Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C01G10_7
(975 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17557458|ref|NP_506716.1| citrate lyase (5P567) [Caenorhabdit... 607 e-172
gi|39583345|emb|CAE66319.1| Hypothetical protein CBG11570 [Caeno... 579 e-164
gi|50730613|ref|XP_416971.1| PREDICTED: similar to citrate lyase... 255 9e-67
gi|34876091|ref|XP_240311.2| similar to citrate lyase beta like ... 254 2e-66
gi|14530763|emb|CAC42469.1| bA134O15.1 (similar to citrate lyase... 254 3e-66
gi|45545437|ref|NP_996531.1| citrate lyase beta like [Homo sapie... 254 3e-66
gi|21706438|gb|AAH34360.1| Citrate lyase beta like [Homo sapiens... 253 4e-66
gi|19173728|ref|NP_083832.1| citrate lyase beta like [Mus muscul... 251 1e-65
gi|12844088|dbj|BAB26232.1| unnamed protein product [Mus musculu... 251 1e-65
gi|50255830|gb|EAL18562.1| hypothetical protein CNBJ2030 [Crypto... 163 6e-39
gi|32422979|ref|XP_331933.1| hypothetical protein [Neurospora cr... 155 2e-36
gi|12832942|dbj|BAB22319.1| unnamed protein product [Mus musculus] 150 4e-35
gi|46106885|ref|XP_380616.1| hypothetical protein FG00440.1 [Gib... 148 2e-34
gi|49079250|ref|XP_403292.1| hypothetical protein UM05677.1 [Ust... 139 7e-32
gi|15789826|ref|NP_279650.1| citrate (pro-3S)-lyase; CitE [Halob... 137 5e-31
gi|47220156|emb|CAG07297.1| unnamed protein product [Tetraodon n... 136 8e-31
gi|13473726|ref|NP_105294.1| Citrate lyase beta chain (acyl lyas... 134 4e-30
gi|34763818|ref|ZP_00144729.1| Citrate lyase beta chain; Citryl-... 133 5e-30
gi|49092506|ref|XP_407714.1| hypothetical protein AN3577.2 [Aspe... 133 7e-30
gi|19704714|ref|NP_604276.1| Citrate lyase beta chain; Citryl-Co... 132 1e-29
gi|39933310|ref|NP_945586.1| putative Citrate lyase beta chain (... 130 3e-29
gi|15675157|ref|NP_269331.1| putative citrate lyase, beta subuni... 130 5e-29
gi|29377761|ref|NP_816915.1| citrate lyase, beta subunit [Entero... 129 8e-29
gi|18310130|ref|NP_562064.1| citrate lyase beta subunit [Clostri... 129 1e-28
gi|19746124|ref|NP_607260.1| putative citrate lyase, beta subuni... 129 1e-28
gi|41033633|emb|CAF18483.1| citrate lyase beta subunit [Thermopr... 129 1e-28
gi|48866238|ref|ZP_00320094.1| COG2301: Citrate lyase beta subun... 128 2e-28
gi|21910369|ref|NP_664637.1| putative citrate lyase beta subunit... 128 2e-28
gi|15898098|ref|NP_342703.1| Citryl-CoA lyase beta subunit homol... 128 2e-28
gi|28212051|ref|NP_782995.1| citrate lyase beta chain; citryl-co... 126 7e-28
gi|28377896|ref|NP_784788.1| citrate lyase, beta chain [Lactobac... 126 9e-28
gi|42527140|ref|NP_972238.1| citrate lyase, beta subunit [Trepon... 124 3e-27
gi|24379459|ref|NP_721414.1| putative citrate lyase CilB, citryl... 123 6e-27
gi|16127889|ref|NP_422453.1| citrate lyase beta subunit, putativ... 122 2e-26
gi|28212138|ref|NP_783082.1| citrate lyase beta chain [Clostridi... 120 5e-26
gi|11281333|pir||T46730 citrate (pro-3S)-lyase (EC 4.1.3.6) beta... 120 6e-26
gi|49236953|ref|ZP_00331009.1| COG2301: Citrate lyase beta subun... 119 1e-25
gi|45548212|ref|ZP_00188246.1| COG2301: Citrate lyase beta subun... 119 1e-25
gi|14600622|ref|NP_147139.1| citrate lyase beta chain [Aeropyrum... 118 2e-25
gi|45684249|ref|ZP_00195680.1| COG2301: Citrate lyase beta subun... 117 3e-25
gi|45914548|ref|ZP_00196725.1| COG2301: Citrate lyase beta subun... 115 2e-24
gi|15966929|ref|NP_387282.1| PROBABLE CITRATE LYASE BETA CHAIN (... 115 2e-24
gi|3913247|sp|O53078|CILB_LEUMC Citrate lyase beta chain (Citras... 114 3e-24
gi|15640816|ref|NP_230447.1| citrate lyase, beta subunit [Vibrio... 114 3e-24
gi|23015163|ref|ZP_00054947.1| COG2301: Citrate lyase beta subun... 113 6e-24
gi|46913897|emb|CAG20679.1| putative citrate lyase, beta subunit... 112 1e-23
gi|17988758|ref|NP_541391.1| CITRATE LYASE BETA CHAIN / CITRYL-C... 111 2e-23
gi|50843370|ref|YP_056597.1| citrate lyase beta chain [Propionib... 110 5e-23
gi|38104487|gb|EAA51045.1| hypothetical protein MG04805.4 [Magna... 110 6e-23
gi|48780827|ref|ZP_00277499.1| COG2301: Citrate lyase beta subun... 109 8e-23
gi|17981051|gb|AAL50820.1| citrate lyase [Rhodococcus erythropolis] 109 8e-23
gi|48835784|ref|ZP_00292782.1| COG2301: Citrate lyase beta subun... 109 8e-23
gi|27375610|ref|NP_767139.1| citrate lyase beta subunit [Bradyrh... 109 1e-22
gi|33152336|ref|NP_873689.1| citrate lyase beta chain; citryl-Co... 108 2e-22
gi|45916880|ref|ZP_00195921.2| COG2301: Citrate lyase beta subun... 105 2e-21
gi|1168952|sp|P44460|CILB_HAEIN Citrate lyase beta chain (Citras... 105 2e-21
gi|41406391|ref|NP_959227.1| hypothetical protein MAP0293 [Mycob... 105 2e-21
gi|13471372|ref|NP_102938.1| probable beta subunit of citrate ly... 104 3e-21
gi|16122174|ref|NP_405487.1| putative citrate lyase beta chain [... 103 6e-21
gi|48850197|ref|ZP_00304439.1| COG2301: Citrate lyase beta subun... 103 8e-21
gi|15806259|ref|NP_294964.1| citrate lyase, beta subunit [Deinoc... 103 8e-21
gi|13475020|ref|NP_106578.1| citrate lyase beta-subunit [Mesorhi... 102 1e-20
gi|48835756|ref|ZP_00292754.1| COG2301: Citrate lyase beta subun... 102 2e-20
gi|46133658|ref|ZP_00157530.2| COG2301: Citrate lyase beta subun... 102 2e-20
gi|15673172|ref|NP_267346.1| citrate lyase beta chain [Lactococc... 101 2e-20
gi|48764991|ref|ZP_00269542.1| COG2301: Citrate lyase beta subun... 101 2e-20
gi|27381908|ref|NP_773437.1| blr6797 [Bradyrhizobium japonicum U... 101 3e-20
gi|15890035|ref|NP_355716.1| AGR_C_5061p [Agrobacterium tumefaci... 101 3e-20
gi|33598030|ref|NP_885673.1| putative citrate lyase [Bordetella ... 101 3e-20
gi|30995348|ref|NP_438196.2| citrate lyase beta chain [Haemophil... 100 4e-20
gi|45548517|ref|ZP_00188549.1| COG2301: Citrate lyase beta subun... 100 5e-20
gi|29142645|ref|NP_805987.1| citrate lyase beta chain [Salmonell... 100 7e-20
gi|16759582|ref|NP_455199.1| citrate lyase beta chain [Salmonell... 100 7e-20
gi|16759054|ref|NP_454671.1| citrate lyase beta chain [Salmonell... 100 7e-20
gi|16763999|ref|NP_459614.1| citrate lyase beta chain [Salmonell... 100 9e-20
gi|16763450|ref|NP_459065.1| putative citrate lyase beta chain [... 100 9e-20
gi|1168953|sp|P17725|CILB_KLEPN Citrate lyase beta chain (Citras... 99 1e-19
gi|33595288|ref|NP_882931.1| conserved hypothetical protein [Bor... 99 1e-19
gi|3287961|sp|P77770|CILB_ECOLI Citrate lyase beta chain (Citras... 99 2e-19
gi|26246598|ref|NP_752637.1| Citrate lyase beta chain [Escherich... 99 2e-19
gi|33599579|ref|NP_887139.1| conserved hypothetical protein [Bor... 99 2e-19
gi|48850337|ref|ZP_00304579.1| COG2301: Citrate lyase beta subun... 98 2e-19
gi|30062073|ref|NP_836244.1| citrate lyase beta chain (acyl lya... 98 2e-19
gi|24111960|ref|NP_706470.1| citrate lyase beta chain (acyl lyas... 98 2e-19
gi|48831193|ref|ZP_00288268.1| COG2301: Citrate lyase beta subun... 98 3e-19
gi|15922098|ref|NP_377767.1| 252aa long hypothetical citrate lya... 98 3e-19
gi|16766420|ref|NP_462035.1| putative transcriptional regulator ... 97 4e-19
gi|13471038|ref|NP_102607.1| citrate lyase beta chain [Mesorhizo... 97 6e-19
gi|38703883|ref|NP_308682.2| citrate lyase beta chain [Escherich... 97 6e-19
gi|25345135|pir||G90710 citrate lyase beta chain [imported] - Es... 97 6e-19
gi|39937617|ref|NP_949893.1| putative citrate lyase beta chain [... 97 7e-19
gi|1657785|gb|AAB58884.1| malyl-CoA lyase [Methylobacterium exto... 96 9e-19
gi|15800331|ref|NP_286343.1| citrate lyase beta chain (acyl lyas... 96 1e-18
gi|30249767|ref|NP_841837.1| probable beta subunit of citrate ly... 95 3e-18
gi|33598158|ref|NP_885801.1| putative citrate lyase beta subunit... 94 4e-18
gi|33601802|ref|NP_889362.1| putative citrate lyase beta chain [... 93 8e-18
gi|33592456|ref|NP_880100.1| putative citrate lyase beta chain [... 93 1e-17
gi|46192005|ref|ZP_00207108.1| COG2301: Citrate lyase beta subun... 93 1e-17
gi|50121496|ref|YP_050663.1| citrate lyase beta chain [Erwinia c... 92 2e-17
gi|46192894|ref|ZP_00005846.2| COG2301: Citrate lyase beta subun... 92 2e-17
gi|46314449|ref|ZP_00215035.1| COG2301: Citrate lyase beta subun... 91 5e-17
gi|41408408|ref|NP_961244.1| CitE [Mycobacterium avium subsp. pa... 90 7e-17
gi|48786540|ref|ZP_00282674.1| COG2301: Citrate lyase beta subun... 89 1e-16
gi|48782243|ref|ZP_00278795.1| COG2301: Citrate lyase beta subun... 89 2e-16
gi|50123037|ref|YP_052204.1| putative citrate lyase beta chain [... 88 3e-16
gi|46317163|ref|ZP_00217741.1| COG2301: Citrate lyase beta subun... 88 3e-16
gi|21234050|ref|NP_639627.1| putative lysase [Streptomyces coeli... 87 4e-16
gi|21224775|ref|NP_630554.1| putative citratelyase [Streptomyces... 87 6e-16
gi|46313797|ref|ZP_00214385.1| COG2301: Citrate lyase beta subun... 87 7e-16
gi|46314969|ref|ZP_00215553.1| COG2301: Citrate lyase beta subun... 87 7e-16
gi|42629206|ref|ZP_00154754.1| COG2301: Citrate lyase beta subun... 86 2e-15
gi|23111915|ref|ZP_00097475.1| COG2301: Citrate lyase beta subun... 86 2e-15
gi|45516065|ref|ZP_00167618.1| COG2301: Citrate lyase beta subun... 86 2e-15
gi|48763741|ref|ZP_00268295.1| COG2301: Citrate lyase beta subun... 84 4e-15
gi|48835637|ref|ZP_00292636.1| COG2301: Citrate lyase beta subun... 84 5e-15
gi|29828455|ref|NP_823089.1| putative lyase [Streptomyces avermi... 82 1e-14
gi|48788331|ref|ZP_00284310.1| COG2301: Citrate lyase beta subun... 82 2e-14
gi|20804008|emb|CAD31585.1| PROBABLE SIMILAR TO BETA SUBUNIT OF ... 82 2e-14
gi|48785239|ref|ZP_00281489.1| COG2301: Citrate lyase beta subun... 80 5e-14
gi|23468743|ref|ZP_00124078.1| COG2301: Citrate lyase beta subun... 80 7e-14
gi|47573101|ref|ZP_00243141.1| COG2301: Citrate lyase beta subun... 80 7e-14
gi|29832723|ref|NP_827357.1| putative citrate lyase beta chain [... 79 2e-13
gi|38233442|ref|NP_939209.1| Putative citrate lyase [Corynebacte... 79 2e-13
gi|25027494|ref|NP_737548.1| citrate lyase [Corynebacterium effi... 78 3e-13
gi|15807199|ref|NP_295928.1| citrate lyase, beta subunit [Deinoc... 78 3e-13
gi|15609635|ref|NP_217014.1| citE [Mycobacterium tuberculosis H3... 77 5e-13
gi|17989419|ref|NP_542052.1| CITRATE LYASE BETA CHAIN [Brucella ... 77 5e-13
gi|48780605|ref|ZP_00277309.1| COG2301: Citrate lyase beta subun... 75 2e-12
gi|41407786|ref|NP_960622.1| hypothetical protein MAP1688 [Mycob... 74 4e-12
gi|46314435|ref|ZP_00215021.1| COG2301: Citrate lyase beta subun... 74 4e-12
gi|19552089|ref|NP_600091.1| citrate lyase beta subunit [Coryneb... 74 5e-12
gi|34764062|ref|ZP_00144945.1| Citrate lyase beta chain [Fusobac... 74 5e-12
gi|23103794|ref|ZP_00090268.1| COG2301: Citrate lyase beta subun... 74 7e-12
gi|45516208|ref|ZP_00167761.1| COG2301: Citrate lyase beta subun... 73 9e-12
gi|33595061|ref|NP_882704.1| conserved hypothetical protein [Bor... 73 1e-11
gi|5734383|emb|CAB52684.1| citrate lyase [Corynebacterium glutam... 71 3e-11
gi|15596080|ref|NP_249574.1| probable acyl-CoA lyase beta chain ... 71 3e-11
gi|49083391|gb|AAT51020.1| PA0883 [synthetic construct] 71 3e-11
gi|32040895|ref|ZP_00138478.1| COG2301: Citrate lyase beta subun... 70 6e-11
gi|32040897|ref|ZP_00138480.1| COG2301: Citrate lyase beta subun... 70 6e-11
gi|21220514|ref|NP_626293.1| putative citrate lyase beta chain [... 70 6e-11
gi|48769402|ref|ZP_00273748.1| COG2301: Citrate lyase beta subun... 70 6e-11
gi|45548519|ref|ZP_00188551.1| COG2301: Citrate lyase beta subun... 63 1e-08
gi|48834107|ref|ZP_00291122.1| COG2301: Citrate lyase beta subun... 62 2e-08
gi|23005625|ref|ZP_00048344.1| COG2301: Citrate lyase beta subun... 60 6e-08
gi|48783657|ref|ZP_00280109.1| COG2301: Citrate lyase beta subun... 60 1e-07
gi|23121623|ref|ZP_00103858.1| COG2301: Citrate lyase beta subun... 57 5e-07
gi|23004237|ref|ZP_00047675.1| COG2301: Citrate lyase beta subun... 54 5e-06
gi|16764216|ref|NP_459831.1| putative cytoplasmic protein [Salmo... 52 3e-05
gi|22970864|ref|ZP_00017884.1| hypothetical protein [Chloroflexu... 51 3e-05
gi|41409250|ref|NP_962086.1| hypothetical protein MAP3152c [Myco... 51 3e-05
gi|46201042|ref|ZP_00207943.1| COG2301: Citrate lyase beta subun... 50 8e-05
gi|23120893|ref|ZP_00103381.1| COG2301: Citrate lyase beta subun... 48 3e-04
gi|15610212|ref|NP_217591.1| hypothetical protein Rv3075c [Mycob... 47 9e-04
gi|16127229|ref|NP_421793.1| citrate lyase, beta subunit, putati... 45 0.002
gi|46202913|ref|ZP_00052405.2| COG2301: Citrate lyase beta subun... 45 0.003
gi|46205809|ref|ZP_00048061.2| COG2301: Citrate lyase beta subun... 45 0.003
gi|46363228|ref|ZP_00226000.1| COG2301: Citrate lyase beta subun... 43 0.012
gi|33592915|ref|NP_880559.1| citrate lyase beta chain [Bordetell... 41 0.047
gi|41689265|ref|ZP_00145799.1| COG2301: Citrate lyase beta subun... 40 0.10
gi|11878193|gb|AAG40841.1| lyase [Streptomyces cinnamonensis] 37 0.89
gi|3172141|gb|AAC28948.1| citrate lyase beta-subunit [Escherichi... 36 1.2
gi|4062239|dbj|BAA35258.1| Citrate lyase beta chain (acyl lyase ... 36 1.2
gi|33596213|ref|NP_883856.1| citrate lyase beta chain [Bordetell... 36 1.2
gi|15807211|ref|NP_295941.1| hypothetical protein [Deinococcus r... 35 2.0
gi|23121624|ref|ZP_00103859.1| COG2301: Citrate lyase beta subun... 35 2.0
gi|34764061|ref|ZP_00144944.1| Citrate lyase beta chain [Fusobac... 35 2.0
gi|48784615|ref|ZP_00280981.1| COG2301: Citrate lyase beta subun... 35 3.4
gi|50085097|ref|YP_046607.1| conserved hypothetical protein [Aci... 35 3.4
gi|15131667|emb|CAC48389.1| malate synthase [Haloferax volcanii] 34 5.7
gi|37619816|emb|CAA91416.2| Hypothetical protein M05D6.7 [Caenor... 33 9.8
gi|17534643|ref|NP_495793.1| gamma Butyrobetaine Hydroxylase (gb... 33 9.8
gi|33599258|ref|NP_886818.1| conserved hypothetical protein [Bor... 33 9.8
gi|33591779|ref|NP_879423.1| conserved hypothetical protein [Bor... 33 9.8
gi|33594982|ref|NP_882625.1| conserved hypothetical protein [Bor... 33 9.8
>gi|17557458|ref|NP_506716.1| citrate lyase (5P567) [Caenorhabditis
elegans]
gi|7495121|pir||T18818 hypothetical protein C01G10.7 -
Caenorhabditis elegans
gi|3873871|emb|CAB02709.1| Hypothetical protein C01G10.7
[Caenorhabditis elegans]
Length = 324
Score = 607 bits (1566), Expect = e-172
Identities = 306/324 (94%), Positives = 306/324 (94%)
Frame = +1
Query: 1 MLPKTIIRHISQFAGVRDAAKYVPRRALLYVPASNQKMLDKVPMMQADSVVLELEDGVXX 180
MLPKTIIRHISQFAGVRDAAKYVPRRALLYVPASNQKMLDKVPMMQADSVVLELEDGV
Sbjct: 1 MLPKTIIRHISQFAGVRDAAKYVPRRALLYVPASNQKMLDKVPMMQADSVVLELEDGVAL 60
Query: 181 XXXXXXXXXXXXXXXXLPYHTLACQELGLRVNSVSSGLLEDDIIAVSKAEKLPQAFMIPK 360
LPYHTLACQELGLRVNSVSSGLLEDDIIAVSKAEKLPQAFMIPK
Sbjct: 61 TAKADARVRAAAALDKLPYHTLACQELGLRVNSVSSGLLEDDIIAVSKAEKLPQAFMIPK 120
Query: 361 VDCPEDLVTIYNIFREHYGDERITNTNTRLVIWIESARALLDMPRIVSSTLNLHKQAGFF 540
VDCPEDLVTIYNIFREHYGDERITNTNTRLVIWIESARALLDMPRIVSSTLNLHKQAGFF
Sbjct: 121 VDCPEDLVTIYNIFREHYGDERITNTNTRLVIWIESARALLDMPRIVSSTLNLHKQAGFF 180
Query: 541 KLDAVVFGSDDFCADIGATRSSHGTETLFARQKFVTCCKAFQLQAIDSVYIDIKDLDGLR 720
KLDAVVFGSDDFCADIGATRSSHGTETLFARQKFVTCCKAFQLQAIDSVYIDIKDLDGLR
Sbjct: 181 KLDAVVFGSDDFCADIGATRSSHGTETLFARQKFVTCCKAFQLQAIDSVYIDIKDLDGLR 240
Query: 721 RQSAEGWQWGFTGKQVIHPSQVSVVQEQFLPPKDRIEWAQELVHAYSEHEALGKGAFQFR 900
RQSAEGWQWGFTGKQVIHPSQVSVVQEQFLPPKDRIEWAQELVHAYSEHEALGKGAFQFR
Sbjct: 241 RQSAEGWQWGFTGKQVIHPSQVSVVQEQFLPPKDRIEWAQELVHAYSEHEALGKGAFQFR 300
Query: 901 GQMIDRPLLLQALNIIQLVERVQN 972
GQMIDRPLLLQALNIIQLVERVQN
Sbjct: 301 GQMIDRPLLLQALNIIQLVERVQN 324