Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C02A12_1
         (642 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17557472|ref|NP_503968.1| glutathione S-Transferase (gst-33) ...   411   e-114
gi|39584542|emb|CAE74620.1| Hypothetical protein CBG22411 [Caeno...   348   5e-95
gi|8917596|gb|AAF81283.1| glutathione S-transferase [Haemonchus ...   160   3e-38
gi|39589143|emb|CAE57876.1| Hypothetical protein CBG00918 [Caeno...   157   2e-37
gi|17536525|ref|NP_495967.1| glutathione S-Transferase (gst-13) ...   154   2e-36
gi|17533777|ref|NP_496862.1| glutathione S-Transferase (gst-12) ...   153   3e-36
gi|39591199|emb|CAE73252.1| Hypothetical protein CBG20668 [Caeno...   152   7e-36
gi|39591202|emb|CAE73255.1| Hypothetical protein CBG20671 [Caeno...   151   9e-36
gi|17537493|ref|NP_497119.1| glutathione S-transferase family me...   149   6e-35
gi|17537489|ref|NP_497117.1| glutathione S-Transferase (gst-28) ...   147   2e-34
gi|17537487|ref|NP_497116.1| glutathione S-Transferase (gst-27) ...   146   3e-34
gi|17537261|ref|NP_496858.1| glutathione S-Transferase (gst-20) ...   146   3e-34
gi|39591186|emb|CAE73239.1| Hypothetical protein CBG20648 [Caeno...   144   1e-33
gi|39592704|emb|CAE62318.1| Hypothetical protein CBG06384 [Caeno...   144   1e-33
gi|17537491|ref|NP_497118.1| glutathione S-Transferase (gst-29) ...   143   2e-33
gi|17537485|ref|NP_497115.1| glutathione S-Transferase (gst-26) ...   142   7e-33
gi|17533779|ref|NP_496861.1| glutathione S-Transferase (gst-14) ...   140   2e-32
gi|17537497|ref|NP_497121.1| glutathione S-Transferase (gst-31) ...   138   1e-31
gi|7108568|gb|AAF36480.1| glutathione S-transferase 2 [Nematospi...   137   2e-31
gi|17565374|ref|NP_503532.1| predicted CDS, glutathione S-Transf...   137   2e-31
gi|39591201|emb|CAE73254.1| Hypothetical protein CBG20670 [Caeno...   137   2e-31
gi|47717441|gb|AAT37718.1| glutathione S-transferase [Ancylostom...   136   4e-31
gi|39585759|emb|CAE59961.1| Hypothetical protein CBG03451 [Caeno...   136   4e-31
gi|32565684|ref|NP_497123.2| predicted CDS, glutathione S-Transf...   135   7e-31
gi|17533775|ref|NP_496859.1| glutathione S-Transferase (gst-24) ...   135   9e-31
gi|1170109|sp|P46436|GTS1_ASCSU Glutathione S-transferase 1 (GST...   135   9e-31
gi|39596768|emb|CAE58995.1| Hypothetical protein CBG02268 [Caeno...   134   1e-30
gi|17534687|ref|NP_494884.1| glutathione S-Transferase (gst-8) [...   133   3e-30
gi|39596775|emb|CAE59002.1| Hypothetical protein CBG02278 [Caeno...   130   2e-29
gi|39585761|emb|CAE59963.1| Hypothetical protein CBG03453 [Caeno...   130   2e-29
gi|17534681|ref|NP_496357.1| glutathione S-Transferase (gst-5) [...   129   4e-29
gi|17533783|ref|NP_496863.1| glutathione S-Transferase (gst-16) ...   129   4e-29
gi|17535437|ref|NP_494887.1| glutathione S-Transferase (gst-9) [...   129   5e-29
gi|17533789|ref|NP_496864.1| glutathione S-Transferase (gst-19) ...   129   5e-29
gi|39585723|emb|CAE59925.1| Hypothetical protein CBG03411 [Caeno...   128   1e-28
gi|39591173|emb|CAE73226.1| Hypothetical protein CBG20632 [Caeno...   128   1e-28
gi|17540934|ref|NP_501846.1| glutathione S-Transferase (23.7 kD)...   127   2e-28
gi|17541378|ref|NP_501848.1| glutathione S-Transferase (23.9 kD)...   127   2e-28
gi|39591187|emb|CAE73240.1| Hypothetical protein CBG20649 [Caeno...   126   3e-28
gi|17560538|ref|NP_506983.1| glutathione S-Transferase (gst-38) ...   126   4e-28
gi|17534685|ref|NP_494883.1| glutathione S-Transferase (23.0 kD)...   126   4e-28
gi|17533781|ref|NP_496860.1| glutathione S-Transferase (gst-15) ...   123   3e-27
gi|39587305|emb|CAE74959.1| Hypothetical protein CBG22850 [Caeno...   122   8e-27
gi|39585760|emb|CAE59962.1| Hypothetical protein CBG03452 [Caeno...   121   1e-26
gi|39579272|emb|CAE56959.1| Hypothetical protein CBG24809 [Caeno...   121   1e-26
gi|32564842|ref|NP_741061.2| glutathione S-Transferase (gst-35) ...   121   1e-26
gi|32564637|ref|NP_494882.2| glutathione S-Transferase (23.6 kD)...   120   2e-26
gi|7498934|pir||T29984 hypothetical protein F11G11.3 - Caenorhab...   120   2e-26
gi|17537895|ref|NP_494902.1| glutathione S-Transferase (gst-30) ...   120   2e-26
gi|32565758|ref|NP_741060.2| predicted CDS, glutathione S-Transf...   118   1e-25
gi|39579271|emb|CAE56958.1| Hypothetical protein CBG24808 [Caeno...   115   7e-25
gi|17540932|ref|NP_501847.1| glutathione S-Transferase (21.8 kD)...   114   2e-24
gi|39591200|emb|CAE73253.1| Hypothetical protein CBG20669 [Caeno...   114   2e-24
gi|7505567|pir||T23485 hypothetical protein K08F4.11 - Caenorhab...   109   4e-23
gi|17533787|ref|NP_496866.1| glutathione S-Transferase (gst-18) ...   109   5e-23
gi|17566902|ref|NP_503492.1| glutathione S-Transferase (gst-21) ...   108   7e-23
gi|45384344|ref|NP_990342.1| prostaglandin-D synthase [Gallus ga...   108   1e-22
gi|39590943|emb|CAE58723.1| Hypothetical protein CBG01908 [Caeno...   108   1e-22
gi|17560032|ref|NP_507095.1| glutathione S-Transferase (gst-22) ...   107   2e-22
gi|25152187|ref|NP_509652.2| glutathione S-Transferase (23.9 kD)...   106   4e-22
gi|7505572|pir||T23484 hypothetical protein K08F4.6 - Caenorhabd...   105   6e-22
gi|17535439|ref|NP_494889.1| glutathione S-Transferase (gst-9) [...    99   5e-20
gi|32330663|gb|AAP79878.1| glutathione S-transferase [Solenopsis...    98   2e-19
gi|31205195|ref|XP_311546.1| ENSANGP00000023017 [Anopheles gambi...    97   3e-19
gi|31205193|ref|XP_311545.1| ENSANGP00000010247 [Anopheles gambi...    96   4e-19
gi|624328|gb|AAB01055.1| S-crystallin                                  96   6e-19
gi|7506384|pir||T23994 hypothetical protein R07B1.4 - Caenorhabd...    96   8e-19
gi|1170110|sp|P46437|GTS_MUSDO GLUTATHIONE S-TRANSFERASE (GST CL...    94   2e-18
gi|1170108|sp|P46428|GTS_ANOGA GLUTATHIONE S-TRANSFERASE (GST CL...    94   2e-18
gi|625079|gb|AAA97540.1| S-crystallin                                  94   3e-18
gi|24654347|ref|NP_725653.1| CG8938-PA [Drosophila melanogaster]...    94   3e-18
gi|134271|sp|P27009|SC1_OCTDO S-CRYSTALLIN 1 (OL1) >gnl|BL_ORD_I...    93   4e-18
gi|134283|sp|P27012|SC4_OCTDO S-CRYSTALLIN 4 (OL4) >gnl|BL_ORD_I...    93   5e-18
gi|39592701|emb|CAE62315.1| Hypothetical protein CBG06381 [Caeno...    92   6e-18
gi|134280|sp|P27014|SC2_OCTVU S-crystallin 2 >gnl|BL_ORD_ID|1015...    92   6e-18
gi|48095724|ref|XP_394518.1| similar to glutathione S-transferas...    92   6e-18
gi|159838|gb|AAA29403.1| S-crystallin                                  91   1e-17
gi|2495111|sp|Q25626|SC3_OCTVU S-CRYSTALLIN 3 >gnl|BL_ORD_ID|170...    91   1e-17
gi|38051840|gb|AAH60462.1| MGC68589 protein [Xenopus laevis]           91   1e-17
gi|134261|sp|P18426|SC11_OMMSL S-CRYSTALLIN SL11 (MAJOR LENS POL...    91   2e-17
gi|40362717|gb|AAR84628.1| glutathione S-transferase [Gryllotalp...    91   2e-17
gi|624306|gb|AAA97543.1| S-crystallin                                  90   3e-17
gi|134281|sp|P27011|SC3_OCTDO S-CRYSTALLIN 3 (OL3) >gnl|BL_ORD_I...    90   3e-17
gi|134279|sp|P27010|SC2_OCTDO S-CRYSTALLIN 2 (OL2) >gnl|BL_ORD_I...    90   3e-17
gi|20139191|sp|Q9JHF7|PGD2_MOUSE Glutathione-requiring prostagla...    89   5e-17
gi|31980908|ref|NP_062328.2| prostaglandin D2 synthase 2, hemato...    89   5e-17
gi|6671050|gb|AAF23078.1| glutathione S-transferase [Choristoneu...    89   7e-17
gi|159831|gb|AAA29402.1| S-crystallin                                  89   7e-17
gi|134275|sp|P18425|SC20_OMMSL S-CRYSTALLIN SL20-1 (MAJOR LENS P...    89   7e-17
gi|624322|gb|AAA97551.1| S-crystallin                                  89   7e-17
gi|17569381|ref|NP_508625.1| glutathione S-Transferase (gst-11) ...    89   9e-17
gi|39597765|emb|CAE68457.1| Hypothetical protein CBG14247 [Caeno...    89   9e-17
gi|32965121|gb|AAP91748.1| glutathione-requiring prostaglandin D...    88   1e-16
gi|624316|gb|AAA97548.1| S-crystallin                                  88   1e-16
gi|13928888|ref|NP_113832.1| prostaglandin D2 synthase 2; prosta...    88   1e-16
gi|21435011|gb|AAM53611.1| glutathione S-transferase S1-2 [Anoph...    88   2e-16
gi|84595|pir||S06442 crystallin (clone pSl20) - Sloane's squid >...    88   2e-16
gi|21952442|gb|AAM82563.1| glutathione s-transferase [Xenopus la...    88   2e-16
gi|624326|gb|AAB01054.1| S-crystallin                                  87   2e-16
gi|7657457|ref|NP_055300.1| prostaglandin-D synthase; hematopoie...    87   2e-16
gi|913849|gb|AAA73508.1| lens-specific S-crystallin {SL20-1} [oc...    87   2e-16
gi|624310|gb|AAA97545.1| S-crystallin                                  87   3e-16
gi|1170111|sp|P46088|GTS_OMMSL Glutathione S-transferase (GST cl...    87   4e-16
gi|32450087|gb|AAH53774.1| MGC64301 protein [Xenopus laevis]           87   4e-16
gi|30749298|pdb|1IYH|A Chain A, Crystal Structure Of Hematopoiet...    86   6e-16
gi|624318|gb|AAA97549.1| S-crystallin                                  86   8e-16
gi|17563170|ref|NP_504894.1| glutathione S-Transferase (25.0 kD)...    86   8e-16
gi|1065021|pdb|1GSQ|  Glutathione S-Transferase (Gst) (E.C.2.5.1...    85   1e-15
gi|1170107|sp|P46429|GTS2_MANSE GLUTATHIONE S-TRANSFERASE 2 (GST...    84   2e-15
gi|624302|gb|AAA97541.1| S-crystallin                                  84   2e-15
gi|2326190|gb|AAB72147.1| allergen Bla g 5 [Blattella germanica]       84   2e-15
gi|6225491|sp|O18598|GTS1_BLAGE Glutathione S-transferase (GST c...    84   2e-15
gi|624336|gb|AAB01059.1| S-crystallin                                  84   3e-15
gi|12859396|dbj|BAB31640.1| unnamed protein product [Mus musculus]     84   3e-15
gi|20141353|sp|P24472|GTA4_MOUSE Glutathione S-transferase 5.7 (...    83   4e-15
gi|12848219|dbj|BAB27873.1| unnamed protein product [Mus musculus]     83   4e-15
gi|6754082|ref|NP_034487.1| glutathione S-transferase, alpha 4 [...    83   4e-15
gi|49900017|gb|AAH77016.1| Unknown (protein for MGC:89746) [Xeno...    83   4e-15
gi|6137390|pdb|1B48|A Chain A, Crystal Structure Of Mgsta4-4 In ...    83   4e-15
gi|624312|gb|AAA97546.1| S-crystallin                                  82   7e-15
gi|624332|gb|AAB01057.1| S-crystallin                                  82   9e-15
gi|624308|gb|AAA97544.1| S-crystallin                                  82   9e-15
gi|7387485|gb|AAB33637.2| glutathione S-transferase; GST [Nemato...    81   1e-14
gi|49532912|dbj|BAD26691.1| Glutathione S-transferase [Plutella ...    81   1e-14
gi|624330|gb|AAB01056.1| S-crystallin                                  80   3e-14
gi|134268|sp|P27016|SC18_OMMSL S-CRYSTALLIN SL18 >gnl|BL_ORD_ID|...    80   3e-14
gi|1170086|sp|Q08862|GTC_RABIT GLUTATHIONE S-TRANSFERASE YC (ALP...    80   4e-14
gi|17565768|ref|NP_503701.1| glutathione S-Transferase (24.8 kD)...    79   7e-14
gi|39583549|emb|CAE65653.1| Hypothetical protein CBG10717 [Caeno...    79   1e-13
gi|624324|gb|AAB01053.1| S-crystallin                                  78   1e-13
gi|17540724|ref|NP_499981.1| glutathione S-Transferase (24.9 kD)...    78   2e-13
gi|27720723|ref|XP_217195.1| similar to GLUTATHIONE S-TRANSFERAS...    78   2e-13
gi|50744870|ref|XP_419913.1| PREDICTED: glutathione S-transferas...    78   2e-13
gi|38511981|gb|AAH60914.1| Zgc:73173 protein [Danio rerio]             78   2e-13
gi|624320|gb|AAA97550.1| S-crystallin                                  77   2e-13
gi|13096120|pdb|1EV4|A Chain A, Rat Glutathione S-Transferase A1...    77   2e-13
gi|13096123|pdb|1EV9|A Chain A, Rat Glutathione S-Transferase A1...    77   2e-13
gi|47604962|ref|NP_990743.1| glutathione transferase [Gallus gal...    77   3e-13
gi|50744868|ref|XP_444657.1| PREDICTED: glutathione transferase ...    77   3e-13
gi|624304|gb|AAA97542.1| S-crystallin                                  77   3e-13
gi|11514502|pdb|1F3B|A Chain A, Crystal Structure Of Mgsta1-1 In...    77   3e-13
gi|121713|sp|P04903|GTA2_RAT Glutathione S-transferase Ya-2 (Lig...    77   3e-13
gi|30749486|pdb|1ML6|A Chain A, Crystal Structure Of Mgsta2-2 In...    77   3e-13
gi|8393499|ref|NP_058709.1| glutathione-S-transferase, alpha typ...    77   4e-13
gi|66611|pir||XURTG glutathione transferase (EC 2.5.1.18) class ...    77   4e-13
gi|49169816|ref|NP_001001777.1| glutathione S-transferase [Gallu...    77   4e-13
gi|624334|gb|AAB01058.1| S-crystallin                                  76   5e-13
gi|11514499|pdb|1F3A|A Chain A, Crystal Structure Of Mgsta1-1 In...    76   5e-13
gi|50513281|pdb|1PKW|A Chain A, Crystal Structure Of Human Gluta...    76   5e-13
gi|121710|sp|P10648|GTA2_MOUSE Glutathione S-transferase GT41A (...    76   5e-13
gi|121712|sp|P13745|GTA1_MOUSE Glutathione S-transferase Ya chai...    76   5e-13
gi|22091454|ref|NP_665683.1| glutathione S-transferase A1; GST, ...    76   6e-13
gi|50513287|pdb|1PL2|A Chain A, Crystal Structure Of Human Gluta...    76   6e-13
gi|442977|pdb|1GUH|A Chain A, Glutathione S-Transferase A1-1 (E....    76   6e-13
gi|1127144|pdb|1GSE|A Chain A, Glutathione Transferase A1-1 Comp...    76   6e-13
gi|50263046|ref|NP_032208.2| glutathione S-transferase, alpha 2 ...    75   8e-13
gi|624314|gb|AAA97547.1| S-crystallin                                  75   1e-12
gi|1654009|emb|CAA70303.1| glutathione S-transferase [Mesocricet...    75   1e-12
gi|951352|gb|AAA74634.1| glutathione S-transferase A3                  75   1e-12
gi|12005978|gb|AAG44695.1| glutathione S-transferase Ia [Onchoce...    75   1e-12
gi|481923|pir||S40165 glutathione transferase (EC 2.5.1.18) - ne...    75   1e-12
gi|477414|pir||A48982 glutathione transferase (EC 2.5.1.18) 2 - ...    75   1e-12
gi|11258625|pir||A49365 glutathione transferase (EC 2.5.1.18) al...    75   1e-12
gi|49169814|ref|NP_001001776.1| glutathione S-transferase class-...    75   1e-12
gi|24308514|ref|NP_714543.1| glutathione transferase A5 [Homo sa...    75   1e-12
gi|1170077|sp|P46434|GT1_ONCVO GLUTATHIONE S-TRANSFERASE 1 >gnl|...    75   1e-12
gi|7110611|ref|NP_032207.1| glutathione S-transferase, alpha 1 (...    75   1e-12
gi|12005980|gb|AAG44696.1| glutathione S-transferase Ib [Onchoce...    74   2e-12
gi|39588668|emb|CAE58192.1| Hypothetical protein CBG01286 [Caeno...    74   2e-12
gi|2495107|sp|P80894|GTA1_ANTST Glutathione S-transferase (GST c...    74   2e-12
gi|12832492|dbj|BAB22131.1| unnamed protein product [Mus musculus]     74   2e-12
gi|13928688|ref|NP_113697.1| glutathione S-transferase, alpha 1;...    74   2e-12
gi|31981724|ref|NP_034486.2| glutathione S-transferase, alpha 3 ...    74   2e-12
gi|38173961|gb|AAH61134.1| Unknown (protein for MGC:74264) [Mus ...    74   2e-12
gi|23428564|gb|AAL23713.1| glutathione S-transferase [Opisthorch...    74   2e-12
gi|1065322|pdb|1AGS|A Chain A, Alpha Glutathione S-Transferase (...    74   2e-12
gi|187132|gb|AAA36174.1| gluthione S-transferase subunit 1 (GST,...    74   3e-12
gi|1170085|sp|P46418|GTC2_RAT Glutathione S-transferase Yc-2 (Ch...    74   3e-12
gi|24430144|ref|NP_000838.3| glutathione S-transferase A3; gluta...    73   5e-12
gi|193703|gb|AAA37751.1| glutathione transferase                       73   5e-12
gi|18089048|gb|AAH20619.1| Glutathione S-transferase A3 [Homo sa...    72   7e-12
gi|48106995|ref|XP_393084.1| similar to Glutathione-requiring pr...    72   7e-12
gi|1170102|sp|P46427|GTP_ONCVO Glutathione S-transferase 2 (GST ...    72   9e-12
gi|5360517|dbj|BAA82038.1| glutathione s-transferase [Cavia porc...    72   9e-12
gi|20988789|gb|AAH30173.1| Gsta2 protein [Mus musculus]                72   9e-12
gi|8928140|sp|P81706|GTA1_CAVPO Glutathione S-transferase A (GST...    72   9e-12
gi|7188365|gb|AAF37739.1| glutathione S-transferase alpha [Rattu...    72   9e-12
gi|7434039|pir||S24330 glutathione transferase (EC 2.5.1.18) alp...    72   1e-11
gi|8218078|emb|CAB92770.1| dJ152L7.3 (glutathione S-transferase ...    72   1e-11
gi|257476|gb|AAB23672.1| glutathione S-transferase A2 subunit [H...    72   1e-11
gi|1170101|sp|P46426|GTP_DIRIM Glutathione S-transferase (GST cl...    71   2e-11
gi|20149504|ref|NP_000837.2| glutathione S-transferase A2; gluta...    71   2e-11
gi|2495106|sp|Q28035|GTA1_BOVIN Glutathione S-transferase alpha ...    71   2e-11
gi|1170081|sp|Q08863|GTA1_RABIT Glutathione S-transferase alpha ...    71   2e-11
gi|17533785|ref|NP_496865.1| glutathione S-Transferase (gst-17) ...    71   2e-11
gi|7687909|gb|AAD42800.2| microsomal glutathione-S-transferase [...    71   2e-11
gi|3514020|gb|AAC34097.1| glutathione transferase; PiGSTII [Plat...    70   3e-11
gi|975211|emb|CAA58767.1| glutathione transferase [Onchocerca vo...    70   3e-11
gi|2829287|gb|AAC00518.1| glutathione S-transferase [Schistosoma...    70   3e-11
gi|1389744|gb|AAB03573.1| glutathione-S-transferase                    70   3e-11
gi|21263651|sp|P81942|GTP1_BUFBU Glutathione S-transferase P 1 (...    70   3e-11
gi|45382235|ref|NP_990149.1| glutathione S-transferase class-alp...    70   3e-11
gi|50400547|sp|Q8JFZ2|GTP1_XENLA Glutathione S-transferase P 1 (...    70   3e-11
gi|4335859|gb|AAD17488.1| 28 kDa glutathione S-transferase; 28GS...    70   3e-11
gi|47523158|ref|NP_999015.1| glutathione S-transferase [Sus scro...    70   4e-11
gi|2058287|emb|CAA73325.1| glutathione transferase [Brugia malayi]     69   8e-11
gi|121699|sp|P26624|GT28_SCHJA Glutathione S-transferase 28 kDa ...    69   8e-11
gi|47523832|ref|NP_999554.1| glutathione S-transferase [Sus scro...    69   8e-11
gi|38049405|ref|XP_136557.2| similar to class-alpha glutathione ...    68   1e-10
gi|28630830|gb|AAO45827.1| glutathione S-transferase [Wuchereria...    68   1e-10
gi|5524944|emb|CAB50870.1| glutathione S-transferase [Ovis aries]      68   1e-10
gi|39588669|emb|CAE58193.1| Hypothetical protein CBG01287 [Caeno...    67   3e-10
gi|17564840|ref|NP_503889.1| glutathione S-Transferase (gst-23) ...    67   4e-10
gi|31559115|gb|AAP50848.1| glutathione S-transferase 2 [Bombyx m...    67   4e-10
gi|47228894|emb|CAG09409.1| unnamed protein product [Tetraodon n...    67   4e-10
gi|34859224|ref|XP_234810.2| similar to GLUTATHIONE S-TRANSFERAS...    66   5e-10
gi|38636658|dbj|BAD02978.1| glutathione S-transferase [Blepharis...    66   6e-10
gi|49532926|dbj|BAD26698.1| Glutathione S transferase 2-like pro...    66   6e-10
gi|39588670|emb|CAE58194.1| Hypothetical protein CBG01288 [Caeno...    66   6e-10
gi|4504173|ref|NP_001503.1| glutathione S-transferase A4; glutat...    65   1e-09
gi|3402001|pdb|1FHE|  Glutathione Transferase (Fh47) From Fascio...    65   1e-09
gi|3915723|sp|P31670|GT27_FASHE Glutathione S-transferase 26 kDa...    65   1e-09
gi|47076115|emb|CAD90167.1| mu class glutathione S-transferase [...    65   1e-09
gi|32567128|ref|NP_503698.2| glutathione S-transferase, N-termin...    64   2e-09
gi|21450105|ref|NP_659118.1| cDNA sequence BC021614 [Mus musculu...    64   2e-09
gi|25453412|ref|NP_620430.1| glutathione S-transferase, pi 2 [Ra...    64   2e-09
gi|16518972|gb|AAL25087.1| glutathione s-transferase [Plasmodium...    64   2e-09
gi|23509408|ref|NP_702075.1| glutathione s-transferase, putative...    64   2e-09
gi|7434040|pir||S77958 glutathione transferase (EC 2.5.1.18) alp...    64   3e-09
gi|265545|gb|AAB25369.1| alpha-class glutathione S-transferase o...    63   4e-09
gi|345859|pir||S29658 glutathione transferase (EC 2.5.1.18) omeg...    63   4e-09
gi|34539115|gb|AAQ74441.1| glutathione S-transferase [Haemaphysa...    63   4e-09
gi|265539|gb|AAB25364.1| alpha-class glutathione S-transferase o...    63   5e-09
gi|345858|pir||S29657 glutathione transferase (EC 2.5.1.18) omeg...    63   5e-09
gi|121700|sp|P09792|GT28_SCHMA Glutathione S-transferase 28 kDa ...    62   7e-09
gi|384152|prf||1905266C glutathione S transferase:ISOTYPE=GST47        62   1e-08
gi|21263652|sp|P83325|GTP2_BUFBU Glutathione S-transferase P 2 (...    62   1e-08
gi|159060|gb|AAA29140.1| mu-glutathione transferase [Fasciola he...    61   2e-08
gi|39585029|emb|CAE62680.1| Hypothetical protein CBG06825 [Caeno...    60   3e-08
gi|56330|emb|CAA25203.1| unnamed protein product [Rattus norvegi...    60   3e-08
gi|10092608|ref|NP_038569.1| glutathione S-transferase, pi 1; Gs...    60   3e-08
gi|34536838|gb|AAQ73932.1| GST-like hemolymph protein [Corcyra c...    60   4e-08
gi|41387382|gb|AAS01601.1| Pi-class glutathione S-trasferase [An...    60   4e-08
gi|3023905|sp|Q60550|GTP_MESAU Glutathione S-transferase P (GST ...    60   4e-08
gi|4699783|pdb|22GS|A Chain A, Human Glutathione S-Transferase P...    60   5e-08
gi|32401425|ref|NP_861461.1| glutathione S-transferase, pi 2; Gs...    60   5e-08
gi|4557944|pdb|1GTI|A Chain A, Modified Glutathione S-Transferas...    59   6e-08
gi|576133|pdb|1GLP|A Chain A, Glutathione S-Transferase Yfyf (Cl...    59   6e-08
gi|4139536|pdb|17GS|A Chain A, Glutathione S-Transferase P1-1 >g...    59   6e-08
gi|4630882|dbj|BAA76974.1| glutathione S-transferase [Oncorhynch...    59   8e-08
gi|1170100|sp|P46424|GTP_CRILO Glutathione S-transferase P (GST ...    59   1e-07
gi|2264324|gb|AAB63382.1| 28 kDa glutathione-S transferase             59   1e-07
gi|2204207|emb|CAA30894.1| glutathione S-transferase [Homo sapiens]    59   1e-07
gi|2554831|pdb|2PGT|A Chain A, Crystal Structure Of Human Glutat...    59   1e-07
gi|4504183|ref|NP_000843.1| glutathione transferase; deafness, X...    59   1e-07
gi|5822569|pdb|4PGT|A Chain A, Crystal Structure Of Hgstp1-1[v10...    59   1e-07
gi|23480514|gb|EAA17054.1| glutathione s-transferase [Plasmodium...    59   1e-07
gi|1083336|pir||A55140 glutathione transferase (EC 2.5.1.18) piA...    59   1e-07
gi|2624495|pdb|1BAY|A Chain A, Glutathione S-Transferase Yfyf Cy...    58   1e-07
gi|20664358|pdb|1LBK|A Chain A, Crystal Structure Of A Recombina...    57   2e-07
gi|3915724|sp|P31671|GT28_FASHE GLUTATHIONE S-TRANSFERASE 26 KD ...    57   2e-07
gi|20982640|ref|XP_159712.1| similar to glutathione transferase ...    57   2e-07
gi|2914230|pdb|4GSS|A Chain A, Human Glutathione S-Transferase P...    57   2e-07
gi|494066|pdb|1GSS|A Chain A, Glutathione S-Transferase (E.C.2.5...    57   2e-07
gi|2780951|pdb|1AQV|A Chain A, Glutathione S-Transferase In Comp...    57   2e-07
gi|726098|gb|AAC13869.1| glutathione S-transferase-P1c [Homo sap...    57   3e-07
gi|46329897|gb|AAH68854.1| Unknown (protein for IMAGE:3399306) [...    57   3e-07
gi|23200508|pdb|1MD3|A Chain A, A Folding Mutant Of Human Class ...    57   3e-07
gi|23200510|pdb|1MD4|A Chain A, A Folding Mutant Of Human Class ...    57   3e-07
gi|34861384|ref|XP_215189.2| similar to hypothetical protein MGC...    57   4e-07
gi|17553834|ref|NP_499006.1| glutathione S-Transferase, P subuni...    57   4e-07
gi|25153666|ref|NP_503673.2| glutathione S-transferase, N-termin...    57   4e-07
gi|17561486|ref|NP_503671.1| glutathione S-transferase, N-termin...    57   4e-07
gi|11514448|pdb|1EOG|A Chain A, Crystal Structure Of Pi Class Gl...    56   5e-07
gi|631017|pir||S43432 glutathione transferase (EC 2.5.1.18) alph...    56   7e-07
gi|1346208|sp|P47954|GTP_CRIMI Glutathione S-transferase P (GST ...    56   7e-07
gi|4574306|gb|AAD23997.1| glutathione S-transferase [Fasciola gi...    56   7e-07
gi|34811305|pdb|1PX7|A Chain A, A Folding Mutant Of Human Class ...    56   7e-07
gi|29135319|ref|NP_803481.1| glutathione S-transferase A2 [Bos t...    55   9e-07
gi|34811303|pdb|1PX6|A Chain A, A Folding Mutant Of Human Class ...    55   9e-07
gi|39654103|pdb|1KBN|A Chain A, Glutathione Transferase Mutant >...    55   9e-07
gi|161013|gb|AAA29892.1| 28kDa glutathione-S transferase               55   1e-06
gi|2495108|sp|Q28514|GTP_MACMU Glutathione S-transferase P (GST ...    55   1e-06
gi|22671702|gb|AAN04480.1| glutathione S-transferase GSTP1-1 [Bu...    55   1e-06
gi|544443|sp|P30113|GT28_SCHBO GLUTATHIONE S-TRANSFERASE 28 KD (...    55   1e-06
gi|232199|sp|P30114|GT28_SCHHA Glutathione S-transferase 28 kDa ...    55   1e-06
gi|26347823|dbj|BAC37560.1| unnamed protein product [Mus musculus]     55   1e-06
gi|29135329|ref|NP_803482.1| glutathione S-transferase pi [Bos t...    55   1e-06
gi|21591409|gb|AAM64045.1| glutathione S-transferase [Taenia sol...    55   1e-06
gi|28828694|gb|AAO51292.1| similar to Xenopus laevis (African cl...    55   1e-06
gi|11514451|pdb|1EOH|A Chain A, Glutathione Transferase P1-1 >gn...    54   2e-06
gi|159058|gb|AAA29139.1| mu-glutathione transferase [Fasciola he...    53   4e-06
gi|384151|prf||1905266B glutathione S transferase:ISOTYPE=GST7         53   4e-06
gi|3913799|sp|P56598|GT29_FASHE Glutathione S-transferase 26 kDa...    53   6e-06
gi|477190|pir||A48388 glutathione S-transferase - liver fluke (f...    53   6e-06
gi|87564|pir||A41177 glutathione transferase (EC 2.5.1.18) / fat...    52   7e-06
gi|2316076|gb|AAB66318.1| glutathione S-transferase [Echinococcu...    52   1e-05
gi|4959550|gb|AAD34393.1| glutathione S-transferase class-alpha ...    52   1e-05
gi|1004227|emb|CAA59739.1| glutathione transferase [Echinococcus...    51   2e-05
gi|46115920|ref|XP_383978.1| hypothetical protein FG03802.1 [Gib...    51   2e-05
gi|27462836|gb|AAO15607.1| glutathione S-transferase [Sarcoptes ...    50   3e-05
gi|2738935|gb|AAD04712.1| glutathione transferase [Homo sapiens]       50   3e-05
gi|22671705|gb|AAN04481.1| glutathione S-transferase GSTP2-2 [Bu...    50   4e-05
gi|34865663|ref|XP_345686.1| similar to GLUTATHIONE S-TRANSFERAS...    50   4e-05
gi|32346216|gb|AAN85429.1| glutathione-S-transferase [Pyrocystis...    50   4e-05
gi|6013379|gb|AAF01323.1| glutathione S-transferase Pi [Capra hi...    50   4e-05
gi|18858197|ref|NP_571809.1| glutathione S-transferase pi [Danio...    49   6e-05
gi|34539117|gb|AAQ74442.1| glutathione S-transferase [Rhipicepha...    49   6e-05
gi|4115420|dbj|BAA36351.1| 24 kDa female-specific fat body prote...    49   8e-05
gi|4115418|dbj|BAA36350.1| 24 kDa female-specific fat body prote...    49   1e-04
gi|2147980|pir||S61363 prostaglandin-H E-isomerase chain H - Asc...    49   1e-04
gi|1254920|gb|AAB35901.1| prostaglandin-H E-isome=sigma-class gl...    49   1e-04
gi|18280276|gb|AAL02368.1| class gamma glutathione S-transferase...    48   1e-04
gi|10443248|emb|CAC10391.1| dJ214M20.3 (glutathione S-transferas...    48   1e-04
gi|104677|pir||S18464 glutathione transferase (EC 2.5.1.18) mu2 ...    47   3e-04
gi|46048786|ref|NP_990421.1| glutathione S-transferases CL2 [Gal...    47   3e-04
gi|39592078|emb|CAE75298.1| Hypothetical protein CBG23268 [Caeno...    47   3e-04
gi|10120620|pdb|1C72|A Chain A, Tyr115, Gln165 And Trp209 Contri...    47   3e-04
gi|2981970|pdb|1GSU|A Chain A, An Avian Class-Mu Glutathione S-T...    47   3e-04
gi|49097402|ref|XP_410161.1| hypothetical protein AN6024.2 [Aspe...    47   4e-04
gi|1943418|pdb|2GSR|A Chain A, Structure Of Porcine Class Pi Glu...    45   0.001
gi|544445|sp|P80031|GTP_PIG Glutathione S-transferase P (GST P1-...    45   0.001
gi|108301|pir||S13780 glutathione transferase (EC 2.5.1.18) clas...    45   0.001
gi|13447445|gb|AAK26668.1| lens-specific S-crystallin [Eledone a...    45   0.001
gi|34874562|ref|XP_343546.1| similar to class-alpha glutathione ...    44   0.003
gi|17561414|ref|NP_505972.1| glutathione S-transferase, C-termin...    44   0.003
gi|46204955|ref|ZP_00049243.2| COG0625: Glutathione S-transferas...    44   0.003
gi|1170095|sp|P46419|GTM1_DERPT Glutathione S-transferase (GST c...    44   0.003
gi|30145756|emb|CAA96662.2| Hypothetical protein F55A11.6 [Caeno...    44   0.003
gi|26990448|ref|NP_745873.1| glutathione S-transferase family pr...    43   0.005
gi|6625558|gb|AAF19264.1| glutathione S-transferase [Psoroptes o...    43   0.005
gi|1699065|gb|AAB37349.1| glutathione S-transferase [Cloning vec...    42   0.008
gi|3983117|gb|AAC83809.1| glutathione S-transferase [Expression ...    42   0.008
gi|1850359|gb|AAB48035.1| GST-fusion protein [Expression vector ...    42   0.008
gi|595738|gb|AAA57110.1| glutathione S-transferase                     42   0.008
gi|595714|gb|AAA57092.1| glutathione S-transferase                     42   0.008
gi|595730|gb|AAA57104.1| glutathione S-transferase                     42   0.008
gi|595734|gb|AAA57107.1| glutathione S-transferase                     42   0.008
gi|1850357|gb|AAB48034.1| GST-fusion protein [Expression vector ...    42   0.008
gi|595722|gb|AAA57098.1| glutathione S-transferase                     42   0.008
gi|1814366|gb|AAB41882.1| GST-6his [Expression vector pGEX-2T-6H]      42   0.008
gi|3002508|gb|AAC08724.1| GSTmFra2/2-242 [Expression vector pGH/...    42   0.008
gi|15099967|gb|AAK84183.1| glutathione-S-transferase-nitroreduct...    42   0.008
gi|21666485|gb|AAM73721.1| glutathione-S-transferase/nitroreduct...    42   0.008
gi|15099965|gb|AAK84182.1| glutathione-S-transferase-nitroreduct...    42   0.008
gi|595726|gb|AAA57101.1| glutathione S-transferase                     42   0.008
gi|1527195|gb|AAB88910.1| glutathione S-transferase [Expression ...    42   0.008
gi|17507251|ref|NP_490857.1| glutathione S-Transferase (gst-25) ...    42   0.008
gi|23821204|emb|CAD53317.1| glutathione-S-transferase [Cloning v...    42   0.008
gi|3002504|gb|AAC08721.1| GSTmFra2/159-327 [Expression vector pG...    42   0.008
gi|1699061|gb|AAB37346.1| glutathione S-transferase [Cloning vec...    42   0.008
gi|1814368|gb|AAB41883.1| GST-6his [Expression vector pGEX-2T-6H...    42   0.008
gi|1850361|gb|AAB48036.1| GST-fusion protein [Expression vector ...    42   0.008
gi|3002500|gb|AAC08718.1| GSTmFra2/79-242 [Expression vector pGH...    42   0.008
gi|84402|pir||A26484 glutathione transferase (EC 2.5.1.18) - flu...    42   0.008
gi|3242311|emb|CAA11559.1| glutathione-S-transferase [synthetic ...    42   0.008
gi|809436|pdb|1GNE|  Glutathione S-Transferase (E.C.2.5.1.18) Fu...    42   0.008
gi|595710|gb|AAA57089.1| glutathione S-transferase                     42   0.008
gi|595718|gb|AAA57095.1| glutathione S-transferase                     42   0.008
gi|208443|gb|AAB59734.1| glutathione transferase                       42   0.008
gi|595706|gb|AAA57086.1| glutathione S-transferase                     42   0.008
gi|1699069|gb|AAB37352.1| glutathione S-transferase [Cloning vec...    42   0.008
gi|20385949|gb|AAM21516.1| GST-M.SPRX methyltransferase fusion p...    42   0.008
gi|3002496|gb|AAC08715.1| GSTmFra2/2-163 [Expression vector pGH/...    42   0.008
gi|23504743|emb|CAD29477.1| glutathione transferase F4 [Triticum...    42   0.008
gi|15216974|gb|AAK92454.1| GST-loxP-cre recombinase fusion prote...    42   0.008
gi|3002512|gb|AAC08727.1| GSTmFra2/79-327 [Expression vector pGH...    42   0.008
gi|4389298|pdb|1BG5|  Crystal Structure Of The Ankyrin Binding D...    42   0.008
gi|38155842|gb|AAR12690.1| glutathione S-transferase [Expression...    42   0.008
gi|121697|sp|P08515|GT26_SCHJA Glutathione S-transferase 26 kDa ...    42   0.008
gi|4929901|pdb|1B8X|A Chain A, Glutathione S-Transferase Fused W...    42   0.008
gi|595742|gb|AAA57113.1| glutathione S-transferase                     42   0.008
gi|3002516|gb|AAC08730.1| GSTmFra2/2-327 [Expression vector pGH/...    42   0.008
gi|208305|gb|AAA72682.1| glutathione transferase                       42   0.008
gi|3184404|dbj|BAA28713.1| GST-stuffer fusion protein [Cloning v...    42   0.008
gi|6980848|pdb|1DUG|A Chain A, Structure Of The Fibrinogen G Cha...    42   0.008
gi|467623|emb|CAA55122.1| fusion peptide [synthetic construct]         42   0.008
gi|36959131|gb|AAQ87556.1| Glutathione S-transferase [Rhizobium ...    41   0.022
gi|19848969|gb|AAL99403.1| glutathione S-transferase [Boophilus ...    40   0.029
gi|21956654|gb|AAL02369.3| class gamma glutathione S-transferase...    40   0.029
gi|13447444|gb|AAK26667.1| lens-specific S-crystallin [Eledone a...    40   0.038
gi|84594|pir||S14892 crystallin (clone pSl12) - Sloane's squid (...    40   0.050
gi|46322289|ref|ZP_00222660.1| COG0625: Glutathione S-transferas...    40   0.050
gi|2465439|gb|AAB72099.1| glutathione-dependent prostaglandin D ...    39   0.065
gi|38174001|gb|AAH61226.1| Unknown (protein for MGC:74375) [Mus ...    39   0.065
gi|15237931|ref|NP_197224.1| glutathione S-transferase, putative...    39   0.065
gi|121722|sp|P16413|GTMU_CAVPO Glutathione S-transferase B (GST ...    39   0.11
gi|3023918|sp|Q52828|GSTA_RHILE GSTA PROTEIN >gnl|BL_ORD_ID|1716...    38   0.14
gi|14334818|gb|AAK59587.1| putative elongation factor 1B gamma [...    38   0.19
gi|15223649|ref|NP_176084.1| elongation factor 1B-gamma, putativ...    38   0.19
gi|134272|sp|P27013|SC1_OCTVU S-CRYSTALLIN 1 >gnl|BL_ORD_ID|3860...    38   0.19
gi|1524316|emb|CAA68993.1| glutathione S-transferase [Petunia x ...    37   0.25
gi|23504747|emb|CAD29479.1| glutathione transferase F6 [Triticum...    37   0.42
gi|15601256|ref|NP_232887.1| glutathione S-transferase, putative...    36   0.55
gi|50120012|ref|YP_049179.1| glutathione S-transferase [Erwinia ...    36   0.55
gi|11990255|emb|CAC19576.1| dichloromethane dehalogenase [Hyphom...    36   0.72
gi|118339|sp|P21161|DCMA_METDI Dichloromethane dehalogenase (DCM...    36   0.72
gi|481821|pir||S39541 probable glutathione transferase (EC 2.5.1...    35   0.94
gi|15218640|ref|NP_171792.1| glutathione S-transferase, putative...    35   0.94
gi|24215323|ref|NP_712804.1| glutathione transferase [Leptospira...    35   0.94
gi|15228488|ref|NP_186969.1| glutathione S-transferase, putative...    35   0.94
gi|47230189|emb|CAG10603.1| unnamed protein product [Tetraodon n...    35   0.94
gi|23504745|emb|CAD29478.1| glutathione transferase F5 [Triticum...    35   1.2
gi|15227063|ref|NP_178394.1| glutathione S-transferase, putative...    35   1.6
gi|21555418|gb|AAM63854.1| Atpm24.1 glutathione S transferase [A...    35   1.6
gi|15235401|ref|NP_192161.1| glutathione S-transferase, putative...    35   1.6
gi|22417098|gb|AAM96661.1| putative glutathione S-transferase [S...    35   1.6
gi|50084711|ref|YP_046221.1| putative glutathione S-transferase ...    35   1.6
gi|34497230|ref|NP_901445.1| glutathione S-transferase family pr...    35   1.6
gi|48767403|ref|ZP_00271759.1| COG0625: Glutathione S-transferas...    35   1.6
gi|2554769|pdb|1GNW|A Chain A, Structure Of Glutathione S-Transf...    35   1.6
gi|117493|sp|P15534|CRS3_NOTGO Crystallin SIII >gnl|BL_ORD_ID|10...    35   1.6
gi|46126843|ref|XP_387975.1| hypothetical protein FG07799.1 [Gib...    34   2.1
gi|11990257|emb|CAC19600.1| dichloromethane dehalogenase [Methyl...    34   2.1
gi|23106396|ref|ZP_00092850.1| COG0625: Glutathione S-transferas...    34   2.1
gi|27714143|ref|XP_232844.1| similar to GST pi enzyme [Rattus no...    34   2.1
gi|15966690|ref|NP_387043.1| MALEYLACETOACETATE ISOMERASE (GLUTA...    34   2.1
gi|37361852|gb|AAQ91039.1| LRRGT00083 [Rattus norvegicus]              34   2.1
gi|11133647|sp|Q9X4F7|MAAI_RHIME Maleylacetoacetate isomerase (M...    34   2.1
gi|294564|gb|AAA41291.1| glutathione S-transferase Ya subunit [R...    34   2.1
gi|27382529|ref|NP_774058.1| hypothetical glutathione S-transfer...    34   2.7
gi|11990261|emb|CAC19630.1| dichloromethane dehalogenase [uniden...    34   2.7
gi|50796206|ref|XP_423847.1| PREDICTED: similar to cysteine sulf...    34   2.7
gi|15224582|ref|NP_180644.1| glutathione S-transferase, putative...    34   2.7
gi|16263756|ref|NP_436548.1| putative glutathione S-transferase ...    34   2.7
gi|1170093|sp|P42769|GTH5_ARATH Glutathione S-transferase PM239X...    34   2.7
gi|11990165|emb|CAC19545.1| dichloromethane dehalogenase [dichlo...    33   3.6
gi|34914740|ref|NP_918717.1| putative glutathione S-transferase ...    33   3.6
gi|11177841|gb|AAG32475.1| putative glutathione S-transferase Os...    33   3.6
gi|121709|sp|P20137|GTS5_CHICK Glutathione S-transferase 5 (GST-...    33   3.6
gi|38049401|ref|XP_357096.1| similar to Glutathione S-transferas...    33   3.6
gi|26988551|ref|NP_743976.1| glutathione S-transferase family pr...    33   4.7
gi|11990259|emb|CAC19577.1| dichloromethane dehalogenase [Hyphom...    33   4.7
gi|11990163|emb|CAC19546.1| dichloromethane dehalogenase [bacter...    33   4.7
gi|13626392|sp|Q9FUM1|EF1G_PRUAV Elongation factor 1-gamma (EF-1...    33   4.7
gi|16264154|ref|NP_436946.1| putative glutathione S-transferase ...    33   4.7
gi|16126882|ref|NP_421446.1| glutathione S-transferase family pr...    33   4.7
gi|11497628|ref|NP_068848.1| hypothetical protein [Archaeoglobus...    33   4.7
gi|50421413|ref|XP_459257.1| unnamed protein product [Debaryomyc...    33   4.7
gi|31790093|gb|AAP58391.1| glutathione S-transferase 1 [Brassica...    33   4.7
gi|31790095|gb|AAP58392.1| glutathione S-transferase 2 [Brassica...    33   4.7
gi|31790097|gb|AAP58393.1| glutathione S-transferase 3 [Brassica...    33   4.7
gi|31790099|gb|AAP58394.1| glutathione S-transferase 4 [Brassica...    33   4.7
gi|11385467|gb|AAG34816.1| glutathione S-transferase GST 8 [Zea ...    33   4.7
gi|15603416|ref|NP_246490.1| unknown [Pasteurella multocida Pm70...    33   6.1
gi|119164|sp|P12261|EF1G_ARTSA Elongation factor 1-gamma (EF-1-g...    33   6.1
gi|26989197|ref|NP_744622.1| glutathione S-transferase family pr...    33   6.1
gi|34914786|ref|NP_918740.1| putative glutathione S-transferase ...    33   6.1
gi|45518067|ref|ZP_00169618.1| COG0625: Glutathione S-transferas...    33   6.1
gi|8118486|gb|AAF72998.1| glutathione-S-transferase [Vibrio chol...    33   6.1
gi|27379752|ref|NP_771281.1| blr4641 [Bradyrhizobium japonicum U...    32   8.0
gi|28901272|ref|NP_800927.1| putative glutathione S-transferase ...    32   8.0


>gi|17557472|ref|NP_503968.1| glutathione S-Transferase (gst-33)
           [Caenorhabditis elegans]
 gi|7434054|pir||T03853 glutathione S-transferase homolog C02A12.1 -
           Caenorhabditis elegans
 gi|2291125|gb|AAB65264.1| Glutathione s-transferase protein 33
           [Caenorhabditis elegans]
          Length = 213

 Score =  411 bits (1056), Expect = e-114
 Identities = 202/213 (94%), Positives = 202/213 (94%)
 Frame = -1

Query: 642 MTKYRLHYFNARGYAEASRAMFHMAGVEFEDVRYEIDDWIKEENTLKNEMPFGQMPVLEV 463
           MTKYRLHYFNARGYAEASRAMFHMAGVEFEDVRYEIDDWIKEENTLKNEMPFGQMPVLEV
Sbjct: 1   MTKYRLHYFNARGYAEASRAMFHMAGVEFEDVRYEIDDWIKEENTLKNEMPFGQMPVLEV 60

Query: 462 DGEKIPQSVAIARFVANQLGFAGQTPVEKAWADAFTDLYKDFLIDMKPWAMIAFGYPGAA 283
           DGEKIPQSVAIARFVANQLGFAGQTPVEKAWADAFTDLYKDFLIDMKPWAMIAFGYPGAA
Sbjct: 61  DGEKIPQSVAIARFVANQLGFAGQTPVEKAWADAFTDLYKDFLIDMKPWAMIAFGYPGAA 120

Query: 282 GDRDELKKTSLDPAKEKYFXXXXXXXXXXXSGFLLDSGISFPDLFFFETTTSLIELEKGF 103
           GDRDELKKTSLDPAKEKYF           SGFLLDSGISFPDLFFFETTTSLIELEKGF
Sbjct: 121 GDRDELKKTSLDPAKEKYFKLLSKRLEKSKSGFLLDSGISFPDLFFFETTTSLIELEKGF 180

Query: 102 LGTDFPVVNAYFKRIAEHPKLKPYLETRPYSSK 4
           LGTDFPVVNAYFKRIAEHPKLKPYLETRPYSSK
Sbjct: 181 LGTDFPVVNAYFKRIAEHPKLKPYLETRPYSSK 213




[DB home][top]