Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C03A7_3
(1167 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17557514|ref|NP_504382.1| prion-like Q/N-rich domain protein ... 111 3e-23
gi|17557520|ref|NP_504383.1| activated in Blocked Unfolded prote... 108 2e-22
gi|17557522|ref|NP_504384.1| activated in Blocked Unfolded prote... 88 3e-16
gi|17557534|ref|NP_504393.1| activated in Blocked Unfolded prote... 88 4e-16
gi|39583996|emb|CAE64086.1| Hypothetical protein CBG08691 [Caeno... 79 2e-13
gi|39583994|emb|CAE64084.1| Hypothetical protein CBG08689 [Caeno... 77 8e-13
gi|17563034|ref|NP_503423.1| prion-like Q/N-rich domain protein ... 72 2e-11
gi|39583995|emb|CAE64085.1| Hypothetical protein CBG08690 [Caeno... 70 7e-11
gi|39583810|emb|CAE74883.1| Hypothetical protein CBG22746 [Caeno... 65 3e-09
gi|39583811|emb|CAE74884.1| Hypothetical protein CBG22747 [Caeno... 65 4e-09
gi|17569351|ref|NP_509407.1| predicted CDS, activated in Blocked... 64 5e-09
gi|39584002|emb|CAE64092.1| Hypothetical protein CBG08699 [Caeno... 61 6e-08
gi|50293877|ref|XP_449350.1| unnamed protein product [Candida gl... 50 8e-05
gi|46127271|ref|XP_388189.1| hypothetical protein FG08013.1 [Gib... 50 1e-04
gi|39592859|emb|CAE62473.1| Hypothetical protein CBG06569 [Caeno... 50 1e-04
gi|2136504|pir||I47141 gastric mucin (clone PGM-2A) - pig (fragm... 47 9e-04
gi|50291599|ref|XP_448232.1| unnamed protein product [Candida gl... 46 0.002
gi|1582765|prf||2119294A YFW1 gene 44 0.009
gi|6321759|ref|NP_011835.1| cell wall integrity and stress respo... 44 0.009
gi|27805612|sp|Q62635|MUC2_RAT Mucin 2 precursor (Intestinal muc... 43 0.016
gi|1082604|pir||S53363 mucin 5AC (clone JER58) - human (fragment... 43 0.016
gi|19571560|emb|CAD27470.1| SPAPB18E9.04c [Schizosaccharomyces p... 42 0.021
gi|25396003|pir||G88639 protein C34H4.2 [imported] - Caenorhabdi... 42 0.027
gi|6320628|ref|NP_010708.1| Serine/threonine rich cell surface p... 42 0.027
gi|1170299|sp|P41809|HKR1_YEAST Hansenula MRAKII killer toxin-re... 42 0.027
gi|25148407|ref|NP_500096.2| putative secreted or extracellular ... 42 0.027
gi|38108079|gb|EAA54164.1| predicted protein [Magnaporthe grisea... 42 0.036
gi|6322209|ref|NP_012284.1| GPI-anchored cell surface glycoprote... 42 0.036
gi|39590902|emb|CAE58682.1| Hypothetical protein CBG01856 [Caeno... 42 0.036
gi|38090281|ref|XP_357986.1| similar to mucin 16 [Mus musculus] 42 0.036
gi|3676826|gb|AAC62109.1| mucin-like protein [Heterodera glycines] 41 0.047
gi|11384886|pir||I38902 retinoblastoma binding protein RIZ - human 40 0.080
gi|20336260|ref|NP_056950.2| retinoblastoma protein-binding zinc... 40 0.080
gi|38567068|emb|CAE76365.1| related to glucan 1, 4-alpha-glucosi... 40 0.080
gi|25008940|sp|Q13029|PRD2_HUMAN PR-domain zinc finger protein 2... 40 0.080
gi|1405348|dbj|BAA08110.1| zinc-finger DNA-binding protein [Homo... 40 0.080
gi|1587214|prf||2206335A transcription factor 40 0.080
gi|20336258|ref|NP_036363.2| retinoblastoma protein-binding zinc... 40 0.080
gi|39590900|emb|CAE58680.1| Hypothetical protein CBG01854 [Caeno... 40 0.10
gi|17384256|emb|CAC83675.1| mucin 5 [Homo sapiens] 39 0.18
gi|39590899|emb|CAE58679.1| Hypothetical protein CBG01853 [Caeno... 39 0.23
gi|15233976|ref|NP_193602.1| leucine-rich repeat family protein ... 39 0.23
gi|39589649|emb|CAE66884.1| Hypothetical protein CBG12265 [Caeno... 39 0.23
gi|2135764|pir||I53641 mucin 5AC - human (fragment) >gnl|BL_ORD_... 39 0.30
gi|32418956|ref|XP_329956.1| hypothetical protein [Neurospora cr... 39 0.30
gi|38073543|ref|XP_148990.2| similar to KIAA1096 protein [Mus mu... 39 0.30
gi|17550358|ref|NP_508603.1| putative protein, with at least 2 t... 38 0.40
gi|17538770|ref|NP_502375.1| predicted CDS, receptor for egg jel... 38 0.40
gi|22970204|ref|ZP_00017330.1| hypothetical protein [Chloroflexu... 38 0.40
gi|7495878|pir||T29634 hypothetical protein C12D12.1 - Caenorhab... 38 0.40
gi|6322611|ref|NP_012685.1| Delayed Anaerobic Gene; Dan4p [Sacch... 38 0.40
gi|45508516|ref|ZP_00160854.1| COG3225: ABC-type uncharacterized... 38 0.40
gi|17557168|ref|NP_505667.1| activated in Blocked Unfolded prote... 38 0.52
gi|39593357|emb|CAE64827.1| Hypothetical protein CBG09623 [Caeno... 38 0.52
gi|50556110|ref|XP_505463.1| hypothetical protein [Yarrowia lipo... 38 0.52
gi|19113850|ref|NP_592938.1| required for mating and meiosis [Sc... 38 0.52
gi|7492040|pir||T38293 hypothetical serine-rich protein - fissio... 38 0.52
gi|46321597|ref|ZP_00221973.1| COG0457: FOG: TPR repeat [Burkhol... 38 0.52
gi|39592304|emb|CAE75525.1| Hypothetical protein CBG23547 [Caeno... 38 0.52
gi|47209320|emb|CAF92704.1| unnamed protein product [Tetraodon n... 38 0.52
gi|32567356|ref|NP_872210.1| activated in Blocked Unfolded prote... 38 0.52
gi|17557170|ref|NP_505668.1| prion-like Q/N-rich domain protein ... 38 0.52
gi|50794150|ref|XP_423665.1| PREDICTED: similar to MGC68939 prot... 37 0.68
gi|17384258|emb|CAC83676.1| mucin 5 [Homo sapiens] 37 0.68
gi|46397621|sp|P98088|MU5A_HUMAN Mucin 5AC (Mucin 5 subtype AC, ... 37 0.68
gi|22796421|emb|CAC93669.1| peptidoglycan hydrolase [Lactococcus... 37 0.88
gi|33300082|emb|CAE17706.1| Hypothetical protein C30H6.11 [Caeno... 37 0.88
gi|32403608|ref|XP_322417.1| predicted protein [Neurospora crass... 37 0.88
gi|49475417|ref|YP_033458.1| UDP-3-o-[3-hydroxymyristoyl] glucos... 37 0.88
gi|2144110|pir||I84499 zinc finger protein RIZ - rat >gnl|BL_ORD... 37 1.2
gi|17544298|ref|NP_502873.1| predicted CDS, activated in Blocked... 37 1.2
gi|17544300|ref|NP_502874.1| predicted CDS, prion-like Q/N-rich ... 37 1.2
gi|17544296|ref|NP_502872.1| prion-like Q/N-rich domain protein ... 37 1.2
gi|17567159|ref|NP_508265.1| activated in Blocked Unfolded prote... 37 1.2
gi|31203355|ref|XP_310626.1| ENSANGP00000020758 [Anopheles gambi... 37 1.2
gi|7504248|pir||T22696 hypothetical protein F55B11.3 - Caenorhab... 37 1.2
gi|50549699|ref|XP_502320.1| hypothetical protein [Yarrowia lipo... 37 1.2
gi|50286375|ref|XP_445616.1| unnamed protein product [Candida gl... 37 1.2
gi|563375|emb|CAA84031.1| mucin [Homo sapiens] 37 1.2
gi|32422561|ref|XP_331724.1| hypothetical protein [Neurospora cr... 37 1.2
gi|111978|pir||S24169 mucin - rat 37 1.2
gi|15230130|ref|NP_189098.1| protein kinase family protein [Arab... 37 1.2
gi|45454228|gb|AAS65793.1| putative protein kinase [Arabidopsis ... 37 1.2
gi|48130453|ref|XP_393317.1| similar to ENSANGP00000006359 [Apis... 37 1.2
gi|2135766|pir||S53362 mucin 5AC (clone JER47) - human (fragment) 36 1.5
gi|39590898|emb|CAE58678.1| Hypothetical protein CBG01852 [Caeno... 36 1.5
gi|13877617|gb|AAK43886.1| protein kinase-like protein [Arabidop... 36 1.5
gi|15722000|gb|AAL04415.1| zonadhesin splice variant 2 [Homo sap... 36 2.0
gi|27881488|ref|NP_775079.1| zonadhesin isoform 2 [Homo sapiens]... 36 2.0
gi|15042605|gb|AAK82365.1| Ser/Thr protein kinase PAR-1alpha [Dr... 36 2.0
gi|45552751|ref|NP_995900.1| CG8201-PA [Drosophila melanogaster]... 36 2.0
gi|29421200|dbj|BAB13381.2| KIAA1555 protein [Homo sapiens] 36 2.0
gi|3135306|gb|AAC78790.1| zonadhesin [Homo sapiens] 36 2.0
gi|13375634|ref|NP_078779.1| human immunodeficiency virus type I... 36 2.0
gi|8778315|gb|AAF79324.1| F14J16.29 [Arabidopsis thaliana] 36 2.0
gi|23272558|gb|AAH35625.1| EGR2 protein [Homo sapiens] 36 2.0
gi|45552749|ref|NP_995899.1| CG8201-PB [Drosophila melanogaster]... 36 2.0
gi|12083527|gb|AAG48836.1| similar to Arabidopsis thaliana DNA-d... 36 2.0
gi|17544168|ref|NP_502844.1| prion-like Q/N-rich domain protein ... 36 2.0
gi|27881490|ref|NP_775080.1| zonadhesin isoform 4 [Homo sapiens]... 36 2.0
gi|39752597|gb|AAR30180.1| RE47050p [Drosophila melanogaster] 36 2.0
gi|27881492|ref|NP_775081.1| zonadhesin isoform 5 [Homo sapiens]... 36 2.0
gi|15721999|gb|AAL04414.1| zonadhesin splice variant 4 [Homo sap... 36 2.0
gi|23956226|ref|NP_083077.1| mucin 5, subtype B, tracheobronchia... 36 2.0
gi|49474289|ref|YP_032331.1| UDP-3-o-[3-hydroxymyristoyl] glucos... 36 2.0
gi|15721997|gb|AAL04412.1| zonadhesin splice variant 5 [Homo sap... 36 2.0
gi|16554449|ref|NP_003377.1| zonadhesin isoform 3 [Homo sapiens]... 36 2.0
gi|27881486|ref|NP_775078.1| zonadhesin isoform 1 [Homo sapiens]... 36 2.0
gi|27924006|sp|Q9Y493|ZAN_HUMAN Zonadhesin precursor >gnl|BL_ORD... 36 2.0
gi|15721995|gb|AAL04410.1| zonadhesin splice variant 1 [Homo sap... 36 2.0
gi|17544166|ref|NP_502843.1| prion-like Q/N-rich domain protein ... 36 2.0
gi|27881494|ref|NP_775082.1| zonadhesin isoform 6 [Homo sapiens]... 36 2.0
gi|15721998|gb|AAL04413.1| zonadhesin splice variant 6 [Homo sap... 36 2.0
gi|13592175|gb|AAK31375.1| ppg3 [Leishmania major] 35 2.6
gi|1582641|prf||2119210A mucin 35 2.6
gi|50257374|gb|EAL20083.1| hypothetical protein CNBF4090 [Crypto... 35 2.6
gi|33859755|ref|NP_085128.1| CXXC finger 6; leukemia-associated ... 35 2.6
gi|19584342|emb|CAD28467.1| hypothetical protein [Homo sapiens] 35 2.6
gi|46365146|ref|ZP_00227658.1| COG0515: Serine/threonine protein... 35 2.6
gi|10048477|ref|NP_035871.1| zonadhesin [Mus musculus] >gnl|BL_O... 35 2.6
gi|41147656|ref|XP_168583.4| similar to intestinal membrane muci... 35 2.6
gi|3970666|emb|CAA36434.1| suppressor of variegation protein 3-7... 35 2.6
gi|85152|pir||S09151 suvar(3)7 protein - fruit fly (Drosophila m... 35 2.6
gi|45549221|ref|NP_524342.3| CG8599-PA [Drosophila melanogaster]... 35 2.6
gi|12697897|dbj|BAB21767.1| KIAA1676 protein [Homo sapiens] 35 2.6
gi|39590304|emb|CAE66043.1| Hypothetical protein CBG11242 [Caeno... 35 2.6
gi|50755234|ref|XP_414665.1| PREDICTED: similar to transcription... 35 2.6
gi|6754478|ref|NP_034787.1| human immunodeficiency virus type I ... 35 2.6
gi|19424152|ref|NP_598197.1| mucin 10 [Rattus norvegicus] >gnl|B... 35 2.6
gi|34501467|gb|AAK74120.3| mucin 16 [Homo sapiens] 35 3.4
gi|19571553|emb|CAD27464.1| SPAPB15E9.01c [Schizosaccharomyces p... 35 3.4
gi|32414167|ref|XP_327563.1| hypothetical protein [Neurospora cr... 35 3.4
gi|38102388|gb|EAA49230.1| hypothetical protein MG00888.4 [Magna... 35 3.4
gi|32418914|ref|XP_329935.1| hypothetical protein [Neurospora cr... 35 3.4
gi|45550996|ref|NP_724130.2| CG31753-PA [Drosophila melanogaster... 35 3.4
gi|48474505|sp|Q8TFG9|YL61_SCHPO Hypothetical serine/threonine-r... 35 3.4
gi|47605571|sp|Q8I7Z8|HAM_DROME Transcription factor hamlet >gnl... 35 3.4
gi|7513164|pir||PC4395 mucin 3 - human (fragment) >gnl|BL_ORD_ID... 35 3.4
gi|50762236|ref|XP_424983.1| PREDICTED: similar to DnaJ homolog ... 35 3.4
gi|50656899|gb|AAT79550.1| cellulosomal anchoring scaffoldin B p... 35 3.4
gi|50747896|ref|XP_421035.1| PREDICTED: similar to Mucin 2 precu... 35 3.4
gi|995765|gb|AAA75589.1| mucin 35 3.4
gi|48895576|ref|ZP_00328560.1| COG1496: Uncharacterized conserve... 35 3.4
gi|38112111|gb|EAA57577.1| predicted protein [Magnaporthe grisea... 35 4.4
gi|9845524|ref|NP_000390.2| early growth response 2 protein; KRO... 35 4.4
gi|2276127|dbj|BAA21556.1| hepatitis A virus receptor [Cercopith... 35 4.4
gi|34910776|ref|NP_916735.1| VsaA -like protein [Oryza sativa (j... 35 4.4
gi|34871132|ref|XP_233464.2| similar to DNA binding protein Rc [... 35 4.4
gi|2618801|gb|AAB84381.1| mucin [Homo sapiens] 35 4.4
gi|40714691|gb|AAR88597.1| putative glucanase [Oryza sativa (jap... 35 4.4
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno... 35 4.4
gi|13646986|dbj|BAB41080.1| DNA-binding protein DF1 [Pisum sativum] 35 4.4
gi|38086618|ref|XP_149934.2| similar to ENSANGP00000004655 [Mus ... 35 4.4
gi|21756339|dbj|BAC04860.1| unnamed protein product [Homo sapiens] 35 4.4
gi|31232507|ref|XP_318717.1| ENSANGP00000004655 [Anopheles gambi... 35 4.4
gi|67392|pir||ALBYG glucan 1,4-alpha-glucosidase (EC 3.2.1.3) pr... 35 4.4
gi|13095628|ref|NP_076543.1| glycoprotein gp80 [Bovine herpesvir... 35 4.4
gi|105902|pir||A40492 early growth response 2 protein (EGR2) - h... 35 4.4
gi|47207919|emb|CAG05196.1| unnamed protein product [Tetraodon n... 35 4.4
gi|181987|gb|AAA52372.1| early growth response 2 protein 35 4.4
gi|2130539|gb|AAC51342.1| mucin MUC5B [Homo sapiens] 35 4.4
gi|2853299|gb|AAC02271.1| mucin [Homo sapiens] 35 4.4
gi|9963982|gb|AAG09787.1| repressed by TUP1 protein 1; Rbt1p [Ca... 35 4.4
gi|49085344|ref|XP_404801.1| hypothetical protein AN0664.2 [Aspe... 35 4.4
gi|42659788|ref|XP_039877.8| mucin 5, subtype B, tracheobronchia... 35 4.4
gi|46122409|ref|XP_385758.1| hypothetical protein FG05582.1 [Gib... 35 4.4
gi|46434432|gb|EAK93842.1| hypothetical protein CaO19.8907 [Cand... 35 4.4
gi|46434465|gb|EAK93874.1| hypothetical protein CaO19.1327 [Cand... 35 4.4
gi|83626|pir||JU0474 glucan 1,4-alpha-glucosidase (EC 3.2.1.3) S... 35 4.4
gi|113798|sp|P04065|AMYH_SACDI Glucoamylase S1 precursor (Glucan... 35 4.4
gi|24419041|gb|AAL65133.2| ovarian cancer related tumor marker C... 35 4.4
gi|17380516|sp|P57999|ZAN_RABIT Zonadhesin >gnl|BL_ORD_ID|671946... 35 4.4
gi|11360120|pir||T47182 hypothetical protein DKFZp434M1616.1 - h... 34 5.7
gi|39578940|emb|CAE56077.1| Hypothetical protein CBG23655 [Caeno... 34 5.7
gi|11360308|pir||T45025 mucin MUC5B, tracheobronchial [imported]... 34 5.7
gi|39585659|emb|CAE59861.1| Hypothetical protein CBG03336 [Caeno... 34 5.7
gi|32565577|ref|NP_496139.2| sushi domain/SCR domain/CCP module ... 34 5.7
gi|50306815|ref|XP_453383.1| unnamed protein product [Kluyveromy... 34 5.7
gi|23821885|sp|Q9HC84|MU5B_HUMAN Mucin 5B precursor (Mucin 5 sub... 34 5.7
gi|7499889|pir||T21389 hypothetical protein F26C11.3 - Caenorhab... 34 5.7
gi|27673011|ref|XP_220573.1| similar to platelet glycoprotein Ib... 34 5.7
gi|49075648|ref|XP_401876.1| hypothetical protein UM04261.1 [Ust... 34 5.7
gi|28872861|ref|NP_055987.1| HBxAg transactivated protein 2 [Hom... 34 5.7
gi|292044|gb|AAA35866.1| mucin 34 5.7
gi|25013325|gb|AAL09829.2| beta-glucosidase 5 [Coccidioides posa... 34 5.7
gi|50256987|gb|EAL19705.1| hypothetical protein CNBG3330 [Crypto... 34 5.7
gi|422833|pir||A46629 mucin 6, gastric (single repeat clone) - h... 34 5.7
gi|15236453|ref|NP_194062.1| receptor-like protein kinase, putat... 34 5.7
gi|32406448|ref|XP_323837.1| predicted protein [Neurospora crass... 32 6.4
gi|46432918|gb|EAK92380.1| hypothetical protein CaO19.3384 [Cand... 34 7.5
gi|28144145|gb|AAO26189.1| PDZ-LIM protein cypher1s [Mus musculus] 34 7.5
gi|24661753|ref|NP_648336.1| CG3280-PA [Drosophila melanogaster]... 34 7.5
gi|34869036|ref|XP_233120.2| similar to hypothetical protein [Ra... 34 7.5
gi|50305509|ref|XP_452714.1| unnamed protein product [Kluyveromy... 34 7.5
gi|31791491|ref|NP_853984.1| CONSERVED HYPOTHETICAL PROLINE AND ... 34 7.5
gi|31231947|ref|XP_318620.1| ENSANGP00000020885 [Anopheles gambi... 34 7.5
gi|46443605|gb|EAL02886.1| hypothetical protein CaO19.9293 [Cand... 34 7.5
gi|49103704|ref|XP_411178.1| hypothetical protein AN7041.2 [Aspe... 34 7.5
gi|46443734|gb|EAL03014.1| hypothetical protein CaO19.1725 [Cand... 34 7.5
gi|11346533|pir||T44657 protein GP80 [imported] - bovine herpesv... 34 7.5
gi|14132803|emb|CAC38840.1| putative transcription factor [Acrem... 34 7.5
gi|50510545|dbj|BAD32258.1| mKIAA0613 protein [Mus musculus] 34 7.5
gi|15230275|ref|NP_188537.1| cell wall protein-related [Arabidop... 34 7.5
gi|32413210|ref|XP_327085.1| hypothetical protein ( hypothetical... 34 7.5
gi|17561512|ref|NP_506158.1| predicted CDS, putative protein fam... 34 7.5
gi|50582547|ref|NP_036048.2| LIM domain binding 3; Z-band altern... 34 7.5
gi|6969629|gb|AAF33847.1| oracle 1 protein [Mus musculus] 34 7.5
gi|1778844|gb|AAB40929.1| LimA [Dictyostelium discoideum] 34 7.5
gi|17384254|emb|CAC83674.1| mucin 5 [Homo sapiens] 34 7.5
gi|17544388|ref|NP_502993.1| putative protein family member, wit... 34 7.5
gi|172526|gb|AAA35015.1| S1 protein 34 7.5
gi|18025476|gb|AAK95420.1| BPLF1 [cercopithicine herpesvirus 15] 34 7.5
gi|2130546|gb|AAC51344.1| mucin [Homo sapiens] 34 7.5
gi|50290701|ref|XP_447783.1| unnamed protein product [Candida gl... 34 7.5
gi|50257705|gb|EAL20408.1| hypothetical protein CNBE5310 [Crypto... 34 7.5
gi|33147012|dbj|BAC80096.1| hypothetical protein [Oryza sativa (... 34 7.5
gi|50554945|ref|XP_504881.1| hypothetical protein [Yarrowia lipo... 34 7.5
gi|544411|sp|Q06885|GP10_DICDI Glycoprotein gp100 precursor (P29... 34 7.5
gi|39583863|emb|CAE63953.1| Hypothetical protein CBG08535 [Caeno... 33 9.8
gi|49078548|ref|XP_403016.1| hypothetical protein UM05401.1 [Ust... 33 9.8
gi|39582656|emb|CAE73760.1| Hypothetical protein CBG21295 [Caeno... 33 9.8
gi|19115343|ref|NP_594431.1| hypothetical ser-thr rich protein [... 33 9.8
gi|50756441|ref|XP_415169.1| PREDICTED: similar to ataxin 2; oli... 33 9.8
gi|39579121|emb|CAE56545.1| Hypothetical protein CBG24276 [Caeno... 33 9.8
gi|2137220|pir||A56068 co-repressor protein - mouse >gnl|BL_ORD_... 33 9.8
gi|34334621|gb|AAQ64797.1| Sr-CI [Drosophila simulans] 33 9.8
gi|2135765|pir||A43932 mucin 2 precursor, intestinal - human (fr... 33 9.8
gi|34334629|gb|AAQ64801.1| Sr-CI [Drosophila simulans] >gnl|BL_O... 33 9.8
gi|34334625|gb|AAQ64799.1| Sr-CI [Drosophila simulans] 33 9.8
gi|38104579|gb|EAA51125.1| hypothetical protein MG08647.4 [Magna... 33 9.8
gi|50877834|emb|CAG37674.1| probable UDP-3-O-[3-hydroxymyristoyl... 33 9.8
gi|34925181|sp|Q60520|SN3A_MOUSE Paired amphipathic helix protei... 33 9.8
gi|15426447|gb|AAH13325.1| HAVCR1 protein [Homo sapiens] >gnl|BL... 33 9.8
gi|34328655|gb|AAO83654.1| putative protein Roco9 [Dictyostelium... 33 9.8
gi|186396|gb|AAA59163.1| mucin 33 9.8
gi|30931163|gb|AAH52716.1| Sin3a protein [Mus musculus] 33 9.8
gi|17544390|ref|NP_502994.1| predicted CDS, putative protein fam... 33 9.8
gi|4505285|ref|NP_002448.1| mucin 2 [Homo sapiens] >gnl|BL_ORD_I... 33 9.8
gi|2137221|pir||I61713 co-repressor protein - mouse >gnl|BL_ORD_... 33 9.8
gi|50257806|gb|EAL20507.1| hypothetical protein CNBE4270 [Crypto... 33 9.8
gi|49078516|ref|XP_403003.1| hypothetical protein UM05388.1 [Ust... 33 9.8
gi|34765003|gb|AAQ82434.1| mucin glycoprotein [Homo sapiens] 33 9.8
gi|27151726|sp|O13854|YFGG_SCHPO Hypothetical serine/threonine-r... 33 9.8
gi|34865153|ref|XP_347180.1| similar to MUC6 [Rattus norvegicus] 33 9.8
gi|46441846|gb|EAL01140.1| hypothetical protein CaO19.301 [Candi... 33 9.8
gi|14590454|ref|NP_142522.1| hypothetical protein similar to div... 33 9.8
gi|28828932|gb|AAO51518.1| similar to Homo sapiens (Human). NPD0... 33 9.8
gi|5732926|gb|AAD49342.1| excretory/secretory mucin MUC-5 [Toxoc... 33 9.8
gi|31203057|ref|XP_310477.1| ENSANGP00000019255 [Anopheles gambi... 33 9.8
gi|50549557|ref|XP_502249.1| hypothetical protein [Yarrowia lipo... 33 9.8
gi|31807190|gb|AAH53385.1| Sin3a protein [Mus musculus] 33 9.8
gi|17567385|ref|NP_510839.1| predicted CDS, activated in Blocked... 33 9.8
gi|34334623|gb|AAQ64798.1| Sr-CI [Drosophila simulans] >gnl|BL_O... 33 9.8
gi|14029009|gb|AAK52550.1| Unknown protein [Oryza sativa] 33 9.8
gi|34861766|ref|XP_215127.2| similar to secreted gel-forming muc... 33 9.8
gi|7106407|ref|NP_035508.1| transcriptional regulator, SIN3A; tr... 33 9.8
gi|39593823|emb|CAE62116.1| Hypothetical protein CBG06155 [Caeno... 33 9.8
gi|231543|sp|P29760|AMYI_SACDI Glucoamylase S2 precursor (Glucan... 33 9.8
gi|34559872|gb|AAQ75560.1| Sr-CI [Drosophila melanogaster] >gnl|... 33 9.8
gi|1076781|pir||A54415 transcription factor HBP-1a(c14) - wheat ... 33 9.8
>gi|17557514|ref|NP_504382.1| prion-like Q/N-rich domain protein
PQN-5, Prion-like Q/N-rich domain protein (pqn-5)
[Caenorhabditis elegans]
gi|7495235|pir||T31887 hypothetical protein C03A7.4 - Caenorhabditis
elegans
gi|2315502|gb|AAB66001.1| Prion-like-(q/n-rich)-domain-bearing
protein protein 5 [Caenorhabditis elegans]
Length = 388
Score = 111 bits (278), Expect = 3e-23
Identities = 67/165 (40%), Positives = 67/165 (40%)
Frame = +1
Query: 670 NTQCSDICQQTAQATQQVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNSCTSQ 849
NTQCSDICQQTAQATQQV DNSCTSQ
Sbjct: 224 NTQCSDICQQTAQATQQVYNQNMNQNTNTQMYNPYNTNTNQNANCAPACQPACDNSCTSQ 283
Query: 850 QTQPMYQPYDTTTEAPAQVIQIVLQTSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1029
QTQPMYQPYDTTTEAPAQVIQIVLQTSV
Sbjct: 284 QTQPMYQPYDTTTEAPAQVIQIVLQTSVAQSSQCAPQCEQSCQQQCVQQQQPAAQCQTAC 343
Query: 1030 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYSPCGNGQCCRRK 1164
NYSPCGNGQCCRRK
Sbjct: 344 QSSCSNSCQAAQPATTACQQSPQQSSCSCQANYSPCGNGQCCRRK 388
Score = 51.6 bits (122), Expect = 3e-05
Identities = 26/26 (100%), Positives = 26/26 (100%)
Frame = +1
Query: 1 MRFTSLSIAFLACALVVSGSAIREKR 78
MRFTSLSIAFLACALVVSGSAIREKR
Sbjct: 1 MRFTSLSIAFLACALVVSGSAIREKR 26