagen, type II, alpha 1; disp... 52 2e-05
gi|18375522|ref|NP_542197.1| alpha 1 type XI collagen isoform C ... 52 2e-05
gi|200216|gb|AAA68102.1| pro-alpha-1 type II collagen 52 2e-05
gi|15802413|ref|NP_288439.1| putative tail fiber protein of prop... 52 2e-05
gi|15801757|ref|NP_287775.1| putative tail fiber protein encoded... 52 2e-05
gi|4519617|dbj|BAA75668.1| collagen pro alpha-chain [Haliotis di... 52 2e-05
gi|1173848|gb|AAB41274.1| type V collagen 52 2e-05
gi|11096139|gb|AAG30209.1| collagen-like surface protein [Strept... 52 2e-05
gi|21431496|sp||P12105_1 [Segment 1 of 3] Collagen alpha 1(III) ... 52 2e-05
gi|39936655|ref|NP_948931.1| Collagen triple helix repeat:Antifr... 52 2e-05
gi|15675773|ref|NP_269947.1| collagen-like surface protei [Strep... 52 2e-05
gi|26390235|dbj|BAC25865.1| unnamed protein product [Mus musculus] 52 2e-05
gi|47551001|ref|NP_999674.1| alpha-1 collagen [Strongylocentrotu... 52 2e-05
gi|6165882|gb|AAF04725.1| collagen type XI alpha-1 isoform A [Ho... 52 2e-05
gi|18375518|ref|NP_001845.2| alpha 1 type XI collagen isoform A ... 52 2e-05
gi|21542396|sp|P12107|CA1B_HUMAN Collagen alpha 1(XI) chain prec... 52 2e-05
gi|1360670|pir||CGHU1E collagen alpha 1(XI) chain precursor - hu... 52 2e-05
gi|50732501|ref|XP_418665.1| PREDICTED: similar to alpha-2 type ... 52 2e-05
gi|200217|gb|AAA68101.1| pro-alpha-1 type II collagen 52 2e-05
gi|103623|pir||A32249 collagen - sea urchin (Paracentrotus livid... 52 2e-05
gi|50750043|ref|XP_421847.1| PREDICTED: similar to [Segment 3 of... 52 2e-05
gi|115288|sp|P28481|CA12_MOUSE Collagen alpha 1(II) chain precur... 52 2e-05
gi|15831971|ref|NP_310744.1| putative tail fiber protein [Escher... 52 2e-05
gi|180811|gb|AAA52038.1| type II collagen 52 2e-05
gi|15832195|ref|NP_310968.1| putative tail fiber protein [Escher... 52 2e-05
gi|27696597|gb|AAH43317.1| Col4a5 protein [Mus musculus] 52 2e-05
gi|15800888|ref|NP_286904.1| putative tail component encoded by ... 52 2e-05
gi|15831246|ref|NP_310019.1| putative tail fiber protein [Escher... 52 2e-05
gi|109680|pir||A41182 collagen alpha 1(II) chain precursor - mouse 52 2e-05
gi|30410850|gb|AAH51383.1| Col2a1 protein [Mus musculus] 52 2e-05
gi|6978677|ref|NP_037061.1| procollagen, type II, alpha 1; Proco... 52 2e-05
gi|23510253|ref|NP_700442.1| procollagen, type XXIII, alpha 1; c... 52 2e-05
gi|30353888|gb|AAH52326.1| Col2a1 protein [Mus musculus] 52 2e-05
gi|47229302|emb|CAG04054.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|37589303|gb|AAH59281.1| Col1a1 protein [Mus musculus] 52 2e-05
gi|47223017|emb|CAG07104.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|192287|gb|AAA37342.1| collagen IV alpha subunit 52 2e-05
gi|47229883|emb|CAG07079.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|13096810|gb|AAH03198.1| Col1a1 protein [Mus musculus] 52 2e-05
gi|47229446|emb|CAF99434.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|476420|pir||CGBO1S collagen alpha 1(I) chain - bovine (tentat... 52 2e-05
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 52 2e-05
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >... 52 2e-05
gi|115349|sp|P08572|CA24_HUMAN Collagen alpha 2(IV) chain precur... 52 2e-05
gi|37537826|sp|Q96A84|EMU1_HUMAN Emu1 protein precursor (Emilin ... 52 2e-05
gi|18028926|gb|AAL56219.1| alpha-3 type IX collagen [Mus musculus] 52 2e-05
gi|27734650|sp||P02453_2 [Segment 2 of 2] Collagen alpha 1(I) chain 52 2e-05
gi|32566102|ref|NP_508100.2| COLlagen structural gene (col-19) [... 52 2e-05
gi|29789010|ref|NP_034066.1| procollagen, type IX, alpha 3 [Mus ... 52 2e-05
gi|28204822|gb|AAH46358.1| EMI domain containing 1 [Homo sapiens] 52 2e-05
gi|50511941|ref|NP_597712.2| EMI domain containing 1; putative e... 52 2e-05
gi|47216921|emb|CAG02093.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|50417967|gb|AAH77292.1| Unknown (protein for MGC:80136) [Xeno... 52 2e-05
gi|4519619|dbj|BAA75669.1| collagen pro alpha-chain [Haliotis di... 52 2e-05
gi|37498972|gb|AAQ91577.1| collagen-like protein 3 [Streptococcu... 52 2e-05
gi|2506305|sp|P11087|CA11_MOUSE Collagen alpha 1(I) chain precur... 52 2e-05
gi|2894106|emb|CAB01633.1| Collagen alpha1 [Rattus norvegicus] 52 2e-05
gi|27688933|ref|XP_213440.1| similar to Collagen alpha1 [Rattus ... 52 2e-05
gi|34328108|ref|NP_031768.2| procollagen, type I, alpha 1 [Mus m... 52 2e-05
gi|84432|pir||JS0170 collagen col-19 - Caenorhabditis elegans >g... 52 2e-05
gi|29566025|ref|NP_817595.1| gp4 [Mycobacteriophage Bxz2] >gnl|B... 52 2e-05
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 52 2e-05
gi|15800518|ref|NP_286530.1| putative tail component of prophage... 51 3e-05
gi|180377|gb|AAA51990.1| A collagen (type XIII) alpha-1 chain 51 3e-05
gi|34879630|ref|XP_225043.2| similar to Collagen alpha 2(IV) cha... 51 3e-05
gi|47229594|emb|CAG06790.1| unnamed protein product [Tetraodon n... 51 3e-05
gi|38490686|emb|CAE53096.1| alpha-5 collagen [Paracentrotus livi... 51 3e-05
gi|26348489|dbj|BAC37884.1| unnamed protein product [Mus musculus] 51 3e-05
gi|41393113|ref|NP_958886.1| collagen, type I, alpha 3 [Danio re... 51 3e-05
gi|42542708|gb|AAH66384.1| Collagen, type I, alpha 3 [Danio rerio] 51 3e-05
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno... 51 3e-05
gi|180378|gb|AAA51991.1| B collagen (type XIII) alpha-1 chain 51 3e-05
gi|47564495|ref|ZP_00235540.1| collagen-like triple helix repeat... 51 3e-05
gi|21362285|ref|NP_083142.2| WD repeat domain 33 [Mus musculus] ... 51 3e-05
gi|17481338|dbj|BAB79230.1| type I collagen alpha 2 chain [Oncor... 51 3e-05
gi|26327611|dbj|BAC27549.1| unnamed protein product [Mus musculus] 51 3e-05
gi|34879809|ref|XP_343779.1| similar to type IV collagen alpha 5... 51 3e-05
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ... 51 3e-05
gi|2119156|pir||S28774 collagen alpha chain - tube worm (Riftia ... 51 3e-05
gi|4502959|ref|NP_000384.1| alpha 2 type V collagen preproprotei... 51 3e-05
gi|1340175|emb|CAA28454.1| unnamed protein product [Homo sapiens] 51 3e-05
gi|23468050|ref|ZP_00123621.1| COG5295: Autotransporter adhesin ... 51 3e-05
gi|34875814|ref|XP_343565.1| collagen, type V, alpha 2 [Rattus n... 51 3e-05
gi|16197600|gb|AAL13166.1| type V preprocollagen alpha 2 chain [... 51 3e-05
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 51 3e-05
gi|48140714|ref|XP_393523.1| similar to ENSANGP00000019179 [Apis... 51 3e-05
gi|18309937|ref|NP_561871.1| collagen-like protein [Clostridium ... 51 3e-05
gi|47215142|emb|CAG12433.1| unnamed protein product [Tetraodon n... 51 4e-05
gi|180715|gb|AAA52034.1| alpha-2 type XI collagen 51 4e-05
gi|21105303|gb|AAM34601.1| precollagen-D [Mytilus galloprovincia... 51 4e-05
gi|21105299|gb|AAM34599.1| precollagen-NG [Mytilus galloprovinci... 51 4e-05
gi|48098607|ref|XP_392097.1| similar to ENSANGP00000016783 [Apis... 51 4e-05
gi|47222134|emb|CAG11560.1| unnamed protein product [Tetraodon n... 51 4e-05
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ... 51 4e-05
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 51 4e-05
gi|36031080|ref|NP_034062.2| procollagen, type IV, alpha 2 [Mus ... 51 4e-05
gi|27882587|gb|AAH43696.1| Similar to procollagen, type V, alpha... 51 4e-05
gi|7428703|pir||CGCH2S collagen alpha 2(I) chain precursor - chi... 51 4e-05
gi|33149359|gb|AAO64414.1| type VII collagen [Canis familiaris] 51 4e-05
gi|1360671|pir||CGHU2E collagen alpha 2(XI) chain precursor - hu... 51 4e-05
gi|71414|pir||CGBO2S collagen alpha 2(I) chain - bovine (fragment) 51 4e-05
gi|50758084|ref|XP_415753.1| PREDICTED: similar to putative emu2... 51 4e-05
gi|39935868|ref|NP_948144.1| Collagen triple helix repeat [Rhodo... 51 4e-05
gi|18201919|ref|NP_542412.1| alpha 2 type XI collagen isoform 2 ... 51 4e-05
gi|26343805|dbj|BAC35559.1| unnamed protein product [Mus musculus] 51 4e-05
gi|1000745|gb|AAC50213.1| Pro-a2(XI) 51 4e-05
gi|47564048|ref|NP_001001135.1| cyanogen bromide [Bos taurus] >g... 51 4e-05
gi|8134354|sp|Q9XSJ7|CA11_CANFA Collagen alpha 1(I) chain precur... 51 4e-05
gi|6680978|ref|NP_031767.1| procollagen, type IX, alpha 2 [Mus m... 51 4e-05
gi|18201917|ref|NP_542411.1| alpha 2 type XI collagen isoform 1 ... 51 4e-05
gi|5732934|gb|AAD49346.1| pro-alpha-1 type 1 collagen [Cavia por... 51 4e-05
gi|13432104|sp|P13942|CA2B_HUMAN Collagen alpha 2(XI) chain prec... 51 4e-05
gi|3820987|emb|CAA20240.1| dJ1033B10.12 (collagen, type XI, alph... 51 4e-05
gi|1000746|gb|AAC50214.1| Pro-a2(XI) >gnl|BL_ORD_ID|593459 gi|15... 51 4e-05
gi|50750041|ref|XP_421846.1| PREDICTED: similar to procollagen t... 51 4e-05
gi|1778210|gb|AAC47545.1| fibrillar collagen [Arenicola marina] 51 4e-05
gi|6680970|ref|NP_031763.1| procollagen, type V, alpha 2 [Mus mu... 51 4e-05
gi|32822777|gb|AAH55077.1| Procollagen, type V, alpha 2 [Mus mus... 51 4e-05
gi|27657427|emb|CAD60250.1| putative collagen type XI alpha 1 [S... 51 4e-05
gi|49523658|emb|CAD88876.1| hypothetical protein [Phage phi 4795] 51 4e-05
gi|47229954|emb|CAG10368.1| unnamed protein product [Tetraodon n... 51 4e-05
gi|1000747|gb|AAC50215.1| Pro-a2(XI) 51 4e-05
gi|280636|pir||A36226 collagen alpha 1 chain - sea urchin (Parac... 51 4e-05
gi|18201915|ref|NP_542410.1| alpha 2 type XI collagen isoform 3 ... 51 4e-05
gi|34878620|ref|XP_226076.2| similar to putative WDC146 [Rattus ... 51 4e-05
gi|115269|sp|P02452|CA11_HUMAN Collagen alpha 1(I) chain precursor 51 4e-05
gi|4755085|gb|AAB94054.2| pro alpha 1(I) collagen [Homo sapiens] 50 5e-05
gi|47087124|ref|NP_997693.1| procollagen, type XI, alpha 2; coll... 50 5e-05
gi|180392|gb|AAA51995.1| alpha 1 (I) chain propeptide 50 5e-05
gi|1888409|emb|CAA67261.1| collagen type I alpha 1 [Homo sapiens] 50 5e-05
gi|2190498|emb|CAA65082.1| collagen type IV [Pseudocorticium jar... 50 5e-05
gi|16758080|ref|NP_445808.1| procollagen, type I, alpha 2 [Rattu... 50 5e-05
gi|14164347|dbj|BAB55661.1| collagen a1(I) [Oncorhynchus mykiss] 50 5e-05
gi|30021453|ref|NP_833084.1| Collagen-like triple helix repeat p... 50 5e-05
gi|49479306|ref|YP_036570.1| possible exosporium protein H [Baci... 50 5e-05
gi|33859528|ref|NP_034061.1| procollagen, type IV, alpha 1 [Mus ... 50 5e-05
gi|17137252|ref|NP_477190.1| CG16858-PA [Drosophila melanogaster... 50 5e-05
gi|9453886|dbj|BAB03287.1| pro-alpha 1 type V/XI collagen [Pagru... 50 5e-05
gi|7656989|ref|NP_056534.1| collagen, type V, alpha 3 preproprot... 50 5e-05
gi|18640526|ref|NP_570367.1| collagen alpha 1(I) chain precursor... 50 5e-05
gi|3641657|dbj|BAA33380.1| alpha 1 type I collagen [Oncorhynchus... 50 5e-05
gi|179521|gb|AAA51839.1| BPAG2 50 5e-05
gi|5354049|gb|AAD42346.1| type II collagen cyanogen bromide frag... 50 5e-05
gi|1333876|emb|CAA26132.1| basement membrane collagen alpha1(IV)... 50 5e-05
gi|49117309|gb|AAH72650.1| Col4a1 protein [Mus musculus] 50 5e-05
gi|6753482|ref|NP_034056.1| procollagen, type XI, alpha 2 [Mus m... 50 5e-05
gi|50733060|ref|XP_426008.1| PREDICTED: similar to alpha 3 type ... 50 5e-05
gi|34784640|gb|AAH56620.1| Col4a1 protein [Mus musculus] 50 5e-05
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno... 50 5e-05
gi|47226468|emb|CAG08484.1| unnamed protein product [Tetraodon n... 50 5e-05
gi|50754535|ref|XP_425157.1| PREDICTED: similar to type VII coll... 50 5e-05
gi|2134839|pir||A61262 collagen alpha 1(XVII) chain - human (fra... 50 5e-05
gi|26788083|emb|CAD58730.1| SI:bY143E18.1 (novel protein similar... 50 5e-05
gi|20988703|gb|AAH29697.1| Procollagen, type IX, alpha 2 [Mus mu... 50 5e-05
gi|49477241|ref|YP_035673.1| collagen-like protein [Bacillus thu... 50 5e-05
gi|34879634|ref|XP_214400.2| similar to collagen alpha 1(IV) cha... 50 5e-05
gi|30054|emb|CAA29886.1| alpha1 (III) collagen [Homo sapiens] 50 5e-05
gi|18641354|ref|NP_000485.2| alpha 1 type XVII collagen; collage... 50 5e-05
gi|48994844|gb|AAT48109.1| mutant collagen alpha 1(I) chain [syn... 50 5e-05
gi|30316381|sp|Q64739|CA2B_MOUSE Collagen alpha 2(XI) chain prec... 50 5e-05
gi|9588138|emb|CAC00589.1| bA16H23.2 (collagen, type XVII, alpha... 50 5e-05
gi|41688524|sp|Q9UMD9|CA1G_HUMAN Collagen alpha 1(XVII) chain (B... 50 5e-05
gi|46372001|gb|AAO33458.2| type IV collagen alpha 5 [Canis famil... 50 5e-05
gi|930045|emb|CAA33387.1| alpha-1 (III) collagen [Homo sapiens] 50 5e-05
gi|17543368|ref|NP_501338.1| COLlagen structural gene (col-115) ... 50 5e-05
gi|211606|gb|AAA69961.1| alpha-2 type I collagen [Gallus gallus]... 50 5e-05
gi|4502945|ref|NP_000079.1| alpha 1 type I collagen preproprotei... 50 5e-05
gi|48112109|ref|XP_396317.1| similar to CG33171-PC [Apis mellifera] 50 5e-05
gi|2144803|pir||CGHU1S collagen alpha 1(I) chain precursor - human 50 5e-05
gi|22328092|gb|AAH36531.1| Alpha 1 type I collagen, preproprotei... 50 5e-05
gi|38173761|gb|AAH60753.1| MGC69046 protein [Xenopus laevis] 50 5e-05
gi|34870917|ref|XP_342903.1| similar to procollagen, type IX, al... 50 5e-05
gi|5921192|sp|P02467|CA21_CHICK Collagen alpha 2(I) chain precursor 50 5e-05
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno... 50 7e-05
gi|22027583|ref|NP_542993.2| alpha 1 type XIII collagen isoform ... 50 7e-05
gi|38570075|ref|NP_942014.1| collagen, type XXV, alpha 1 isoform... 50 7e-05
gi|13625304|gb|AAK35008.1| collagen-like Alzheimer amyloid plaqu... 50 7e-05
gi|22027595|ref|NP_542998.2| alpha 1 type XIII collagen isoform ... 50 7e-05
gi|6680968|ref|NP_031760.1| procollagen, type IV, alpha 3 [Mus m... 50 7e-05
gi|45384490|ref|NP_990665.1| collagen XIV [Gallus gallus] >gnl|B... 50 7e-05
gi|47218418|emb|CAG12689.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|34854963|ref|XP_231478.2| similar to matrilin 2 precursor [Ra... 50 7e-05
gi|1418930|emb|CAA98969.1| prepro-alpha2(I) collagen [Homo sapiens] 50 7e-05
gi|32451581|gb|AAH54498.1| Alpha 2 type I collagen [Homo sapiens... 50 7e-05
gi|8134352|sp|O46392|CA21_CANFA Collagen alpha 2(I) chain precur... 50 7e-05
gi|48762934|ref|NP_000080.2| alpha 2 type I collagen; Collagen I... 50 7e-05
gi|34859869|ref|XP_342327.1| procollagen type XI alpha 1 [Rattus... 50 7e-05
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ... 50 7e-05
gi|2388555|gb|AAB69977.1| alpha2(I) collagen [Homo sapiens] 50 7e-05
gi|21105301|gb|AAM34600.1| precollagen-P [Mytilus galloprovincia... 50 7e-05
gi|825646|emb|CAA23761.1| unnamed protein product [Homo sapiens] 50 7e-05
gi|13560500|gb|AAK30078.1| collagen-like protein B [Streptococcu... 50 7e-05
gi|11875612|gb|AAG40729.1| type IV collagen alpha 1 chain precur... 50 7e-05
gi|7441226|pir||S31212 collagen alpha 1(XIV) chain precursor, sh... 50 7e-05
gi|15021422|gb|AAK77699.1| ORF30, putative collagen [shrimp whit... 50 7e-05
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita] 50 7e-05
gi|17158634|ref|NP_477523.1| wsv001 [shrimp white spot syndrome ... 50 7e-05
gi|47551003|ref|NP_999675.1| alpha-2 collagen [Strongylocentrotu... 50 7e-05
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (... 50 7e-05
gi|3172000|emb|CAA06511.1| collagen alpha 1 (XI) [Rattus norvegi... 50 7e-05
gi|47216524|emb|CAG02175.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|46906212|emb|CAA46928.2| collagen type XIV/undulin [Gallus ga... 50 7e-05
gi|115328|sp|P20909|CA1B_RAT COLLAGEN ALPHA 1(XI) CHAIN >gnl|BL_... 50 7e-05
gi|33468851|ref|NP_031762.1| procollagen, type IV, alpha 5 [Mus ... 50 7e-05
gi|27806257|ref|NP_776945.1| collagen, type I, alpha 2 [Bos taur... 50 7e-05
gi|180879|gb|AAB59383.1| alpha-1 type III collagen 50 7e-05
gi|39595057|emb|CAE70925.1| Hypothetical protein CBG17725 [Caeno... 50 7e-05
gi|38570073|ref|NP_115907.2| collagen, type XXV, alpha 1 isoform... 50 7e-05
gi|13625306|gb|AAK35009.1| collagen-like Alzheimer amyloid plaqu... 50 7e-05
gi|38076572|ref|XP_143327.2| similar to INNER EAR-SPECIFIC COLLA... 50 7e-05
gi|48104621|ref|XP_392960.1| similar to alpha 1 type IX collagen... 50 7e-05
gi|529398|gb|AAA52039.1| alpha-1 type II collagen 50 7e-05
>gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)
[Caenorhabditis elegans]
gi|7495060|pir||T32371 hypothetical protein C01B12.1 -
Caenorhabditis elegans
gi|2429435|gb|AAB70974.1| Collagen protein 67 [Caenorhabditis
elegans]
Length = 298
Score = 313 bits (801), Expect = 4e-84
Identities = 169/298 (56%), Positives = 169/298 (56%)
Frame = +1
Query: 1 MMETSEHKELRRXXXXXXXXXXXXXXXXXXXLPMLYSYVAGFQSHLIIEADFCKTRSRDM 180
MMETSEHKELRR LPMLYSYVAGFQSHLIIEADFCKTRSRDM
Sbjct: 1 MMETSEHKELRRVAFFAIVVSTVAVIAAIVILPMLYSYVAGFQSHLIIEADFCKTRSRDM 60
Query: 181 WAQIHDIDGPHLFHRQKRQYSSPNXXXXXXXXXXVTNSEPAPTCCSCQQXXXXXXXXXXX 360
WAQIHDIDGPHLFHRQKRQYSSPN VTNSEPAPTCCSCQQ
Sbjct: 61 WAQIHDIDGPHLFHRQKRQYSSPNPPAAGGYGAPVTNSEPAPTCCSCQQGPAGPPGPPGD 120
Query: 361 XXXXXXXXXXXXXXTDGKEGSLLESAIVNEPCIICXXXXXXXXXXXXXXXXXXXXXXXXX 540
TDGKEGSLLESAIVNEPCIIC
Sbjct: 121 DGNGGQDGVRGNDGTDGKEGSLLESAIVNEPCIICPPGPPGPQGMAGAKGPQGPKGGNGD 180
Query: 541 XXXXXXXXXXXXXXXXXXXXXXXXXXVSGPKGAPGRINQINGPAGPAGHKGVRGPPGPRG 720
VSGPKGAPGRINQINGPAGPAGHKGVRGPPGPRG
Sbjct: 181 NGPDGKAGANGMQGPPGMMGPPGRQGVSGPKGAPGRINQINGPAGPAGHKGVRGPPGPRG 240
Query: 721 EAGLDGGNSEGPQGPQGDAGRXXXXXXXXXXXXXXXXXXXXXXXXCEHCPIPRTPPGY 894
EAGLDGGNSEGPQGPQGDAGR CEHCPIPRTPPGY
Sbjct: 241 EAGLDGGNSEGPQGPQGDAGRPGPVGEQGPQGPEGPQGPPGEPGGCEHCPIPRTPPGY 298