Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C01G12_1
(1068 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531507|ref|NP_497027.1| sex determining protein, Masculinis... 624 e-177
gi|39591365|emb|CAE73419.1| Hypothetical protein CBG20862 [Caeno... 519 e-146
gi|23304704|emb|CAD48140.1| hypothetical protein [Brugia malayi] 241 2e-62
gi|40788293|dbj|BAA25503.2| KIAA0577 protein [Homo sapiens] 181 2e-44
gi|4503293|ref|NP_003578.1| DEAH (Asp-Glu-Ala-His) box polypepti... 181 2e-44
gi|26006959|sp|O60231|DD16_HUMAN Putative pre-mRNA splicing fact... 181 2e-44
gi|14250712|gb|AAH08825.1| DEAH (Asp-Glu-Ala-His) box polypeptid... 181 2e-44
gi|38502930|sp|Q7YR39|DD16_PANTR Putative pre-mRNA splicing fact... 179 1e-43
gi|41529171|dbj|BAD08431.1| DEAD/H (Asp-Glu-Ala-Asp/His) box pol... 178 2e-43
gi|39104622|dbj|BAC65596.4| mKIAA0577 protein [Mus musculus] 177 3e-43
gi|30794426|ref|NP_081263.1| DEAH (Asp-Glu-Ala-His) box polypept... 177 3e-43
gi|47059171|ref|NP_997661.1| DEAH (Asp-Glu-Ala-His) box polypept... 172 1e-41
gi|41053341|ref|NP_956318.1| DEAH (Asp-Glu-Ala-His) box polypept... 171 2e-41
gi|19921526|ref|NP_609946.1| CG10689-PA [Drosophila melanogaster... 160 5e-38
gi|31238779|ref|XP_319844.1| ENSANGP00000016533 [Anopheles gambi... 154 3e-36
gi|31238776|ref|XP_319843.1| ENSANGP00000025250 [Anopheles gambi... 154 3e-36
gi|38424010|dbj|BAD01767.1| RNA helicase-like [Oryza sativa (jap... 123 6e-27
gi|48926654|gb|AAT47443.1| putative DEAD/DEAH RNA helicase [Oryz... 120 7e-26
gi|22329903|ref|NP_174527.2| RNA helicase, putative [Arabidopsis... 119 9e-26
gi|25513513|pir||C86450 F5D14.27 protein - Arabidopsis thaliana ... 113 9e-24
gi|47218748|emb|CAG02734.1| unnamed protein product [Tetraodon n... 101 3e-20
gi|50259106|gb|EAL21783.1| hypothetical protein CNBC4850 [Crypto... 99 2e-19
gi|19112478|ref|NP_595686.1| putative ATP-dependent RNA helicase... 99 2e-19
gi|19862987|sp|Q10752|CC28_SCHPO Putative ATP-dependent RNA heli... 99 2e-19
gi|47187193|emb|CAF94224.1| unnamed protein product [Tetraodon n... 95 3e-18
gi|34852059|ref|XP_215306.2| similar to DEAD/H (Asp-Glu-Ala-Asp/... 88 4e-16
gi|42569631|ref|NP_181077.2| RNA helicase, putative [Arabidopsis... 87 9e-16
gi|25408373|pir||D84767 probable pre-mRNA splicing factor RNA he... 87 9e-16
gi|50550331|ref|XP_502638.1| hypothetical protein [Yarrowia lipo... 86 1e-15
gi|49079422|ref|XP_403358.1| hypothetical protein UM05743.1 [Ust... 84 7e-15
gi|48130474|ref|XP_396668.1| similar to ENSANGP00000016533 [Apis... 74 7e-12
gi|33877185|gb|AAH02789.1| DHX16 protein [Homo sapiens] 69 2e-10
gi|46137751|ref|XP_390567.1| conserved hypothetical protein [Gib... 64 6e-09
gi|49097008|ref|XP_409964.1| hypothetical protein AN5827.2 [Aspe... 62 2e-08
gi|32421753|ref|XP_331320.1| hypothetical protein [Neurospora cr... 61 5e-08
gi|11346341|pir||T46568 ATP-dependent RNA helicase cdc28 [simila... 60 7e-08
gi|38106993|gb|EAA53224.1| hypothetical protein MG07501.4 [Magna... 56 1e-06
gi|23508999|ref|NP_701667.1| pre-mRNA splicing factor RNA helica... 54 5e-06
gi|50413843|ref|XP_457324.1| unnamed protein product [Debaryomyc... 50 7e-05
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster... 50 7e-05
gi|32419136|ref|XP_330046.1| hypothetical protein [Neurospora cr... 48 3e-04
gi|40788346|dbj|BAA34461.2| KIAA0741 protein [Homo sapiens] 48 3e-04
gi|11360327|pir||T43483 translation initiation factor IF-2 homol... 48 3e-04
gi|4322304|gb|AAD16006.1| translation initiation factor IF2 [Hom... 48 3e-04
gi|14195666|sp|O60841|IF2P_HUMAN Eukaryotic translation initiati... 48 3e-04
gi|21619657|gb|AAH32639.1| Translation initiation factor IF2 [Ho... 48 3e-04
gi|5002645|emb|CAB44357.1| IF2 protein [Homo sapiens] 48 3e-04
gi|15451892|ref|NP_056988.2| translation initiation factor IF2 [... 48 3e-04
gi|23484437|gb|EAA19765.1| putative ATP-dependent RNA helicase c... 48 3e-04
gi|38566922|emb|CAE76225.1| related to putative cytoplasmic stru... 48 3e-04
gi|9790237|ref|NP_062684.1| SMC1 structural maintenance of chrom... 48 4e-04
gi|50551847|ref|XP_503398.1| hypothetical protein [Yarrowia lipo... 47 8e-04
gi|45188160|ref|NP_984383.1| ADR287Cp [Eremothecium gossypii] >g... 47 0.001
gi|15292193|gb|AAK93365.1| LD41932p [Drosophila melanogaster] 47 0.001
gi|28436771|gb|AAH46691.1| Smc1l1-prov protein [Xenopus laevis] 46 0.001
gi|39963673|gb|AAH64368.1| SMC1L1 protein [Homo sapiens] 46 0.001
gi|15235842|ref|NP_193401.1| RNA helicase, putative [Arabidopsis... 46 0.001
gi|34365245|emb|CAE45960.1| hypothetical protein [Homo sapiens] 46 0.001
gi|30581135|ref|NP_006297.2| SMC1 structural maintenance of chro... 46 0.001
gi|13928946|ref|NP_113871.1| SMC1 structural maintenance of chro... 46 0.001
gi|30172566|ref|NP_777039.1| SMC1 structural maintenance of chro... 46 0.001
gi|2370078|emb|CAB09784.1| dJ339A18.1 (KIAA0178 (ortholog of Fug... 46 0.001
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib... 46 0.002
gi|47218747|emb|CAG02733.1| unnamed protein product [Tetraodon n... 45 0.002
gi|42761572|gb|AAS45390.1| similar to Babesia bigemina. 200 kDa ... 45 0.002
gi|15238640|ref|NP_197870.1| expressed protein [Arabidopsis thal... 45 0.002
gi|23510212|ref|NP_702878.1| hypothetical protein [Plasmodium fa... 45 0.003
gi|34785442|gb|AAH57524.1| LOC402861 protein [Danio rerio] 45 0.004
gi|34495237|gb|AAQ73468.1| erythrocyte binding protein 2 [Plasmo... 45 0.004
gi|23508177|ref|NP_700847.1| gene 11-1 protein precursor [Plasmo... 45 0.004
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa... 45 0.004
gi|34495238|gb|AAQ73469.1| erythrocyte binding protein 3 [Plasmo... 45 0.004
gi|13539605|emb|CAC35733.1| cyclophilin-RNA interacting protein ... 45 0.004
gi|34899982|ref|NP_911337.1| Neurofilament triplet M protein-lik... 45 0.004
gi|47225554|emb|CAG12037.1| unnamed protein product [Tetraodon n... 44 0.005
gi|14279233|gb|AAK58539.1| RING finger protein 20 [Homo sapiens] 44 0.005
gi|34878777|ref|NP_062538.5| ring finger protein 20; homolog of ... 44 0.005
gi|21739840|emb|CAD38947.1| hypothetical protein [Homo sapiens] 44 0.005
gi|34868389|ref|XP_232995.2| similar to ring finger protein 20 [... 44 0.005
gi|10433666|dbj|BAB14005.1| unnamed protein product [Homo sapiens] 44 0.005
gi|33859829|ref|NP_892044.1| ring finger protein 20 [Mus musculu... 44 0.005
gi|38101341|gb|EAA48320.1| hypothetical protein MG10579.4 [Magna... 44 0.006
gi|8096269|dbj|BAA95789.1| KED [Nicotiana tabacum] 44 0.006
gi|2135244|pir||I54383 chromosome segregation protein smc1 [simi... 44 0.006
gi|15828877|ref|NP_326237.1| unknown; predicted coding region [M... 44 0.008
gi|34875614|ref|XP_218162.2| similar to Translation initiation f... 44 0.008
gi|32408715|ref|XP_324838.1| hypothetical protein [Neurospora cr... 44 0.008
gi|47211228|emb|CAF92784.1| unnamed protein product [Tetraodon n... 43 0.011
gi|38109002|gb|EAA54936.1| hypothetical protein MG05727.4 [Magna... 43 0.011
gi|23508812|ref|NP_701480.1| hypothetical protein [Plasmodium fa... 43 0.011
gi|16648923|gb|AAL24313.1| Unknown protein [Arabidopsis thaliana] 43 0.011
gi|15223583|ref|NP_176058.1| expressed protein [Arabidopsis thal... 43 0.011
gi|39588050|emb|CAE57282.1| Hypothetical protein CBG00187 [Caeno... 43 0.011
gi|47213693|emb|CAF94586.1| unnamed protein product [Tetraodon n... 43 0.011
gi|49618927|gb|AAT68048.1| chromosome adhesion protein SMC1-like... 43 0.011
gi|23619283|ref|NP_705245.1| hypothetical protein [Plasmodium fa... 43 0.014
gi|18256853|gb|AAH21827.1| 2610015P09Rik protein [Mus musculus] 43 0.014
gi|10433974|dbj|BAB14081.1| unnamed protein product [Homo sapiens] 43 0.014
gi|38080827|ref|XP_358847.1| similar to 2610015P09Rik protein [M... 43 0.014
gi|50286051|ref|XP_445454.1| unnamed protein product [Candida gl... 43 0.014
gi|38079795|ref|XP_148073.2| similar to 2610015P09Rik protein [M... 43 0.014
gi|1236759|emb|CAA58041.1| 256 kD golgin [Homo sapiens] 42 0.019
gi|32566158|ref|NP_501528.2| M protein repeat and RepA / Rep+ pr... 42 0.019
gi|1173565|gb|AAC51791.1| golgin-245 [Homo sapiens] >gnl|BL_ORD_... 42 0.019
gi|7508662|pir||T25410 hypothetical protein T28C6.7 - Caenorhabd... 42 0.019
gi|50730570|ref|XP_425582.1| PREDICTED: similar to Eukaryotic tr... 42 0.019
gi|37595292|gb|AAQ94531.1| M protein [Streptococcus pyogenes] 42 0.019
gi|24657526|ref|NP_728981.1| CG32251-PA [Drosophila melanogaster... 42 0.019
gi|6715600|ref|NP_002069.2| golgi autoantigen, golgin subfamily ... 42 0.019
gi|23118168|ref|ZP_00101844.1| COG0810: Periplasmic protein TonB... 42 0.024
gi|23481991|gb|EAA18109.1| erythrocyte binding protein [Plasmodi... 42 0.024
gi|23490877|gb|EAA22546.1| maebl [Plasmodium yoelii yoelii] 42 0.024
gi|32766679|gb|AAH55212.1| Zgc:76902 protein [Danio rerio] 42 0.024
gi|39588840|emb|CAE69470.1| Hypothetical protein CBG15666 [Caeno... 42 0.024
gi|25148570|ref|NP_740973.1| M protein repeat containing protein... 42 0.024
gi|46229708|gb|EAK90526.1| protein with similarity to Gle1l prot... 42 0.024
gi|48768842|ref|ZP_00273190.1| COG0810: Periplasmic protein TonB... 42 0.024
gi|29837126|emb|CAD58850.2| SMC1 protein cohesin subunit [Gallus... 42 0.024
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 42 0.024
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 42 0.024
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n... 42 0.032
gi|29336591|sp|O93308|SMC1_XENLA Structural maintenance of chrom... 42 0.032
gi|38086107|ref|XP_111900.3| RIKEN cDNA B230333C21 gene [Mus mus... 42 0.032
gi|47228706|emb|CAG07438.1| unnamed protein product [Tetraodon n... 42 0.032
gi|17544554|ref|NP_500777.1| putative nuclear protein, with 4 co... 42 0.032
gi|17554908|ref|NP_497967.1| cyclin-like F-box (3F797) [Caenorha... 42 0.032
gi|46228298|gb|EAK89197.1| hypothetical protein with signal pept... 42 0.032
gi|50556614|ref|XP_505715.1| hypothetical protein [Yarrowia lipo... 42 0.032
gi|25395695|pir||G88436 protein T04A8.13 [imported] - Caenorhabd... 42 0.032
gi|7521921|pir||T30534 chromosome segregation protein SMC1 homol... 42 0.032
gi|39589781|emb|CAE67016.1| Hypothetical protein CBG12417 [Caeno... 42 0.032
gi|25411878|pir||E84565 hypothetical protein At2g18540 [imported... 41 0.041
gi|13173388|gb|AAK14386.1| lysine/glutamic acid-rich protein [Ca... 41 0.041
gi|46437637|gb|EAK96980.1| hypothetical protein CaO19.9753 [Cand... 41 0.041
gi|32698944|ref|NP_872367.1| hypothetical protein FLJ36144 [Homo... 41 0.041
gi|46320634|ref|ZP_00221019.1| COG0532: Translation initiation f... 41 0.041
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl... 41 0.041
gi|42569129|ref|NP_179444.2| cupin family protein [Arabidopsis t... 41 0.041
gi|15641030|ref|NP_230661.1| RnfC-related protein [Vibrio choler... 41 0.041
gi|17369132|sp|Q9KT88|RNFC_VIBCH Electron transport complex prot... 41 0.041
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster... 41 0.054
gi|17558378|ref|NP_504775.1| putative protein, with 4 coiled coi... 41 0.054
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 41 0.054
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster... 41 0.054
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me... 41 0.054
gi|48098255|ref|XP_392030.1| similar to ENSANGP00000016791 [Apis... 41 0.054
gi|27371004|gb|AAH40746.1| BC018347 protein [Mus musculus] 41 0.054
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D... 41 0.054
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster... 41 0.054
gi|23479057|gb|EAA15989.1| Lecithin:cholesterol acyltransferase,... 40 0.070
gi|32412236|ref|XP_326598.1| predicted protein [Neurospora crass... 40 0.070
gi|28850292|gb|AAM45316.2| similar to Plasmodium falciparum. Hyp... 40 0.070
gi|28376359|gb|AAO41093.1| major surface protein 3 [Anaplasma ma... 40 0.070
gi|17559190|ref|NP_506146.1| putative protein, with 2 coiled coi... 40 0.070
gi|46249604|gb|AAH68841.1| LOC414611 protein [Xenopus laevis] 40 0.070
gi|39589597|emb|CAE66832.1| Hypothetical protein CBG12202 [Caeno... 40 0.070
gi|30230638|gb|AAP20882.1| M protein [Streptococcus pyogenes] 40 0.070
gi|50551527|ref|XP_503237.1| hypothetical protein [Yarrowia lipo... 40 0.070
gi|46139391|ref|XP_391386.1| hypothetical protein FG11210.1 [Gib... 40 0.070
gi|32420109|ref|XP_330498.1| hypothetical protein [Neurospora cr... 40 0.070
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 40 0.070
gi|28829971|gb|AAO52461.1| similar to Plasmodium falciparum. Hyp... 40 0.070
gi|27227741|emb|CAD59239.1| NAD(+) ADP-ribosyltransferase-3 [Dic... 40 0.070
gi|46227257|gb|EAK88207.1| Low complexity hypothetical protein [... 40 0.092
gi|24580684|ref|NP_608540.1| CG2839-PA [Drosophila melanogaster]... 40 0.092
gi|17550336|ref|NP_510658.1| TBP-Associated transcription Factor... 40 0.092
gi|39589507|emb|CAE74536.1| Hypothetical protein CBG22293 [Caeno... 40 0.092
gi|28436870|gb|AAH47049.1| Upf3b protein [Mus musculus] 40 0.092
gi|46226679|gb|EAK87658.1| Low complexity protein with large Glu... 40 0.092
gi|32420257|ref|XP_330572.1| predicted protein [Neurospora crass... 40 0.092
gi|32416354|ref|XP_328655.1| predicted protein [Neurospora crass... 40 0.092
gi|4102980|gb|AAD09328.1| virulent strain associated lipoprotein... 40 0.092
gi|25056787|ref|XP_110787.2| UPF3 regulator of nonsense transcri... 40 0.092
gi|480565|pir||S37046 IgA receptor - Streptococcus pyogenes >gnl... 40 0.092
gi|50292427|ref|XP_448646.1| unnamed protein product [Candida gl... 40 0.092
gi|17561158|ref|NP_507932.1| protein tyrosine phosphatase non-re... 40 0.092
gi|37805251|gb|AAH60288.1| BC018347 protein [Mus musculus] 40 0.092
gi|11496756|ref|NP_045547.1| B. burgdorferi predicted coding reg... 40 0.092
gi|7020447|dbj|BAA91134.1| unnamed protein product [Homo sapiens] 40 0.12
gi|16805045|ref|NP_473074.1| DNA helicase, putative [Plasmodium ... 40 0.12
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 40 0.12
gi|23508562|ref|NP_701231.1| hypothetical protein [Plasmodium fa... 40 0.12
gi|29881667|gb|AAH51192.1| Splicing factor proline/glutamine ric... 40 0.12
gi|23613642|ref|NP_704663.1| hypothetical protein [Plasmodium fa... 40 0.12
gi|47565281|ref|ZP_00236323.1| S-layer homology domain protein [... 40 0.12
gi|677198|gb|AAB00143.1| putative 40 0.12
gi|12718845|gb|AAK02014.1| enterophilin-2L [Cavia porcellus] 40 0.12
gi|38648808|gb|AAH63115.1| RNF20 protein [Homo sapiens] 40 0.12
gi|32408359|ref|XP_324661.1| hypothetical protein [Neurospora cr... 39 0.16
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738... 39 0.16
gi|18857955|ref|NP_572242.1| CG4119-PA [Drosophila melanogaster]... 39 0.16
gi|50419303|ref|XP_458176.1| unnamed protein product [Debaryomyc... 39 0.16
gi|50740139|ref|XP_429241.1| PREDICTED: hypothetical protein XP_... 39 0.16
gi|17647127|ref|NP_523594.1| CG7157-PA [Drosophila melanogaster]... 39 0.16
gi|437639|gb|AAA72295.1| [Plasmodium falciparum 3' end.], gene p... 39 0.16
gi|24642151|ref|NP_573020.2| CG6227-PA [Drosophila melanogaster]... 39 0.16
gi|7494984|pir||T25469 hypothetical protein B0507.8 - Caenorhabd... 39 0.16
gi|27552474|emb|CAD59915.1| M protein [Streptococcus pyogenes] 39 0.16
gi|17557402|ref|NP_505257.1| putative nuclear protein, with 2 co... 39 0.16
gi|46228553|gb|EAK89423.1| uncharacterized coiled coil protein [... 39 0.16
gi|50257926|gb|EAL20624.1| hypothetical protein CNBE3320 [Crypto... 39 0.16
gi|11612222|gb|AAG37362.1| ACP36DE [Drosophila melanogaster] 39 0.16
gi|34541550|ref|NP_906029.1| TPR domain protein [Porphyromonas g... 39 0.16
gi|23619293|ref|NP_705255.1| reticulocyte binding protein 2 homo... 39 0.16
gi|13345187|gb|AAK19244.1| reticulocyte binding protein 2 homolo... 39 0.16
gi|30019697|ref|NP_831328.1| Multimodular transpeptidase-transgl... 39 0.16
gi|38106086|gb|EAA52437.1| hypothetical protein MG05129.4 [Magna... 39 0.16
gi|31209753|ref|XP_313843.1| ENSANGP00000011728 [Anopheles gambi... 39 0.20
gi|12711674|ref|NP_075386.1| UPF3 regulator of nonsense transcri... 39 0.20
gi|23194177|gb|AAN15036.1| mutant desmin [Homo sapiens] 39 0.20
gi|33413782|gb|AAN39444.1| normocyte binding protein 2a [Plasmod... 39 0.20
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae] 39 0.20
gi|7020947|dbj|BAA91326.1| unnamed protein product [Homo sapiens] 39 0.20
gi|39593039|emb|CAE64508.1| Hypothetical protein CBG09238 [Caeno... 39 0.20
gi|32413022|ref|XP_326991.1| hypothetical protein [Neurospora cr... 39 0.20
gi|46227236|gb|EAK88186.1| hypothetical protein cgd5_220 [Crypto... 39 0.20
gi|17505881|ref|NP_492824.1| vamp-associated protein like family... 39 0.20
gi|45658257|ref|YP_002343.1| chromosome segregation protein [Lep... 39 0.20
gi|50554851|ref|XP_504834.1| hypothetical protein [Yarrowia lipo... 39 0.20
gi|42734037|gb|AAS38912.1| similar to Staphylococcus aureus (str... 39 0.20
gi|46229652|gb|EAK90470.1| hypothetical low complexity protein w... 39 0.20
gi|33413776|gb|AAN39446.1| normocyte binding protein 2a [Plasmod... 39 0.20
gi|23510054|ref|NP_702720.1| hypothetical protein [Plasmodium fa... 39 0.20
gi|7549210|gb|AAF63787.1| 200 kDa antigen p200 [Babesia bigemina] 39 0.20
gi|24214009|ref|NP_711490.1| chromosome segregation protein [Lep... 39 0.20
gi|23509114|ref|NP_701782.1| hypothetical protein [Plasmodium fa... 39 0.20
gi|47211224|emb|CAF92780.1| unnamed protein product [Tetraodon n... 39 0.20
gi|28949944|emb|CAD70930.1| related to wound-responsive protein ... 39 0.20
gi|21357267|ref|NP_649312.1| CG6014-PA [Drosophila melanogaster]... 39 0.20
gi|11612234|gb|AAG37368.1| ACP36DE [Drosophila melanogaster] >gn... 39 0.20
gi|6320145|ref|NP_010225.1| involved intracellular protein trans... 39 0.20
gi|11612242|gb|AAG37372.1| ACP36DE [Drosophila melanogaster] 39 0.20
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p... 39 0.20
gi|17556188|ref|NP_497536.1| translation initiation factor (133.... 39 0.20
gi|28376422|gb|AAM97265.1| major surface protein 3 [Anaplasma ma... 39 0.27
gi|23483071|gb|EAA18862.1| hypothetical protein [Plasmodium yoel... 39 0.27
gi|28829018|gb|AAO51593.1| similar to Plasmodium falciparum (iso... 39 0.27
gi|11612218|gb|AAG37360.1| ACP36DE [Drosophila melanogaster] 39 0.27
gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rR... 39 0.27
gi|23484442|gb|EAA19768.1| hypothetical protein [Plasmodium yoel... 39 0.27
gi|4557509|ref|NP_001331.1| cylicin 2 [Homo sapiens] >gnl|BL_ORD... 39 0.27
gi|50556082|ref|XP_505449.1| hypothetical protein [Yarrowia lipo... 39 0.27
gi|113005|sp|P22620|ABRA_PLAFC 101 kDa malaria antigen (P101) (A... 39 0.27
gi|24583764|ref|NP_723700.1| CG6686-PA [Drosophila melanogaster]... 39 0.27
gi|23508971|ref|NP_701639.1| 101 kd malaria antigen [Plasmodium ... 39 0.27
gi|40074467|gb|AAR39441.1| kinesin family member 12 [Dictyosteli... 39 0.27
gi|23508231|ref|NP_700900.1| hypothetical protein [Plasmodium fa... 39 0.27
gi|2655202|gb|AAB87902.1| U5 snRNP 100 kD protein [Homo sapiens] 39 0.27
gi|50545281|ref|XP_500178.1| hypothetical protein [Yarrowia lipo... 39 0.27
gi|38683786|gb|AAR26958.1| FirrV-1-F4 [Feldmannia irregularis vi... 39 0.27
gi|24583762|ref|NP_609529.2| CG6686-PB [Drosophila melanogaster]... 39 0.27
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 39 0.27
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot... 39 0.27
gi|17544558|ref|NP_500774.1| MSP-domain protein 2 like family me... 39 0.27
gi|46226941|gb|EAK87907.1| myosin [Cryptosporidium parvum] 39 0.27
gi|28422195|gb|AAH44265.1| B52-prov protein [Xenopus laevis] 39 0.27
gi|23612234|ref|NP_703814.1| ribonuclease, putative [Plasmodium ... 39 0.27
gi|34932999|ref|XP_233311.2| similar to DNA segment on chromosom... 39 0.27
gi|127774|sp|P08799|MYS2_DICDI Myosin II heavy chain, non muscle... 39 0.27
gi|34869160|ref|XP_221452.2| similar to KIAA1407 protein [Rattus... 39 0.27
gi|23479871|gb|EAA16587.1| R27-2 protein [Plasmodium yoelii yoelii] 39 0.27
gi|29251317|gb|EAA42799.1| GLP_574_20510_17433 [Giardia lamblia ... 39 0.27
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 38 0.35
gi|4755096|gb|AAB96383.2| accessory gland protein Acp36DE [Droso... 38 0.35
gi|42733645|gb|AAS38609.1| hypothetical protein [Dictyostelium d... 38 0.35
gi|37595272|gb|AAQ94521.1| M protein [Streptococcus pyogenes] 38 0.35
gi|34913470|ref|NP_918082.1| putative formin binding protein [Or... 38 0.35
gi|50426497|ref|XP_461845.1| unnamed protein product [Debaryomyc... 38 0.35
gi|50355643|dbj|BAD29962.1| Be158 [Babesia equi] 38 0.35
gi|39589581|emb|CAE66816.1| Hypothetical protein CBG12181 [Caeno... 38 0.35
gi|23509035|ref|NP_701703.1| hypothetical protein [Plasmodium fa... 38 0.35
gi|50745936|ref|XP_420305.1| PREDICTED: similar to transcription... 38 0.35
gi|15208079|dbj|BAB63064.1| hypothetical protein [Macaca fascicu... 38 0.35
gi|39591417|emb|CAE73471.1| Hypothetical protein CBG20922 [Caeno... 38 0.35
gi|50557322|ref|XP_506069.1| hypothetical protein [Yarrowia lipo... 38 0.35
gi|29788770|ref|NP_598708.2| nuclear mitotic apparatus protein 1... 38 0.35
gi|21430166|gb|AAM50761.1| LD10524p [Drosophila melanogaster] 38 0.35
gi|11612230|gb|AAG37366.1| ACP36DE [Drosophila melanogaster] 38 0.35
gi|13272546|gb|AAK17202.1| major plasmodial myosin heavy chain [... 38 0.35
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 38 0.35
gi|25815236|dbj|BAC41243.1| hypothetical protein [Macaca fascicu... 38 0.35
gi|50757538|ref|XP_415557.1| PREDICTED: similar to Hypothetical ... 38 0.35
gi|24656362|ref|NP_611495.1| CG11180-PA [Drosophila melanogaster... 38 0.35
gi|50761541|ref|XP_424756.1| PREDICTED: similar to Splicing fact... 38 0.35
gi|34785605|gb|AAH58038.1| Unknown (protein for IMAGE:6620883) [... 38 0.35
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 38 0.35
gi|33413774|gb|AAN39445.1| normocyte binding protein 2a [Plasmod... 38 0.35
gi|25990101|gb|AAN75020.1| chromosome scaffold protein p85 [Mone... 38 0.35
gi|50742710|ref|XP_419726.1| PREDICTED: similar to Mtap7 protein... 38 0.35
gi|11612238|gb|AAG37370.1| ACP36DE [Drosophila melanogaster] 38 0.35
gi|27596975|gb|AAM68124.1| merozoite surface protein 3 alpha [Pl... 38 0.35
gi|2133786|pir||I51116 NF-180 - sea lamprey >gnl|BL_ORD_ID|32563... 38 0.46
gi|19115480|ref|NP_594568.1| hypothetical coiled-coil protein; t... 38 0.46
gi|4102202|gb|AAD01436.1| kinesin heavy chain homolog [Homo sapi... 38 0.46
gi|19401863|gb|AAL87694.1| non-transporter ABC protein AbcF4 [Di... 38 0.46
gi|19861596|sp|P78559|MAPA_HUMAN Microtubule-associated protein ... 38 0.46
gi|23510019|ref|NP_702685.1| hypothetical protein [Plasmodium fa... 38 0.46
gi|27365499|ref|NP_761027.1| TolA protein [Vibrio vulnificus CMC... 38 0.46
gi|7494376|pir||E71622 probable membrane associated protein PFB0... 38 0.46
gi|7595898|gb|AAF64489.1| prespore protein MF12 [Dictyostelium d... 38 0.46
gi|17543814|ref|NP_500745.1| putative protein, with a coiled coi... 38 0.46
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 38 0.46
gi|7158835|gb|AAF37556.1| p101/acidic basic repeat antigen [Plas... 38 0.46
gi|23478773|gb|EAA15769.1| ATPase, P-type, HAD superfamily, subf... 38 0.46
gi|46395470|ref|NP_997065.1| intersectin 1; si:dz173a8.1; SH3 do... 38 0.46
gi|48111808|ref|XP_396309.1| similar to hypothetical protein [Ap... 38 0.46
gi|32422567|ref|XP_331727.1| hypothetical protein [Neurospora cr... 38 0.46
gi|15639461|ref|NP_218911.1| conserved hypothetical protein [Tre... 38 0.46
gi|45580727|ref|NP_002364.4| microtubule-associated protein 1A; ... 38 0.46
gi|39590121|emb|CAE61119.1| Hypothetical protein CBG04876 [Caeno... 38 0.46
gi|45185754|ref|NP_983470.1| ACR068Wp [Eremothecium gossypii] >g... 38 0.46
gi|6752407|gb|AAF27714.1| PspA [Streptococcus pneumoniae] 38 0.46
gi|19923844|ref|NP_079001.2| hypothetical protein FLJ23518 [Homo... 38 0.46
gi|21707283|gb|AAH33726.1| Hypothetical protein FLJ23518 [Homo s... 38 0.46
gi|37680460|ref|NP_935069.1| outer membrane integrity protein To... 38 0.46
gi|11359535|pir||T50989 hypothetical protein B7F18.80 [imported]... 38 0.46
gi|22204258|emb|CAD43427.1| SI:dZ173A8.1.2 (novel protein simila... 38 0.46
gi|13124319|sp|O60282|KF5C_HUMAN Kinesin heavy chain isoform 5C ... 38 0.46
gi|23509641|ref|NP_702308.1| hypothetical protein [Plasmodium fa... 38 0.46
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 38 0.46
gi|31542287|ref|NP_598561.2| expressed sequence C78541 [Mus musc... 38 0.46
gi|40788283|dbj|BAA25457.2| KIAA0531 protein [Homo sapiens] 38 0.46
gi|39594446|emb|CAE72024.1| Hypothetical protein CBG19106 [Caeno... 38 0.46
gi|16758244|ref|NP_445938.1| kinesin family member 3C [Rattus no... 38 0.46
gi|17977690|ref|NP_524659.1| CG6727-PA [Drosophila melanogaster]... 38 0.46
gi|39594465|emb|CAE72043.1| Hypothetical protein CBG19125 [Caeno... 38 0.46
gi|32419433|ref|XP_330160.1| hypothetical protein [Neurospora cr... 38 0.46
gi|15207931|dbj|BAB62990.1| hypothetical protein [Macaca fascicu... 38 0.46
gi|22476379|gb|AAL92494.1| pneumococcal surface protein A [Strep... 38 0.46
gi|46108284|ref|XP_381200.1| hypothetical protein FG01024.1 [Gib... 38 0.46
gi|23508165|ref|NP_700835.1| DNA polymerase zeta catalytic subun... 38 0.46
gi|46124021|ref|XP_386564.1| hypothetical protein FG06388.1 [Gib... 38 0.46
gi|15240710|ref|NP_201533.1| WD-40 repeat family protein [Arabid... 38 0.46
gi|15230232|ref|NP_191274.1| dyskerin, putative / nucleolar prot... 38 0.46
gi|17391458|gb|AAH18663.1| FLJ23518 protein [Homo sapiens] 38 0.46
gi|12230342|sp|Q27746|DNM1_PARLI DNA (cytosine-5)-methyltransfer... 38 0.46
gi|2133776|pir||JC5210 DNA (cytosine-5-)-methyltransferase (EC 2... 38 0.46
gi|12707551|gb|AAF08305.2| proliferation-related protein P80 [Ho... 38 0.46
gi|23593265|ref|NP_472954.2| hypothetical protein [Plasmodium fa... 38 0.46
gi|6093304|gb|AAF03480.1| microtubule-associated protein 1A like... 38 0.46
gi|23478331|gb|EAA15449.1| RNB-like protein, putative [Plasmodiu... 37 0.60
gi|7494464|pir||T09127 probable erythrocyte-binding protein MAEB... 37 0.60
gi|39595465|emb|CAE60503.1| Hypothetical protein CBG04122 [Caeno... 37 0.60
gi|47222759|emb|CAG01726.1| unnamed protein product [Tetraodon n... 37 0.60
gi|32403506|ref|XP_322366.1| predicted protein [Neurospora crass... 37 0.60
gi|48095050|ref|XP_394344.1| similar to ENSANGP00000011595 [Apis... 37 0.60
gi|34495215|gb|AAQ73455.1| erythrocyte binding protein 2 [Plasmo... 37 0.60
gi|34784456|gb|AAH57473.1| LOC402866 protein [Danio rerio] 37 0.60
gi|24954539|gb|AAN64673.1| M protein [Streptococcus pyogenes] 37 0.60
gi|19074805|ref|NP_586311.1| hypothetical protein [Encephalitozo... 37 0.60
gi|50746144|ref|XP_420374.1| PREDICTED: hypothetical protein XP_... 37 0.60
gi|17505635|ref|NP_491917.1| putative nuclear protein, with 2 co... 37 0.60
gi|50310449|ref|XP_455244.1| unnamed protein product [Kluyveromy... 37 0.60
gi|23481592|gb|EAA17823.1| hypothetical protein [Plasmodium yoel... 37 0.60
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 37 0.60
gi|114205|sp|P13050|ARP4_STRPY IgA receptor precursor >gnl|BL_OR... 37 0.60
gi|24954550|gb|AAN64675.1| M protein [Streptococcus pyogenes] 37 0.60
gi|37595326|gb|AAQ94548.1| M protein [Streptococcus pyogenes] 37 0.60
gi|9858781|gb|AAG01128.1| BAC19.13 [Lycopersicon esculentum] 37 0.60
gi|34485644|gb|AAQ73207.1| M protein [Streptococcus pyogenes] 37 0.60
gi|34485684|gb|AAQ73227.1| M protein [Streptococcus pyogenes] 37 0.60
gi|21411351|gb|AAH31046.1| Meiosis-specific nuclear structural p... 37 0.60
gi|37595256|gb|AAQ94513.1| M protein [Streptococcus pyogenes] 37 0.60
gi|14422164|gb|AAK60425.1| cardiac muscle factor 1 [Gallus gallus] 37 0.60
gi|7682767|gb|AAF67353.1| PspA [Streptococcus pneumoniae] 37 0.60
gi|23612726|ref|NP_704265.1| hypothetical protein, conserved [Pl... 37 0.60
gi|46138001|ref|XP_390691.1| hypothetical protein FG10515.1 [Gib... 37 0.60
gi|17543780|ref|NP_502799.1| putative nuclear protein, with 2 co... 37 0.60
gi|15228587|ref|NP_189551.1| glycine-rich protein [Arabidopsis t... 37 0.60
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,... 37 0.60
gi|46308601|ref|ZP_00210793.1| COG0532: Translation initiation f... 37 0.60
gi|23509352|ref|NP_702019.1| hypothetical protein [Plasmodium fa... 37 0.60
gi|45382843|ref|NP_989976.1| cardiac muscle factor 1 CMF1 [Gallu... 37 0.60
gi|15240035|ref|NP_196819.1| exocyst subunit EXO70 family protei... 37 0.60
gi|34495216|gb|AAQ73456.1| erythrocyte binding protein 3 [Plasmo... 37 0.60
gi|28779470|gb|AAO46122.1| heat shock protein 90 [Streblomastix ... 37 0.78
gi|33944657|ref|XP_340476.1| translation initiation factor IF-2,... 37 0.78
gi|39594093|emb|CAE70203.1| Hypothetical protein CBG16678 [Caeno... 37 0.78
gi|23507939|ref|NP_700609.1| hypothetical protein [Plasmodium fa... 37 0.78
gi|38086943|ref|XP_136135.2| RIKEN cDNA 5330432J06 [Mus musculus] 37 0.78
gi|15644034|ref|NP_229083.1| DNA mismatch repair protein, putati... 37 0.78
gi|20151563|gb|AAM11141.1| LD15253p [Drosophila melanogaster] 37 0.78
gi|507791|gb|AAC09378.1| polymorphic antigen [Plasmodium falcipa... 37 0.78
gi|23593313|ref|NP_473064.2| hypothetical protein [Plasmodium fa... 37 0.78
gi|17539584|ref|NP_500689.1| putative protein, with 2 coiled coi... 37 0.78
gi|34865213|ref|XP_234156.2| similar to chromatin remodeling fac... 37 0.78
gi|26326305|dbj|BAC26896.1| unnamed protein product [Mus musculus] 37 0.78
gi|23490544|gb|EAA22295.1| unnamed protein product, putative [Pl... 37 0.78
gi|23508591|ref|NP_701260.1| hypothetical protein [Plasmodium fa... 37 0.78
gi|7108770|gb|AAF36532.1| IF2 protein [Drosophila melanogaster] 37 0.78
gi|24656849|ref|NP_651974.1| CG10840-PB [Drosophila melanogaster... 37 0.78
gi|22653669|sp|Q9UIF9|BA2A_HUMAN Bromodomain adjacent to zinc fi... 37 0.78
gi|7494310|pir||B71609 hypothetical protein PFB0680w - malaria p... 37 0.78
gi|7304921|ref|NP_038477.1| bromodomain adjacent to zinc finger ... 37 0.78
gi|3746909|gb|AAC64112.1| M protein [Streptococcus pyogenes] 37 0.78
gi|15238391|ref|NP_200747.1| XH/XS domain-containing protein [Ar... 37 0.78
gi|6324886|ref|NP_014955.1| Protein involved in pre-rRNA process... 37 0.78
gi|50730350|ref|XP_416860.1| PREDICTED: similar to DNA segment o... 37 0.78
gi|47209508|emb|CAF91244.1| unnamed protein product [Tetraodon n... 37 0.78
gi|47228073|emb|CAF97702.1| unnamed protein product [Tetraodon n... 37 0.78
gi|47498038|ref|NP_998865.1| hypothetical protein MGC69319 [Xeno... 37 0.78
gi|17509191|ref|NP_491919.1| putative nuclear protein, with 3 co... 37 0.78
gi|3493137|gb|AAC33291.1| kinesin-like protein KIF3C [Rattus nor... 37 0.78
gi|39597669|emb|CAE68360.1| Hypothetical protein CBG14099 [Caeno... 37 0.78
gi|23480767|gb|EAA17240.1| putative ubiquitin fusion degradation... 37 0.78
gi|50306375|ref|XP_453161.1| unnamed protein product [Kluyveromy... 37 0.78
gi|46105869|ref|XP_380574.1| hypothetical protein FG00398.1 [Gib... 37 0.78
gi|31228736|ref|XP_318103.1| ENSANGP00000017513 [Anopheles gambi... 37 0.78
gi|26337331|dbj|BAC32351.1| unnamed protein product [Mus musculus] 37 0.78
gi|27696233|gb|AAH43744.1| MGC52868 protein [Xenopus laevis] 37 0.78
gi|20138538|sp|O42287|ITN1_XENLA Intersectin 1 >gnl|BL_ORD_ID|11... 37 0.78
gi|18308026|gb|AAL67804.1| pneumococcal surface protein A [Strep... 37 0.78
gi|28828505|gb|AAO51113.1| similar to Dictyostelium discoideum (... 37 0.78
gi|32421759|ref|XP_331323.1| hypothetical protein [Neurospora cr... 37 0.78
gi|50405118|ref|YP_054210.1| hypothetical protein, coiled-coil d... 37 0.78
gi|23480480|gb|EAA17030.1| O1, putative [Plasmodium yoelii yoelii] 37 0.78
gi|39596922|emb|CAE59149.1| Hypothetical protein CBG02454 [Caeno... 37 0.78
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo... 37 0.78
gi|28376430|gb|AAM97269.1| major surface protein 3 [Anaplasma ma... 37 0.78
gi|6807925|emb|CAB70720.1| hypothetical protein [Homo sapiens] 37 1.0
gi|28779472|gb|AAO46123.1| heat shock protein 90 [Streblomastix ... 37 1.0
gi|2541912|dbj|BAA22851.1| troponin T [Mizuhopecten yessoensis] 37 1.0
gi|42733836|gb|AAS38754.1| hypothetical protein [Dictyostelium d... 37 1.0
gi|25395254|pir||B87754 protein C43E11.3 [imported] - Caenorhabd... 37 1.0
gi|41053303|ref|NP_956338.1| Unknown (protein for MGC:63563); wu... 37 1.0
gi|41352705|ref|NP_002245.4| kinesin family member 3C [Homo sapi... 37 1.0
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 37 1.0
gi|33096706|emb|CAE11867.1| hypothetical protein [Homo sapiens] 37 1.0
gi|45185293|ref|NP_983010.1| ABR064Wp [Eremothecium gossypii] >g... 37 1.0
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor... 37 1.0
gi|23510067|ref|NP_702733.1| hypothetical protein [Plasmodium fa... 37 1.0
gi|34015387|gb|AAQ56575.1| putative transposase [Oryza sativa (j... 37 1.0
gi|17552208|ref|NP_498392.1| tho2 (164.4 kD) (3H463) [Caenorhabd... 37 1.0
gi|2674350|gb|AAB88727.1| M-phase phosphoprotein-1 [Homo sapiens] 37 1.0
gi|27807325|ref|NP_777259.1| myosin, heavy polypeptide 10, non-m... 37 1.0
gi|35215057|dbj|BAC92415.1| putative far-red impaired response p... 37 1.0
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 37 1.0
gi|25141373|ref|NP_491340.2| nuclear protein SET and WW/Rsp5/WWP... 37 1.0
gi|48133166|ref|XP_393334.1| similar to myosin heavy chain 2, mu... 37 1.0
gi|13376088|ref|NP_079031.1| hypothetical protein FLJ13213 [Homo... 37 1.0
gi|49483684|ref|YP_040908.1| hypothetical phage protein [Staphyl... 37 1.0
gi|30984034|gb|AAP40331.1| M-phase phosphoprotein 1 [Homo sapiens] 37 1.0
gi|32564092|ref|NP_871842.1| nuclear protein SET (1E831) [Caenor... 37 1.0
gi|50287907|ref|XP_446383.1| unnamed protein product [Candida gl... 37 1.0
gi|28422433|gb|AAH44293.1| LOC398561 protein [Xenopus laevis] 37 1.0
gi|7512524|pir||T17272 hypothetical protein DKFZp434B0435.1 - hu... 37 1.0
gi|46049114|ref|NP_057279.2| M-phase phosphoprotein 1; mitotic k... 37 1.0
gi|23612496|ref|NP_704057.1| sin3 associated polypeptide p18-lik... 37 1.0
gi|45384506|ref|NP_990661.1| class II INCENP protein; class I IN... 37 1.0
gi|2826849|emb|CAA05252.1| KIF3C [Homo sapiens] 37 1.0
gi|28781760|gb|AAO46125.1| heat shock protein 90 [Streblomastix ... 37 1.0
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 37 1.0
gi|32412672|ref|XP_326816.1| hypothetical protein ( (AL451017) r... 37 1.0
gi|5921743|sp|Q12873|CHD3_HUMAN Chromodomain helicase-DNA-bindin... 37 1.0
gi|17557908|ref|NP_504832.1| CCHC type zinc finger containing p... 37 1.0
gi|1708493|sp|P53352|INCE_CHICK Inner centromere protein >gnl|BL... 37 1.0
gi|3298562|gb|AAC39923.1| zinc-finger helicase [Homo sapiens] 37 1.0
gi|23613480|ref|NP_703324.1| glutamic acid-rich protein (garp) [... 37 1.0
gi|17556691|ref|NP_499645.1| prion-like Q/N-rich domain protein,... 37 1.0
gi|15919888|dbj|BAB69456.1| mitotic kinesin-related protein [Hom... 37 1.0
gi|15146212|gb|AAK83589.1| AT3g57150/F24I3_230 [Arabidopsis thal... 37 1.0
gi|25395798|pir||G88480 protein C16A3.7 [imported] - Caenorhabdi... 37 1.0
gi|17568589|ref|NP_509537.1| apical Junction Molecule AJM-1, Jun... 36 1.3
gi|32421811|ref|XP_331349.1| predicted protein [Neurospora crass... 36 1.3
gi|17542856|ref|NP_500057.1| putative nuclear protein (4B983) [C... 36 1.3
gi|2541910|dbj|BAA22850.1| troponin T [Mizuhopecten yessoensis] 36 1.3
gi|33604045|gb|AAH56293.1| Zgc:77319 protein [Danio rerio] >gnl|... 36 1.3
gi|418112|sp|Q04750|TOP1_MOUSE DNA topoisomerase I >gnl|BL_ORD_I... 36 1.3
gi|31200081|ref|XP_308988.1| ENSANGP00000020311 [Anopheles gambi... 36 1.3
gi|27468186|ref|NP_764823.1| GrpE protein [Staphylococcus epider... 36 1.3
gi|26341966|dbj|BAC34645.1| unnamed protein product [Mus musculus] 36 1.3
gi|23479124|gb|EAA16038.1| repeat organellar protein-related [Pl... 36 1.3
gi|40786523|ref|NP_955465.1| zgc:65845; sb:cb494 [Danio rerio] >... 36 1.3
gi|10437384|dbj|BAB15043.1| unnamed protein product [Homo sapiens] 36 1.3
gi|15241428|ref|NP_199231.1| homeobox transcription factor, puta... 36 1.3
gi|7496461|pir||T15598 hypothetical protein C25A11.4a - Caenorha... 36 1.3
gi|2529575|gb|AAC05302.1| kinesin-like protein 3C [Homo sapiens] 36 1.3
gi|50420725|ref|XP_458899.1| unnamed protein product [Debaryomyc... 36 1.3
gi|46438938|gb|EAK98262.1| hypothetical protein CaO19.3831 [Cand... 36 1.3
gi|21359767|gb|AAM49603.1| phi12 tail fiber protein-like protein... 36 1.3
gi|15809050|ref|NP_296369.1| partitioning-defective protein 3 ho... 36 1.3
gi|2665936|gb|AAB88551.1| putative F1-ATP synthase alpha subunit... 36 1.3
gi|22758136|ref|NP_689993.1| hypothetical protein FLJ14503 [Homo... 36 1.3
gi|15604635|ref|NP_221153.1| ATP SYNTHASE ALPHA CHAIN (atpA) [R... 36 1.3
gi|45185544|ref|NP_983260.1| ACL144Cp [Eremothecium gossypii] >g... 36 1.3
gi|50875415|emb|CAG35255.1| related to ATP-dependent dsDNA exonu... 36 1.3
gi|4826998|ref|NP_005057.1| splicing factor proline/glutamine ri... 36 1.3
gi|17221648|dbj|BAB78478.1| preproMP73 [Cucurbita maxima] 36 1.3
gi|50419029|ref|XP_458036.1| unnamed protein product [Debaryomyc... 36 1.3
gi|25009833|gb|AAN71087.1| AT18855p [Drosophila melanogaster] 36 1.3
gi|25148106|ref|NP_741868.1| apical Junction Molecule AJM-1, Jun... 36 1.3
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib... 36 1.3
gi|7715573|gb|AAF68098.1| PspA [Streptococcus pneumoniae] 36 1.3
gi|27596794|gb|AAO20876.1| merozoite surface protein 3 alpha [Pl... 36 1.3
gi|4050087|gb|AAC97961.1| S164 [Homo sapiens] 36 1.3
gi|32345016|gb|AAM93518.1| ATP synthase alpha subunit [Rickettsi... 36 1.3
gi|29841319|gb|AAP06351.1| hypothetical protein [Schistosoma jap... 36 1.3
gi|7496462|pir||T15597 hypothetical protein C25A11.4b - Caenorha... 36 1.3
gi|38014635|gb|AAH04534.2| SFPQ protein [Homo sapiens] 36 1.3
gi|39590827|emb|CAE65200.1| Hypothetical protein CBG10075 [Caeno... 36 1.3
>gi|17531507|ref|NP_497027.1| sex determining protein, Masculinisation
Of Germline MOG-4 (114.3 kD) (mog-4) [Caenorhabditis
elegans]
gi|3915519|sp|O45244|MOG4_CAEEL Probable pre-mRNA splicing factor
ATP-dependent RNA helicase mog-4 (Sex determination
protein mog-4) (Masculinization of germ line protein 4)
gi|7446118|pir||T18832 probable RNA helicase - Caenorhabditis elegans
gi|3873886|emb|CAB03819.1| Hypothetical protein C04H5.6
[Caenorhabditis elegans]
gi|3873945|emb|CAB03845.1| Hypothetical protein C04H5.6
[Caenorhabditis elegans]
gi|9864172|gb|AAG01333.1| sex determining protein MOG-4
[Caenorhabditis elegans]
Length = 1008
Score = 624 bits (1608), Expect = e-177
Identities = 323/342 (94%), Positives = 323/342 (94%)
Frame = -1
Query: 1068 MSVEQFINDQLHSIVGISDRSICQYVHALAKKAKSAPDLVEKLRDAGDFPISPAIQSFAD 889
MSVEQFINDQLHSIVGISDRSICQYVHALAKKAKSAPDLVEKLRDAGDFPISPAIQSFAD
Sbjct: 1 MSVEQFINDQLHSIVGISDRSICQYVHALAKKAKSAPDLVEKLRDAGDFPISPAIQSFAD 60
Query: 888 QLMSRMPRQATSARQRGPTTAELAEQELNRLNRAVGVLEDYSASSTKTKNVRKRKESSSE 709
QLMSRMPRQATSARQRGPTTAELAEQELNRLNRAVGVLEDYSASSTKTKNVRKRKESSSE
Sbjct: 61 QLMSRMPRQATSARQRGPTTAELAEQELNRLNRAVGVLEDYSASSTKTKNVRKRKESSSE 120
Query: 708 DDEAPIXXXXXXXXXXXXXXXXXXXDIEAMEAKLDADIAERDALAARINKKEKDKTRNVM 529
DDEAPI DIEAMEAKLDADIAERDALAARINKKEKDKTRNVM
Sbjct: 121 DDEAPIKASKPGKSVKPSKSDDSESDIEAMEAKLDADIAERDALAARINKKEKDKTRNVM 180
Query: 528 EKKRDDNKDKEGSSMDKLREESRRQYLKKRKVDKLEELEAIVHDDQTLFAREKLTKREKA 349
EKKRDDNKDKEGSSMDKLREESRRQYLKKRKVDKLEELEAIVHDDQTLFAREKLTKREKA
Sbjct: 181 EKKRDDNKDKEGSSMDKLREESRRQYLKKRKVDKLEELEAIVHDDQTLFAREKLTKREKA 240
Query: 348 DMEYRKKVLEYTKAHGKAGDVMKMKRYHLPDASTKQIPSQYVEDDEEDFRPGGDGAKWEE 169
DMEYRKKVLEYTKAHGKAGDVMKMKRYHLPDASTKQIPSQYVEDDEEDFRPGGDGAKWEE
Sbjct: 241 DMEYRKKVLEYTKAHGKAGDVMKMKRYHLPDASTKQIPSQYVEDDEEDFRPGGDGAKWEE 300
Query: 168 EQLMASMLHLGAKDAKRKEQEFELLLDEKVDFIQALQMPGTN 43
EQLMASMLHLGAKDAKRKEQEFELLLDEKVDFIQALQMPGTN
Sbjct: 301 EQLMASMLHLGAKDAKRKEQEFELLLDEKVDFIQALQMPGTN 342