Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C02A12_1
(642 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17557472|ref|NP_503968.1| glutathione S-Transferase (gst-33) ... 411 e-114
gi|39584542|emb|CAE74620.1| Hypothetical protein CBG22411 [Caeno... 348 5e-95
gi|8917596|gb|AAF81283.1| glutathione S-transferase [Haemonchus ... 160 3e-38
gi|39589143|emb|CAE57876.1| Hypothetical protein CBG00918 [Caeno... 157 2e-37
gi|17536525|ref|NP_495967.1| glutathione S-Transferase (gst-13) ... 154 2e-36
gi|17533777|ref|NP_496862.1| glutathione S-Transferase (gst-12) ... 153 3e-36
gi|39591199|emb|CAE73252.1| Hypothetical protein CBG20668 [Caeno... 152 7e-36
gi|39591202|emb|CAE73255.1| Hypothetical protein CBG20671 [Caeno... 151 9e-36
gi|17537493|ref|NP_497119.1| glutathione S-transferase family me... 149 6e-35
gi|17537489|ref|NP_497117.1| glutathione S-Transferase (gst-28) ... 147 2e-34
gi|17537487|ref|NP_497116.1| glutathione S-Transferase (gst-27) ... 146 3e-34
gi|17537261|ref|NP_496858.1| glutathione S-Transferase (gst-20) ... 146 3e-34
gi|39591186|emb|CAE73239.1| Hypothetical protein CBG20648 [Caeno... 144 1e-33
gi|39592704|emb|CAE62318.1| Hypothetical protein CBG06384 [Caeno... 144 1e-33
gi|17537491|ref|NP_497118.1| glutathione S-Transferase (gst-29) ... 143 2e-33
gi|17537485|ref|NP_497115.1| glutathione S-Transferase (gst-26) ... 142 7e-33
gi|17533779|ref|NP_496861.1| glutathione S-Transferase (gst-14) ... 140 2e-32
gi|17537497|ref|NP_497121.1| glutathione S-Transferase (gst-31) ... 138 1e-31
gi|7108568|gb|AAF36480.1| glutathione S-transferase 2 [Nematospi... 137 2e-31
gi|17565374|ref|NP_503532.1| predicted CDS, glutathione S-Transf... 137 2e-31
gi|39591201|emb|CAE73254.1| Hypothetical protein CBG20670 [Caeno... 137 2e-31
gi|47717441|gb|AAT37718.1| glutathione S-transferase [Ancylostom... 136 4e-31
gi|39585759|emb|CAE59961.1| Hypothetical protein CBG03451 [Caeno... 136 4e-31
gi|32565684|ref|NP_497123.2| predicted CDS, glutathione S-Transf... 135 7e-31
gi|17533775|ref|NP_496859.1| glutathione S-Transferase (gst-24) ... 135 9e-31
gi|1170109|sp|P46436|GTS1_ASCSU Glutathione S-transferase 1 (GST... 135 9e-31
gi|39596768|emb|CAE58995.1| Hypothetical protein CBG02268 [Caeno... 134 1e-30
gi|17534687|ref|NP_494884.1| glutathione S-Transferase (gst-8) [... 133 3e-30
gi|39596775|emb|CAE59002.1| Hypothetical protein CBG02278 [Caeno... 130 2e-29
gi|39585761|emb|CAE59963.1| Hypothetical protein CBG03453 [Caeno... 130 2e-29
gi|17534681|ref|NP_496357.1| glutathione S-Transferase (gst-5) [... 129 4e-29
gi|17533783|ref|NP_496863.1| glutathione S-Transferase (gst-16) ... 129 4e-29
gi|17535437|ref|NP_494887.1| glutathione S-Transferase (gst-9) [... 129 5e-29
gi|17533789|ref|NP_496864.1| glutathione S-Transferase (gst-19) ... 129 5e-29
gi|39585723|emb|CAE59925.1| Hypothetical protein CBG03411 [Caeno... 128 1e-28
gi|39591173|emb|CAE73226.1| Hypothetical protein CBG20632 [Caeno... 128 1e-28
gi|17540934|ref|NP_501846.1| glutathione S-Transferase (23.7 kD)... 127 2e-28
gi|17541378|ref|NP_501848.1| glutathione S-Transferase (23.9 kD)... 127 2e-28
gi|39591187|emb|CAE73240.1| Hypothetical protein CBG20649 [Caeno... 126 3e-28
gi|17560538|ref|NP_506983.1| glutathione S-Transferase (gst-38) ... 126 4e-28
gi|17534685|ref|NP_494883.1| glutathione S-Transferase (23.0 kD)... 126 4e-28
gi|17533781|ref|NP_496860.1| glutathione S-Transferase (gst-15) ... 123 3e-27
gi|39587305|emb|CAE74959.1| Hypothetical protein CBG22850 [Caeno... 122 8e-27
gi|39585760|emb|CAE59962.1| Hypothetical protein CBG03452 [Caeno... 121 1e-26
gi|39579272|emb|CAE56959.1| Hypothetical protein CBG24809 [Caeno... 121 1e-26
gi|32564842|ref|NP_741061.2| glutathione S-Transferase (gst-35) ... 121 1e-26
gi|32564637|ref|NP_494882.2| glutathione S-Transferase (23.6 kD)... 120 2e-26
gi|7498934|pir||T29984 hypothetical protein F11G11.3 - Caenorhab... 120 2e-26
gi|17537895|ref|NP_494902.1| glutathione S-Transferase (gst-30) ... 120 2e-26
gi|32565758|ref|NP_741060.2| predicted CDS, glutathione S-Transf... 118 1e-25
gi|39579271|emb|CAE56958.1| Hypothetical protein CBG24808 [Caeno... 115 7e-25
gi|17540932|ref|NP_501847.1| glutathione S-Transferase (21.8 kD)... 114 2e-24
gi|39591200|emb|CAE73253.1| Hypothetical protein CBG20669 [Caeno... 114 2e-24
gi|7505567|pir||T23485 hypothetical protein K08F4.11 - Caenorhab... 109 4e-23
gi|17533787|ref|NP_496866.1| glutathione S-Transferase (gst-18) ... 109 5e-23
gi|17566902|ref|NP_503492.1| glutathione S-Transferase (gst-21) ... 108 7e-23
gi|45384344|ref|NP_990342.1| prostaglandin-D synthase [Gallus ga... 108 1e-22
gi|39590943|emb|CAE58723.1| Hypothetical protein CBG01908 [Caeno... 108 1e-22
gi|17560032|ref|NP_507095.1| glutathione S-Transferase (gst-22) ... 107 2e-22
gi|25152187|ref|NP_509652.2| glutathione S-Transferase (23.9 kD)... 106 4e-22
gi|7505572|pir||T23484 hypothetical protein K08F4.6 - Caenorhabd... 105 6e-22
gi|17535439|ref|NP_494889.1| glutathione S-Transferase (gst-9) [... 99 5e-20
gi|32330663|gb|AAP79878.1| glutathione S-transferase [Solenopsis... 98 2e-19
gi|31205195|ref|XP_311546.1| ENSANGP00000023017 [Anopheles gambi... 97 3e-19
gi|31205193|ref|XP_311545.1| ENSANGP00000010247 [Anopheles gambi... 96 4e-19
gi|624328|gb|AAB01055.1| S-crystallin 96 6e-19
gi|7506384|pir||T23994 hypothetical protein R07B1.4 - Caenorhabd... 96 8e-19
gi|1170110|sp|P46437|GTS_MUSDO GLUTATHIONE S-TRANSFERASE (GST CL... 94 2e-18
gi|1170108|sp|P46428|GTS_ANOGA GLUTATHIONE S-TRANSFERASE (GST CL... 94 2e-18
gi|625079|gb|AAA97540.1| S-crystallin 94 3e-18
gi|24654347|ref|NP_725653.1| CG8938-PA [Drosophila melanogaster]... 94 3e-18
gi|134271|sp|P27009|SC1_OCTDO S-CRYSTALLIN 1 (OL1) >gnl|BL_ORD_I... 93 4e-18
gi|134283|sp|P27012|SC4_OCTDO S-CRYSTALLIN 4 (OL4) >gnl|BL_ORD_I... 93 5e-18
gi|39592701|emb|CAE62315.1| Hypothetical protein CBG06381 [Caeno... 92 6e-18
gi|134280|sp|P27014|SC2_OCTVU S-crystallin 2 >gnl|BL_ORD_ID|1015... 92 6e-18
gi|48095724|ref|XP_394518.1| similar to glutathione S-transferas... 92 6e-18
gi|159838|gb|AAA29403.1| S-crystallin 91 1e-17
gi|2495111|sp|Q25626|SC3_OCTVU S-CRYSTALLIN 3 >gnl|BL_ORD_ID|170... 91 1e-17
gi|38051840|gb|AAH60462.1| MGC68589 protein [Xenopus laevis] 91 1e-17
gi|134261|sp|P18426|SC11_OMMSL S-CRYSTALLIN SL11 (MAJOR LENS POL... 91 2e-17
gi|40362717|gb|AAR84628.1| glutathione S-transferase [Gryllotalp... 91 2e-17
gi|624306|gb|AAA97543.1| S-crystallin 90 3e-17
gi|134281|sp|P27011|SC3_OCTDO S-CRYSTALLIN 3 (OL3) >gnl|BL_ORD_I... 90 3e-17
gi|134279|sp|P27010|SC2_OCTDO S-CRYSTALLIN 2 (OL2) >gnl|BL_ORD_I... 90 3e-17
gi|20139191|sp|Q9JHF7|PGD2_MOUSE Glutathione-requiring prostagla... 89 5e-17
gi|31980908|ref|NP_062328.2| prostaglandin D2 synthase 2, hemato... 89 5e-17
gi|6671050|gb|AAF23078.1| glutathione S-transferase [Choristoneu... 89 7e-17
gi|159831|gb|AAA29402.1| S-crystallin 89 7e-17
gi|134275|sp|P18425|SC20_OMMSL S-CRYSTALLIN SL20-1 (MAJOR LENS P... 89 7e-17
gi|624322|gb|AAA97551.1| S-crystallin 89 7e-17
gi|17569381|ref|NP_508625.1| glutathione S-Transferase (gst-11) ... 89 9e-17
gi|39597765|emb|CAE68457.1| Hypothetical protein CBG14247 [Caeno... 89 9e-17
gi|32965121|gb|AAP91748.1| glutathione-requiring prostaglandin D... 88 1e-16
gi|624316|gb|AAA97548.1| S-crystallin 88 1e-16
gi|13928888|ref|NP_113832.1| prostaglandin D2 synthase 2; prosta... 88 1e-16
gi|21435011|gb|AAM53611.1| glutathione S-transferase S1-2 [Anoph... 88 2e-16
gi|84595|pir||S06442 crystallin (clone pSl20) - Sloane's squid >... 88 2e-16
gi|21952442|gb|AAM82563.1| glutathione s-transferase [Xenopus la... 88 2e-16
gi|624326|gb|AAB01054.1| S-crystallin 87 2e-16
gi|7657457|ref|NP_055300.1| prostaglandin-D synthase; hematopoie... 87 2e-16
gi|913849|gb|AAA73508.1| lens-specific S-crystallin {SL20-1} [oc... 87 2e-16
gi|624310|gb|AAA97545.1| S-crystallin 87 3e-16
gi|1170111|sp|P46088|GTS_OMMSL Glutathione S-transferase (GST cl... 87 4e-16
gi|32450087|gb|AAH53774.1| MGC64301 protein [Xenopus laevis] 87 4e-16
gi|30749298|pdb|1IYH|A Chain A, Crystal Structure Of Hematopoiet... 86 6e-16
gi|624318|gb|AAA97549.1| S-crystallin 86 8e-16
gi|17563170|ref|NP_504894.1| glutathione S-Transferase (25.0 kD)... 86 8e-16
gi|1065021|pdb|1GSQ| Glutathione S-Transferase (Gst) (E.C.2.5.1... 85 1e-15
gi|1170107|sp|P46429|GTS2_MANSE GLUTATHIONE S-TRANSFERASE 2 (GST... 84 2e-15
gi|624302|gb|AAA97541.1| S-crystallin 84 2e-15
gi|2326190|gb|AAB72147.1| allergen Bla g 5 [Blattella germanica] 84 2e-15
gi|6225491|sp|O18598|GTS1_BLAGE Glutathione S-transferase (GST c... 84 2e-15
gi|624336|gb|AAB01059.1| S-crystallin 84 3e-15
gi|12859396|dbj|BAB31640.1| unnamed protein product [Mus musculus] 84 3e-15
gi|20141353|sp|P24472|GTA4_MOUSE Glutathione S-transferase 5.7 (... 83 4e-15
gi|12848219|dbj|BAB27873.1| unnamed protein product [Mus musculus] 83 4e-15
gi|6754082|ref|NP_034487.1| glutathione S-transferase, alpha 4 [... 83 4e-15
gi|49900017|gb|AAH77016.1| Unknown (protein for MGC:89746) [Xeno... 83 4e-15
gi|6137390|pdb|1B48|A Chain A, Crystal Structure Of Mgsta4-4 In ... 83 4e-15
gi|624312|gb|AAA97546.1| S-crystallin 82 7e-15
gi|624332|gb|AAB01057.1| S-crystallin 82 9e-15
gi|624308|gb|AAA97544.1| S-crystallin 82 9e-15
gi|7387485|gb|AAB33637.2| glutathione S-transferase; GST [Nemato... 81 1e-14
gi|49532912|dbj|BAD26691.1| Glutathione S-transferase [Plutella ... 81 1e-14
gi|624330|gb|AAB01056.1| S-crystallin 80 3e-14
gi|134268|sp|P27016|SC18_OMMSL S-CRYSTALLIN SL18 >gnl|BL_ORD_ID|... 80 3e-14
gi|1170086|sp|Q08862|GTC_RABIT GLUTATHIONE S-TRANSFERASE YC (ALP... 80 4e-14
gi|17565768|ref|NP_503701.1| glutathione S-Transferase (24.8 kD)... 79 7e-14
gi|39583549|emb|CAE65653.1| Hypothetical protein CBG10717 [Caeno... 79 1e-13
gi|624324|gb|AAB01053.1| S-crystallin 78 1e-13
gi|17540724|ref|NP_499981.1| glutathione S-Transferase (24.9 kD)... 78 2e-13
gi|27720723|ref|XP_217195.1| similar to GLUTATHIONE S-TRANSFERAS... 78 2e-13
gi|50744870|ref|XP_419913.1| PREDICTED: glutathione S-transferas... 78 2e-13
gi|38511981|gb|AAH60914.1| Zgc:73173 protein [Danio rerio] 78 2e-13
gi|624320|gb|AAA97550.1| S-crystallin 77 2e-13
gi|13096120|pdb|1EV4|A Chain A, Rat Glutathione S-Transferase A1... 77 2e-13
gi|13096123|pdb|1EV9|A Chain A, Rat Glutathione S-Transferase A1... 77 2e-13
gi|47604962|ref|NP_990743.1| glutathione transferase [Gallus gal... 77 3e-13
gi|50744868|ref|XP_444657.1| PREDICTED: glutathione transferase ... 77 3e-13
gi|624304|gb|AAA97542.1| S-crystallin 77 3e-13
gi|11514502|pdb|1F3B|A Chain A, Crystal Structure Of Mgsta1-1 In... 77 3e-13
gi|121713|sp|P04903|GTA2_RAT Glutathione S-transferase Ya-2 (Lig... 77 3e-13
gi|30749486|pdb|1ML6|A Chain A, Crystal Structure Of Mgsta2-2 In... 77 3e-13
gi|8393499|ref|NP_058709.1| glutathione-S-transferase, alpha typ... 77 4e-13
gi|66611|pir||XURTG glutathione transferase (EC 2.5.1.18) class ... 77 4e-13
gi|49169816|ref|NP_001001777.1| glutathione S-transferase [Gallu... 77 4e-13
gi|624334|gb|AAB01058.1| S-crystallin 76 5e-13
gi|11514499|pdb|1F3A|A Chain A, Crystal Structure Of Mgsta1-1 In... 76 5e-13
gi|50513281|pdb|1PKW|A Chain A, Crystal Structure Of Human Gluta... 76 5e-13
gi|121710|sp|P10648|GTA2_MOUSE Glutathione S-transferase GT41A (... 76 5e-13
gi|121712|sp|P13745|GTA1_MOUSE Glutathione S-transferase Ya chai... 76 5e-13
gi|22091454|ref|NP_665683.1| glutathione S-transferase A1; GST, ... 76 6e-13
gi|50513287|pdb|1PL2|A Chain A, Crystal Structure Of Human Gluta... 76 6e-13
gi|442977|pdb|1GUH|A Chain A, Glutathione S-Transferase A1-1 (E.... 76 6e-13
gi|1127144|pdb|1GSE|A Chain A, Glutathione Transferase A1-1 Comp... 76 6e-13
gi|50263046|ref|NP_032208.2| glutathione S-transferase, alpha 2 ... 75 8e-13
gi|624314|gb|AAA97547.1| S-crystallin 75 1e-12
gi|1654009|emb|CAA70303.1| glutathione S-transferase [Mesocricet... 75 1e-12
gi|951352|gb|AAA74634.1| glutathione S-transferase A3 75 1e-12
gi|12005978|gb|AAG44695.1| glutathione S-transferase Ia [Onchoce... 75 1e-12
gi|481923|pir||S40165 glutathione transferase (EC 2.5.1.18) - ne... 75 1e-12
gi|477414|pir||A48982 glutathione transferase (EC 2.5.1.18) 2 - ... 75 1e-12
gi|11258625|pir||A49365 glutathione transferase (EC 2.5.1.18) al... 75 1e-12
gi|49169814|ref|NP_001001776.1| glutathione S-transferase class-... 75 1e-12
gi|24308514|ref|NP_714543.1| glutathione transferase A5 [Homo sa... 75 1e-12
gi|1170077|sp|P46434|GT1_ONCVO GLUTATHIONE S-TRANSFERASE 1 >gnl|... 75 1e-12
gi|7110611|ref|NP_032207.1| glutathione S-transferase, alpha 1 (... 75 1e-12
gi|12005980|gb|AAG44696.1| glutathione S-transferase Ib [Onchoce... 74 2e-12
gi|39588668|emb|CAE58192.1| Hypothetical protein CBG01286 [Caeno... 74 2e-12
gi|2495107|sp|P80894|GTA1_ANTST Glutathione S-transferase (GST c... 74 2e-12
gi|12832492|dbj|BAB22131.1| unnamed protein product [Mus musculus] 74 2e-12
gi|13928688|ref|NP_113697.1| glutathione S-transferase, alpha 1;... 74 2e-12
gi|31981724|ref|NP_034486.2| glutathione S-transferase, alpha 3 ... 74 2e-12
gi|38173961|gb|AAH61134.1| Unknown (protein for MGC:74264) [Mus ... 74 2e-12
gi|23428564|gb|AAL23713.1| glutathione S-transferase [Opisthorch... 74 2e-12
gi|1065322|pdb|1AGS|A Chain A, Alpha Glutathione S-Transferase (... 74 2e-12
gi|187132|gb|AAA36174.1| gluthione S-transferase subunit 1 (GST,... 74 3e-12
gi|1170085|sp|P46418|GTC2_RAT Glutathione S-transferase Yc-2 (Ch... 74 3e-12
gi|24430144|ref|NP_000838.3| glutathione S-transferase A3; gluta... 73 5e-12
gi|193703|gb|AAA37751.1| glutathione transferase 73 5e-12
gi|18089048|gb|AAH20619.1| Glutathione S-transferase A3 [Homo sa... 72 7e-12
gi|48106995|ref|XP_393084.1| similar to Glutathione-requiring pr... 72 7e-12
gi|1170102|sp|P46427|GTP_ONCVO Glutathione S-transferase 2 (GST ... 72 9e-12
gi|5360517|dbj|BAA82038.1| glutathione s-transferase [Cavia porc... 72 9e-12
gi|20988789|gb|AAH30173.1| Gsta2 protein [Mus musculus] 72 9e-12
gi|8928140|sp|P81706|GTA1_CAVPO Glutathione S-transferase A (GST... 72 9e-12
gi|7188365|gb|AAF37739.1| glutathione S-transferase alpha [Rattu... 72 9e-12
gi|7434039|pir||S24330 glutathione transferase (EC 2.5.1.18) alp... 72 1e-11
gi|8218078|emb|CAB92770.1| dJ152L7.3 (glutathione S-transferase ... 72 1e-11
gi|257476|gb|AAB23672.1| glutathione S-transferase A2 subunit [H... 72 1e-11
gi|1170101|sp|P46426|GTP_DIRIM Glutathione S-transferase (GST cl... 71 2e-11
gi|20149504|ref|NP_000837.2| glutathione S-transferase A2; gluta... 71 2e-11
gi|2495106|sp|Q28035|GTA1_BOVIN Glutathione S-transferase alpha ... 71 2e-11
gi|1170081|sp|Q08863|GTA1_RABIT Glutathione S-transferase alpha ... 71 2e-11
gi|17533785|ref|NP_496865.1| glutathione S-Transferase (gst-17) ... 71 2e-11
gi|7687909|gb|AAD42800.2| microsomal glutathione-S-transferase [... 71 2e-11
gi|3514020|gb|AAC34097.1| glutathione transferase; PiGSTII [Plat... 70 3e-11
gi|975211|emb|CAA58767.1| glutathione transferase [Onchocerca vo... 70 3e-11
gi|2829287|gb|AAC00518.1| glutathione S-transferase [Schistosoma... 70 3e-11
gi|1389744|gb|AAB03573.1| glutathione-S-transferase 70 3e-11
gi|21263651|sp|P81942|GTP1_BUFBU Glutathione S-transferase P 1 (... 70 3e-11
gi|45382235|ref|NP_990149.1| glutathione S-transferase class-alp... 70 3e-11
gi|50400547|sp|Q8JFZ2|GTP1_XENLA Glutathione S-transferase P 1 (... 70 3e-11
gi|4335859|gb|AAD17488.1| 28 kDa glutathione S-transferase; 28GS... 70 3e-11
gi|47523158|ref|NP_999015.1| glutathione S-transferase [Sus scro... 70 4e-11
gi|2058287|emb|CAA73325.1| glutathione transferase [Brugia malayi] 69 8e-11
gi|121699|sp|P26624|GT28_SCHJA Glutathione S-transferase 28 kDa ... 69 8e-11
gi|47523832|ref|NP_999554.1| glutathione S-transferase [Sus scro... 69 8e-11
gi|38049405|ref|XP_136557.2| similar to class-alpha glutathione ... 68 1e-10
gi|28630830|gb|AAO45827.1| glutathione S-transferase [Wuchereria... 68 1e-10
gi|5524944|emb|CAB50870.1| glutathione S-transferase [Ovis aries] 68 1e-10
gi|39588669|emb|CAE58193.1| Hypothetical protein CBG01287 [Caeno... 67 3e-10
gi|17564840|ref|NP_503889.1| glutathione S-Transferase (gst-23) ... 67 4e-10
gi|31559115|gb|AAP50848.1| glutathione S-transferase 2 [Bombyx m... 67 4e-10
gi|47228894|emb|CAG09409.1| unnamed protein product [Tetraodon n... 67 4e-10
gi|34859224|ref|XP_234810.2| similar to GLUTATHIONE S-TRANSFERAS... 66 5e-10
gi|38636658|dbj|BAD02978.1| glutathione S-transferase [Blepharis... 66 6e-10
gi|49532926|dbj|BAD26698.1| Glutathione S transferase 2-like pro... 66 6e-10
gi|39588670|emb|CAE58194.1| Hypothetical protein CBG01288 [Caeno... 66 6e-10
gi|4504173|ref|NP_001503.1| glutathione S-transferase A4; glutat... 65 1e-09
gi|3402001|pdb|1FHE| Glutathione Transferase (Fh47) From Fascio... 65 1e-09
gi|3915723|sp|P31670|GT27_FASHE Glutathione S-transferase 26 kDa... 65 1e-09
gi|47076115|emb|CAD90167.1| mu class glutathione S-transferase [... 65 1e-09
gi|32567128|ref|NP_503698.2| glutathione S-transferase, N-termin... 64 2e-09
gi|21450105|ref|NP_659118.1| cDNA sequence BC021614 [Mus musculu... 64 2e-09
gi|25453412|ref|NP_620430.1| glutathione S-transferase, pi 2 [Ra... 64 2e-09
gi|16518972|gb|AAL25087.1| glutathione s-transferase [Plasmodium... 64 2e-09
gi|23509408|ref|NP_702075.1| glutathione s-transferase, putative... 64 2e-09
gi|7434040|pir||S77958 glutathione transferase (EC 2.5.1.18) alp... 64 3e-09
gi|265545|gb|AAB25369.1| alpha-class glutathione S-transferase o... 63 4e-09
gi|345859|pir||S29658 glutathione transferase (EC 2.5.1.18) omeg... 63 4e-09
gi|34539115|gb|AAQ74441.1| glutathione S-transferase [Haemaphysa... 63 4e-09
gi|265539|gb|AAB25364.1| alpha-class glutathione S-transferase o... 63 5e-09
gi|345858|pir||S29657 glutathione transferase (EC 2.5.1.18) omeg... 63 5e-09
gi|121700|sp|P09792|GT28_SCHMA Glutathione S-transferase 28 kDa ... 62 7e-09
gi|384152|prf||1905266C glutathione S transferase:ISOTYPE=GST47 62 1e-08
gi|21263652|sp|P83325|GTP2_BUFBU Glutathione S-transferase P 2 (... 62 1e-08
gi|159060|gb|AAA29140.1| mu-glutathione transferase [Fasciola he... 61 2e-08
gi|39585029|emb|CAE62680.1| Hypothetical protein CBG06825 [Caeno... 60 3e-08
gi|56330|emb|CAA25203.1| unnamed protein product [Rattus norvegi... 60 3e-08
gi|10092608|ref|NP_038569.1| glutathione S-transferase, pi 1; Gs... 60 3e-08
gi|34536838|gb|AAQ73932.1| GST-like hemolymph protein [Corcyra c... 60 4e-08
gi|41387382|gb|AAS01601.1| Pi-class glutathione S-trasferase [An... 60 4e-08
gi|3023905|sp|Q60550|GTP_MESAU Glutathione S-transferase P (GST ... 60 4e-08
gi|4699783|pdb|22GS|A Chain A, Human Glutathione S-Transferase P... 60 5e-08
gi|32401425|ref|NP_861461.1| glutathione S-transferase, pi 2; Gs... 60 5e-08
gi|4557944|pdb|1GTI|A Chain A, Modified Glutathione S-Transferas... 59 6e-08
gi|576133|pdb|1GLP|A Chain A, Glutathione S-Transferase Yfyf (Cl... 59 6e-08
gi|4139536|pdb|17GS|A Chain A, Glutathione S-Transferase P1-1 >g... 59 6e-08
gi|4630882|dbj|BAA76974.1| glutathione S-transferase [Oncorhynch... 59 8e-08
gi|1170100|sp|P46424|GTP_CRILO Glutathione S-transferase P (GST ... 59 1e-07
gi|2264324|gb|AAB63382.1| 28 kDa glutathione-S transferase 59 1e-07
gi|2204207|emb|CAA30894.1| glutathione S-transferase [Homo sapiens] 59 1e-07
gi|2554831|pdb|2PGT|A Chain A, Crystal Structure Of Human Glutat... 59 1e-07
gi|4504183|ref|NP_000843.1| glutathione transferase; deafness, X... 59 1e-07
gi|5822569|pdb|4PGT|A Chain A, Crystal Structure Of Hgstp1-1[v10... 59 1e-07
gi|23480514|gb|EAA17054.1| glutathione s-transferase [Plasmodium... 59 1e-07
gi|1083336|pir||A55140 glutathione transferase (EC 2.5.1.18) piA... 59 1e-07
gi|2624495|pdb|1BAY|A Chain A, Glutathione S-Transferase Yfyf Cy... 58 1e-07
gi|20664358|pdb|1LBK|A Chain A, Crystal Structure Of A Recombina... 57 2e-07
gi|3915724|sp|P31671|GT28_FASHE GLUTATHIONE S-TRANSFERASE 26 KD ... 57 2e-07
gi|20982640|ref|XP_159712.1| similar to glutathione transferase ... 57 2e-07
gi|2914230|pdb|4GSS|A Chain A, Human Glutathione S-Transferase P... 57 2e-07
gi|494066|pdb|1GSS|A Chain A, Glutathione S-Transferase (E.C.2.5... 57 2e-07
gi|2780951|pdb|1AQV|A Chain A, Glutathione S-Transferase In Comp... 57 2e-07
gi|726098|gb|AAC13869.1| glutathione S-transferase-P1c [Homo sap... 57 3e-07
gi|46329897|gb|AAH68854.1| Unknown (protein for IMAGE:3399306) [... 57 3e-07
gi|23200508|pdb|1MD3|A Chain A, A Folding Mutant Of Human Class ... 57 3e-07
gi|23200510|pdb|1MD4|A Chain A, A Folding Mutant Of Human Class ... 57 3e-07
gi|34861384|ref|XP_215189.2| similar to hypothetical protein MGC... 57 4e-07
gi|17553834|ref|NP_499006.1| glutathione S-Transferase, P subuni... 57 4e-07
gi|25153666|ref|NP_503673.2| glutathione S-transferase, N-termin... 57 4e-07
gi|17561486|ref|NP_503671.1| glutathione S-transferase, N-termin... 57 4e-07
gi|11514448|pdb|1EOG|A Chain A, Crystal Structure Of Pi Class Gl... 56 5e-07
gi|631017|pir||S43432 glutathione transferase (EC 2.5.1.18) alph... 56 7e-07
gi|1346208|sp|P47954|GTP_CRIMI Glutathione S-transferase P (GST ... 56 7e-07
gi|4574306|gb|AAD23997.1| glutathione S-transferase [Fasciola gi... 56 7e-07
gi|34811305|pdb|1PX7|A Chain A, A Folding Mutant Of Human Class ... 56 7e-07
gi|29135319|ref|NP_803481.1| glutathione S-transferase A2 [Bos t... 55 9e-07
gi|34811303|pdb|1PX6|A Chain A, A Folding Mutant Of Human Class ... 55 9e-07
gi|39654103|pdb|1KBN|A Chain A, Glutathione Transferase Mutant >... 55 9e-07
gi|161013|gb|AAA29892.1| 28kDa glutathione-S transferase 55 1e-06
gi|2495108|sp|Q28514|GTP_MACMU Glutathione S-transferase P (GST ... 55 1e-06
gi|22671702|gb|AAN04480.1| glutathione S-transferase GSTP1-1 [Bu... 55 1e-06
gi|544443|sp|P30113|GT28_SCHBO GLUTATHIONE S-TRANSFERASE 28 KD (... 55 1e-06
gi|232199|sp|P30114|GT28_SCHHA Glutathione S-transferase 28 kDa ... 55 1e-06
gi|26347823|dbj|BAC37560.1| unnamed protein product [Mus musculus] 55 1e-06
gi|29135329|ref|NP_803482.1| glutathione S-transferase pi [Bos t... 55 1e-06
gi|21591409|gb|AAM64045.1| glutathione S-transferase [Taenia sol... 55 1e-06
gi|28828694|gb|AAO51292.1| similar to Xenopus laevis (African cl... 55 1e-06
gi|11514451|pdb|1EOH|A Chain A, Glutathione Transferase P1-1 >gn... 54 2e-06
gi|159058|gb|AAA29139.1| mu-glutathione transferase [Fasciola he... 53 4e-06
gi|384151|prf||1905266B glutathione S transferase:ISOTYPE=GST7 53 4e-06
gi|3913799|sp|P56598|GT29_FASHE Glutathione S-transferase 26 kDa... 53 6e-06
gi|477190|pir||A48388 glutathione S-transferase - liver fluke (f... 53 6e-06
gi|87564|pir||A41177 glutathione transferase (EC 2.5.1.18) / fat... 52 7e-06
gi|2316076|gb|AAB66318.1| glutathione S-transferase [Echinococcu... 52 1e-05
gi|4959550|gb|AAD34393.1| glutathione S-transferase class-alpha ... 52 1e-05
gi|1004227|emb|CAA59739.1| glutathione transferase [Echinococcus... 51 2e-05
gi|46115920|ref|XP_383978.1| hypothetical protein FG03802.1 [Gib... 51 2e-05
gi|27462836|gb|AAO15607.1| glutathione S-transferase [Sarcoptes ... 50 3e-05
gi|2738935|gb|AAD04712.1| glutathione transferase [Homo sapiens] 50 3e-05
gi|22671705|gb|AAN04481.1| glutathione S-transferase GSTP2-2 [Bu... 50 4e-05
gi|34865663|ref|XP_345686.1| similar to GLUTATHIONE S-TRANSFERAS... 50 4e-05
gi|32346216|gb|AAN85429.1| glutathione-S-transferase [Pyrocystis... 50 4e-05
gi|6013379|gb|AAF01323.1| glutathione S-transferase Pi [Capra hi... 50 4e-05
gi|18858197|ref|NP_571809.1| glutathione S-transferase pi [Danio... 49 6e-05
gi|34539117|gb|AAQ74442.1| glutathione S-transferase [Rhipicepha... 49 6e-05
gi|4115420|dbj|BAA36351.1| 24 kDa female-specific fat body prote... 49 8e-05
gi|4115418|dbj|BAA36350.1| 24 kDa female-specific fat body prote... 49 1e-04
gi|2147980|pir||S61363 prostaglandin-H E-isomerase chain H - Asc... 49 1e-04
gi|1254920|gb|AAB35901.1| prostaglandin-H E-isome=sigma-class gl... 49 1e-04
gi|18280276|gb|AAL02368.1| class gamma glutathione S-transferase... 48 1e-04
gi|10443248|emb|CAC10391.1| dJ214M20.3 (glutathione S-transferas... 48 1e-04
gi|104677|pir||S18464 glutathione transferase (EC 2.5.1.18) mu2 ... 47 3e-04
gi|46048786|ref|NP_990421.1| glutathione S-transferases CL2 [Gal... 47 3e-04
gi|39592078|emb|CAE75298.1| Hypothetical protein CBG23268 [Caeno... 47 3e-04
gi|10120620|pdb|1C72|A Chain A, Tyr115, Gln165 And Trp209 Contri... 47 3e-04
gi|2981970|pdb|1GSU|A Chain A, An Avian Class-Mu Glutathione S-T... 47 3e-04
gi|49097402|ref|XP_410161.1| hypothetical protein AN6024.2 [Aspe... 47 4e-04
gi|1943418|pdb|2GSR|A Chain A, Structure Of Porcine Class Pi Glu... 45 0.001
gi|544445|sp|P80031|GTP_PIG Glutathione S-transferase P (GST P1-... 45 0.001
gi|108301|pir||S13780 glutathione transferase (EC 2.5.1.18) clas... 45 0.001
gi|13447445|gb|AAK26668.1| lens-specific S-crystallin [Eledone a... 45 0.001
gi|34874562|ref|XP_343546.1| similar to class-alpha glutathione ... 44 0.003
gi|17561414|ref|NP_505972.1| glutathione S-transferase, C-termin... 44 0.003
gi|46204955|ref|ZP_00049243.2| COG0625: Glutathione S-transferas... 44 0.003
gi|1170095|sp|P46419|GTM1_DERPT Glutathione S-transferase (GST c... 44 0.003
gi|30145756|emb|CAA96662.2| Hypothetical protein F55A11.6 [Caeno... 44 0.003
gi|26990448|ref|NP_745873.1| glutathione S-transferase family pr... 43 0.005
gi|6625558|gb|AAF19264.1| glutathione S-transferase [Psoroptes o... 43 0.005
gi|1699065|gb|AAB37349.1| glutathione S-transferase [Cloning vec... 42 0.008
gi|3983117|gb|AAC83809.1| glutathione S-transferase [Expression ... 42 0.008
gi|1850359|gb|AAB48035.1| GST-fusion protein [Expression vector ... 42 0.008
gi|595738|gb|AAA57110.1| glutathione S-transferase 42 0.008
gi|595714|gb|AAA57092.1| glutathione S-transferase 42 0.008
gi|595730|gb|AAA57104.1| glutathione S-transferase 42 0.008
gi|595734|gb|AAA57107.1| glutathione S-transferase 42 0.008
gi|1850357|gb|AAB48034.1| GST-fusion protein [Expression vector ... 42 0.008
gi|595722|gb|AAA57098.1| glutathione S-transferase 42 0.008
gi|1814366|gb|AAB41882.1| GST-6his [Expression vector pGEX-2T-6H] 42 0.008
gi|3002508|gb|AAC08724.1| GSTmFra2/2-242 [Expression vector pGH/... 42 0.008
gi|15099967|gb|AAK84183.1| glutathione-S-transferase-nitroreduct... 42 0.008
gi|21666485|gb|AAM73721.1| glutathione-S-transferase/nitroreduct... 42 0.008
gi|15099965|gb|AAK84182.1| glutathione-S-transferase-nitroreduct... 42 0.008
gi|595726|gb|AAA57101.1| glutathione S-transferase 42 0.008
gi|1527195|gb|AAB88910.1| glutathione S-transferase [Expression ... 42 0.008
gi|17507251|ref|NP_490857.1| glutathione S-Transferase (gst-25) ... 42 0.008
gi|23821204|emb|CAD53317.1| glutathione-S-transferase [Cloning v... 42 0.008
gi|3002504|gb|AAC08721.1| GSTmFra2/159-327 [Expression vector pG... 42 0.008
gi|1699061|gb|AAB37346.1| glutathione S-transferase [Cloning vec... 42 0.008
gi|1814368|gb|AAB41883.1| GST-6his [Expression vector pGEX-2T-6H... 42 0.008
gi|1850361|gb|AAB48036.1| GST-fusion protein [Expression vector ... 42 0.008
gi|3002500|gb|AAC08718.1| GSTmFra2/79-242 [Expression vector pGH... 42 0.008
gi|84402|pir||A26484 glutathione transferase (EC 2.5.1.18) - flu... 42 0.008
gi|3242311|emb|CAA11559.1| glutathione-S-transferase [synthetic ... 42 0.008
gi|809436|pdb|1GNE| Glutathione S-Transferase (E.C.2.5.1.18) Fu... 42 0.008
gi|595710|gb|AAA57089.1| glutathione S-transferase 42 0.008
gi|595718|gb|AAA57095.1| glutathione S-transferase 42 0.008
gi|208443|gb|AAB59734.1| glutathione transferase 42 0.008
gi|595706|gb|AAA57086.1| glutathione S-transferase 42 0.008
gi|1699069|gb|AAB37352.1| glutathione S-transferase [Cloning vec... 42 0.008
gi|20385949|gb|AAM21516.1| GST-M.SPRX methyltransferase fusion p... 42 0.008
gi|3002496|gb|AAC08715.1| GSTmFra2/2-163 [Expression vector pGH/... 42 0.008
gi|23504743|emb|CAD29477.1| glutathione transferase F4 [Triticum... 42 0.008
gi|15216974|gb|AAK92454.1| GST-loxP-cre recombinase fusion prote... 42 0.008
gi|3002512|gb|AAC08727.1| GSTmFra2/79-327 [Expression vector pGH... 42 0.008
gi|4389298|pdb|1BG5| Crystal Structure Of The Ankyrin Binding D... 42 0.008
gi|38155842|gb|AAR12690.1| glutathione S-transferase [Expression... 42 0.008
gi|121697|sp|P08515|GT26_SCHJA Glutathione S-transferase 26 kDa ... 42 0.008
gi|4929901|pdb|1B8X|A Chain A, Glutathione S-Transferase Fused W... 42 0.008
gi|595742|gb|AAA57113.1| glutathione S-transferase 42 0.008
gi|3002516|gb|AAC08730.1| GSTmFra2/2-327 [Expression vector pGH/... 42 0.008
gi|208305|gb|AAA72682.1| glutathione transferase 42 0.008
gi|3184404|dbj|BAA28713.1| GST-stuffer fusion protein [Cloning v... 42 0.008
gi|6980848|pdb|1DUG|A Chain A, Structure Of The Fibrinogen G Cha... 42 0.008
gi|467623|emb|CAA55122.1| fusion peptide [synthetic construct] 42 0.008
gi|36959131|gb|AAQ87556.1| Glutathione S-transferase [Rhizobium ... 41 0.022
gi|19848969|gb|AAL99403.1| glutathione S-transferase [Boophilus ... 40 0.029
gi|21956654|gb|AAL02369.3| class gamma glutathione S-transferase... 40 0.029
gi|13447444|gb|AAK26667.1| lens-specific S-crystallin [Eledone a... 40 0.038
gi|84594|pir||S14892 crystallin (clone pSl12) - Sloane's squid (... 40 0.050
gi|46322289|ref|ZP_00222660.1| COG0625: Glutathione S-transferas... 40 0.050
gi|2465439|gb|AAB72099.1| glutathione-dependent prostaglandin D ... 39 0.065
gi|38174001|gb|AAH61226.1| Unknown (protein for MGC:74375) [Mus ... 39 0.065
gi|15237931|ref|NP_197224.1| glutathione S-transferase, putative... 39 0.065
gi|121722|sp|P16413|GTMU_CAVPO Glutathione S-transferase B (GST ... 39 0.11
gi|3023918|sp|Q52828|GSTA_RHILE GSTA PROTEIN >gnl|BL_ORD_ID|1716... 38 0.14
gi|14334818|gb|AAK59587.1| putative elongation factor 1B gamma [... 38 0.19
gi|15223649|ref|NP_176084.1| elongation factor 1B-gamma, putativ... 38 0.19
gi|134272|sp|P27013|SC1_OCTVU S-CRYSTALLIN 1 >gnl|BL_ORD_ID|3860... 38 0.19
gi|1524316|emb|CAA68993.1| glutathione S-transferase [Petunia x ... 37 0.25
gi|23504747|emb|CAD29479.1| glutathione transferase F6 [Triticum... 37 0.42
gi|15601256|ref|NP_232887.1| glutathione S-transferase, putative... 36 0.55
gi|50120012|ref|YP_049179.1| glutathione S-transferase [Erwinia ... 36 0.55
gi|11990255|emb|CAC19576.1| dichloromethane dehalogenase [Hyphom... 36 0.72
gi|118339|sp|P21161|DCMA_METDI Dichloromethane dehalogenase (DCM... 36 0.72
gi|481821|pir||S39541 probable glutathione transferase (EC 2.5.1... 35 0.94
gi|15218640|ref|NP_171792.1| glutathione S-transferase, putative... 35 0.94
gi|24215323|ref|NP_712804.1| glutathione transferase [Leptospira... 35 0.94
gi|15228488|ref|NP_186969.1| glutathione S-transferase, putative... 35 0.94
gi|47230189|emb|CAG10603.1| unnamed protein product [Tetraodon n... 35 0.94
gi|23504745|emb|CAD29478.1| glutathione transferase F5 [Triticum... 35 1.2
gi|15227063|ref|NP_178394.1| glutathione S-transferase, putative... 35 1.6
gi|21555418|gb|AAM63854.1| Atpm24.1 glutathione S transferase [A... 35 1.6
gi|15235401|ref|NP_192161.1| glutathione S-transferase, putative... 35 1.6
gi|22417098|gb|AAM96661.1| putative glutathione S-transferase [S... 35 1.6
gi|50084711|ref|YP_046221.1| putative glutathione S-transferase ... 35 1.6
gi|34497230|ref|NP_901445.1| glutathione S-transferase family pr... 35 1.6
gi|48767403|ref|ZP_00271759.1| COG0625: Glutathione S-transferas... 35 1.6
gi|2554769|pdb|1GNW|A Chain A, Structure Of Glutathione S-Transf... 35 1.6
gi|117493|sp|P15534|CRS3_NOTGO Crystallin SIII >gnl|BL_ORD_ID|10... 35 1.6
gi|46126843|ref|XP_387975.1| hypothetical protein FG07799.1 [Gib... 34 2.1
gi|11990257|emb|CAC19600.1| dichloromethane dehalogenase [Methyl... 34 2.1
gi|23106396|ref|ZP_00092850.1| COG0625: Glutathione S-transferas... 34 2.1
gi|27714143|ref|XP_232844.1| similar to GST pi enzyme [Rattus no... 34 2.1
gi|15966690|ref|NP_387043.1| MALEYLACETOACETATE ISOMERASE (GLUTA... 34 2.1
gi|37361852|gb|AAQ91039.1| LRRGT00083 [Rattus norvegicus] 34 2.1
gi|11133647|sp|Q9X4F7|MAAI_RHIME Maleylacetoacetate isomerase (M... 34 2.1
gi|294564|gb|AAA41291.1| glutathione S-transferase Ya subunit [R... 34 2.1
gi|27382529|ref|NP_774058.1| hypothetical glutathione S-transfer... 34 2.7
gi|11990261|emb|CAC19630.1| dichloromethane dehalogenase [uniden... 34 2.7
gi|50796206|ref|XP_423847.1| PREDICTED: similar to cysteine sulf... 34 2.7
gi|15224582|ref|NP_180644.1| glutathione S-transferase, putative... 34 2.7
gi|16263756|ref|NP_436548.1| putative glutathione S-transferase ... 34 2.7
gi|1170093|sp|P42769|GTH5_ARATH Glutathione S-transferase PM239X... 34 2.7
gi|11990165|emb|CAC19545.1| dichloromethane dehalogenase [dichlo... 33 3.6
gi|34914740|ref|NP_918717.1| putative glutathione S-transferase ... 33 3.6
gi|11177841|gb|AAG32475.1| putative glutathione S-transferase Os... 33 3.6
gi|121709|sp|P20137|GTS5_CHICK Glutathione S-transferase 5 (GST-... 33 3.6
gi|38049401|ref|XP_357096.1| similar to Glutathione S-transferas... 33 3.6
gi|26988551|ref|NP_743976.1| glutathione S-transferase family pr... 33 4.7
gi|11990259|emb|CAC19577.1| dichloromethane dehalogenase [Hyphom... 33 4.7
gi|11990163|emb|CAC19546.1| dichloromethane dehalogenase [bacter... 33 4.7
gi|13626392|sp|Q9FUM1|EF1G_PRUAV Elongation factor 1-gamma (EF-1... 33 4.7
gi|16264154|ref|NP_436946.1| putative glutathione S-transferase ... 33 4.7
gi|16126882|ref|NP_421446.1| glutathione S-transferase family pr... 33 4.7
gi|11497628|ref|NP_068848.1| hypothetical protein [Archaeoglobus... 33 4.7
gi|50421413|ref|XP_459257.1| unnamed protein product [Debaryomyc... 33 4.7
gi|31790093|gb|AAP58391.1| glutathione S-transferase 1 [Brassica... 33 4.7
gi|31790095|gb|AAP58392.1| glutathione S-transferase 2 [Brassica... 33 4.7
gi|31790097|gb|AAP58393.1| glutathione S-transferase 3 [Brassica... 33 4.7
gi|31790099|gb|AAP58394.1| glutathione S-transferase 4 [Brassica... 33 4.7
gi|11385467|gb|AAG34816.1| glutathione S-transferase GST 8 [Zea ... 33 4.7
gi|15603416|ref|NP_246490.1| unknown [Pasteurella multocida Pm70... 33 6.1
gi|119164|sp|P12261|EF1G_ARTSA Elongation factor 1-gamma (EF-1-g... 33 6.1
gi|26989197|ref|NP_744622.1| glutathione S-transferase family pr... 33 6.1
gi|34914786|ref|NP_918740.1| putative glutathione S-transferase ... 33 6.1
gi|45518067|ref|ZP_00169618.1| COG0625: Glutathione S-transferas... 33 6.1
gi|8118486|gb|AAF72998.1| glutathione-S-transferase [Vibrio chol... 33 6.1
gi|27379752|ref|NP_771281.1| blr4641 [Bradyrhizobium japonicum U... 32 8.0
gi|28901272|ref|NP_800927.1| putative glutathione S-transferase ... 32 8.0
>gi|17557472|ref|NP_503968.1| glutathione S-Transferase (gst-33)
[Caenorhabditis elegans]
gi|7434054|pir||T03853 glutathione S-transferase homolog C02A12.1 -
Caenorhabditis elegans
gi|2291125|gb|AAB65264.1| Glutathione s-transferase protein 33
[Caenorhabditis elegans]
Length = 213
Score = 411 bits (1056), Expect = e-114
Identities = 202/213 (94%), Positives = 202/213 (94%)
Frame = -1
Query: 642 MTKYRLHYFNARGYAEASRAMFHMAGVEFEDVRYEIDDWIKEENTLKNEMPFGQMPVLEV 463
MTKYRLHYFNARGYAEASRAMFHMAGVEFEDVRYEIDDWIKEENTLKNEMPFGQMPVLEV
Sbjct: 1 MTKYRLHYFNARGYAEASRAMFHMAGVEFEDVRYEIDDWIKEENTLKNEMPFGQMPVLEV 60
Query: 462 DGEKIPQSVAIARFVANQLGFAGQTPVEKAWADAFTDLYKDFLIDMKPWAMIAFGYPGAA 283
DGEKIPQSVAIARFVANQLGFAGQTPVEKAWADAFTDLYKDFLIDMKPWAMIAFGYPGAA
Sbjct: 61 DGEKIPQSVAIARFVANQLGFAGQTPVEKAWADAFTDLYKDFLIDMKPWAMIAFGYPGAA 120
Query: 282 GDRDELKKTSLDPAKEKYFXXXXXXXXXXXSGFLLDSGISFPDLFFFETTTSLIELEKGF 103
GDRDELKKTSLDPAKEKYF SGFLLDSGISFPDLFFFETTTSLIELEKGF
Sbjct: 121 GDRDELKKTSLDPAKEKYFKLLSKRLEKSKSGFLLDSGISFPDLFFFETTTSLIELEKGF 180
Query: 102 LGTDFPVVNAYFKRIAEHPKLKPYLETRPYSSK 4
LGTDFPVVNAYFKRIAEHPKLKPYLETRPYSSK
Sbjct: 181 LGTDFPVVNAYFKRIAEHPKLKPYLETRPYSSK 213