Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C05E4_11
(1101 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17563482|ref|NP_503315.1| serpin (srp-1) [Caenorhabditis eleg... 723 0.0
gi|39592660|emb|CAE62274.1| Hypothetical protein CBG06333 [Caeno... 468 e-130
gi|39592678|emb|CAE62292.1| Hypothetical protein CBG06352 [Caeno... 265 1e-69
gi|17563492|ref|NP_505107.1| serpin (40.4 kD) (srp-7) [Caenorhab... 250 5e-65
gi|39592659|emb|CAE62273.1| Hypothetical protein CBG06332 [Caeno... 247 3e-64
gi|42405410|gb|AAS13532.1| serine or cysteine protease inhibitor... 244 2e-63
gi|17563490|ref|NP_504890.1| serpin (srp-6) [Caenorhabditis eleg... 244 3e-63
gi|7495290|pir||T25504 hypothetical protein C03G6.19 - Caenorhab... 244 3e-63
gi|17563484|ref|NP_503318.1| patterned Expression Site PES-21, S... 238 1e-61
gi|25154383|ref|NP_503528.2| serpin (40.6 kD) (srp-3) [Caenorhab... 238 2e-61
gi|42405401|gb|AAS13528.1| serine or cysteine protease inhibitor... 238 2e-61
gi|42405412|gb|AAS13533.1| serine or cysteine protease inhibitor... 236 9e-61
gi|39590372|emb|CAE66111.1| Hypothetical protein CBG11331 [Caeno... 234 3e-60
gi|39592674|emb|CAE62288.1| Hypothetical protein CBG06347 [Caeno... 233 5e-60
gi|7711112|emb|CAA72916.2| serine protease inhibitor-like protei... 221 2e-56
gi|32567324|ref|NP_507268.2| serpin (srp-9) [Caenorhabditis eleg... 201 2e-50
gi|39592677|emb|CAE62291.1| Hypothetical protein CBG06351 [Caeno... 192 2e-47
gi|7498712|pir||T20650 hypothetical protein F09C6.5 - Caenorhabd... 191 3e-47
gi|17563498|ref|NP_507269.1| predicted CDS, serpin (srp-10) [Cae... 183 7e-45
gi|17563488|ref|NP_504889.1| predicted CDS, serpin (srp-5) [Caen... 178 2e-43
gi|39589045|emb|CAE57777.1| Hypothetical protein CBG00799 [Caeno... 175 1e-42
gi|17228273|ref|NP_484821.1| similar to serine protease inhibito... 174 3e-42
gi|45509207|ref|ZP_00161542.1| COG4826: Serine protease inhibito... 172 1e-41
gi|23125481|ref|ZP_00107412.1| COG4826: Serine protease inhibito... 171 2e-41
gi|6572143|emb|CAB63096.1| serine proteinase inhibitor (serpin-1... 160 6e-38
gi|24586111|ref|NP_524958.2| CG9456-PA [Drosophila melanogaster]... 160 6e-38
gi|3885488|gb|AAC95432.1| squamous cell carcinoma antigen 2 [Mus... 158 2e-37
gi|27462376|gb|AAN62872.1| squamous cell carcinoma antigen 2 rel... 158 2e-37
gi|27462060|gb|AAN62870.1| squamous cell carcinoma antigen 2 [Mu... 158 2e-37
gi|17975583|ref|NP_524953.1| CG10913-PA [Drosophila melanogaster... 157 3e-37
gi|113052|sp|P80034|ACH2_BOMMO Antichymotrypsin II (ACHY-II) >gn... 157 4e-37
gi|38371730|ref|NP_941373.1| serine (or cysteine) proteinase inh... 156 7e-37
gi|40737632|gb|AAR89288.1| serpinb3b [Mus musculus] 156 9e-37
gi|47215288|emb|CAF98097.1| unnamed protein product [Tetraodon n... 155 1e-36
gi|433400|gb|AAB42377.1| BmSERPIN [Brugia malayi] 154 5e-36
gi|32450606|gb|AAH54235.1| Serpina1d-prov protein [Xenopus laevis] 154 5e-36
gi|34878800|ref|XP_222492.2| similar to squamous cell carcinoma ... 153 6e-36
gi|2118386|pir||I56481 alpha 1-proteinase inhibitor - spiny mous... 153 8e-36
gi|7542480|gb|AAF63473.1| serine proteinase inhibitor [Trichinel... 151 3e-35
gi|2118392|pir||I49471 alpha-1 proteinase inhibitor 2 - mouse (f... 151 3e-35
gi|48860367|ref|ZP_00314292.1| COG4826: Serine protease inhibito... 150 4e-35
gi|112867|sp|P22599|A1T2_MOUSE Alpha-1-antitrypsin 1-2 precursor... 150 4e-35
gi|18256880|gb|AAH21850.1| Serpina1d protein [Mus musculus] 150 5e-35
gi|40254615|ref|NP_033270.2| serine (or cysteine) proteinase inh... 150 5e-35
gi|28138135|gb|AAO26395.1| serpin [Ctenocephalides felis] 150 7e-35
gi|45550372|ref|NP_610246.3| CG9460-PA [Drosophila melanogaster]... 149 9e-35
gi|25527511|gb|AAN73322.1| serpin 4 [Ctenocephalides felis] 149 9e-35
gi|25527466|gb|AAN73320.1| serpin 6 [Ctenocephalides felis] 149 9e-35
gi|34875507|ref|XP_225267.2| similar to NK26 [Rattus norvegicus] 149 1e-34
gi|25527494|gb|AAN73321.1| serpin 5 [Ctenocephalides felis] 149 1e-34
gi|49523584|emb|CAD68157.1| serine protease inhibitor [Branchios... 149 1e-34
gi|28603766|ref|NP_788819.1| serine (or cysteine) proteinase inh... 149 1e-34
gi|203063|gb|AAA40788.1| alpha-1-antitrypsin precursor 149 1e-34
gi|112889|sp|P17475|A1AT_RAT Alpha-1-antiproteinase precursor (A... 149 1e-34
gi|17148354|emb|CAD12784.1| serpin [Anopheles gambiae] 148 3e-34
gi|25140425|gb|AAN71632.1| serine protease inhibitor serpin 1a [... 148 3e-34
gi|31210385|ref|XP_314159.1| ENSANGP00000015833 [Anopheles gambi... 148 3e-34
gi|31210381|ref|XP_314157.1| ENSANGP00000023182 [Anopheles gambi... 148 3e-34
gi|25527811|gb|AAN73325.1| serpin 1 [Ctenocephalides felis] 147 3e-34
gi|11968100|ref|NP_071964.1| serine protease inhibitor alpha 1; ... 147 4e-34
gi|12834448|dbj|BAB22916.1| unnamed protein product [Mus musculus] 147 4e-34
gi|6678085|ref|NP_033272.1| serine (or cysteine) proteinase inhi... 147 6e-34
gi|27685107|ref|XP_225266.1| similar to NK13 [Rattus norvegicus] 146 7e-34
gi|6678079|ref|NP_033269.1| serine (or cysteine) proteinase inhi... 146 7e-34
gi|15029602|gb|AAH10988.1| Serpina1a protein [Mus musculus] 146 1e-33
gi|37521539|ref|NP_924916.1| probable serine protease inhibitor ... 146 1e-33
gi|45552471|ref|NP_995758.1| CG9453-PG [Drosophila melanogaster]... 145 1e-33
gi|29612513|gb|AAH49970.1| Serpina1a protein [Mus musculus] 145 1e-33
gi|45552477|ref|NP_995761.1| CG9453-PD [Drosophila melanogaster]... 145 1e-33
gi|25527771|gb|AAN73324.1| serpin 2 [Ctenocephalides felis] 145 1e-33
gi|239552|gb|AAB20405.1| squamous cell carcinoma antigen; SCC an... 145 1e-33
gi|15929675|gb|AAH15266.1| Serpina1a protein [Mus musculus] 145 1e-33
gi|14602605|gb|AAH09818.1| Serpina1a protein [Mus musculus] >gnl... 145 1e-33
gi|15029662|gb|AAH11040.1| Serine (or cysteine) proteinase inhib... 145 1e-33
gi|25527594|gb|AAN73323.1| serpin 3 [Ctenocephalides felis] 145 2e-33
gi|2118383|pir||I38201 squamous cell carcinoma antigen 1 - human 145 2e-33
gi|50540374|ref|NP_001002653.1| zgc:91981 [Danio rerio] >gnl|BL_... 145 2e-33
gi|1144561|gb|AAB60386.1| protein C inhibitor 145 2e-33
gi|29825633|gb|AAO92272.1| squamous cell carcinoma antigen 1 [Ho... 144 3e-33
gi|13904990|gb|AAH06776.1| Serine (or cysteine) proteinase inhib... 144 3e-33
gi|6678091|ref|NP_033276.1| serine (or cysteine) proteinase inhi... 144 3e-33
gi|6678083|ref|NP_033271.1| serine (or cysteine) proteinase inhi... 144 3e-33
gi|30584745|gb|AAP36625.1| Homo sapiens serine (or cysteine) pro... 144 4e-33
gi|5902072|ref|NP_008850.1| serine (or cysteine) proteinase inhi... 144 4e-33
gi|24585522|ref|NP_524956.2| CG9334-PA [Drosophila melanogaster]... 143 6e-33
gi|6759386|emb|CAB69784.1| putative serine protease inhibitor [A... 143 6e-33
gi|5262663|emb|CAB45766.1| hypothetical protein [Homo sapiens] 143 6e-33
gi|14140097|emb|CAB55818.2| hypothetical protein [Ixodes ricinus] 143 6e-33
gi|21361195|ref|NP_000615.2| serine (or cysteine) proteinase inh... 143 6e-33
gi|25005272|emb|CAD56658.1| squamous cell carcinoma antigen 1 [H... 143 6e-33
gi|30585367|gb|AAP36956.1| Homo sapiens serine (or cysteine) pro... 143 6e-33
gi|40018548|ref|NP_954516.1| serine (or cysteine) proteinase inh... 143 8e-33
gi|41235743|ref|NP_958751.1| serine (or cysteine) proteinase inh... 143 8e-33
gi|6678097|ref|NP_033280.1| serine (or cysteine) proteinase inhi... 143 8e-33
gi|31210379|ref|XP_314156.1| ENSANGP00000022846 [Anopheles gambi... 142 1e-32
gi|33468935|ref|NP_035590.1| serine (or cysteine) proteinase inh... 142 1e-32
gi|31199797|ref|XP_308846.1| ENSANGP00000007723 [Anopheles gambi... 142 1e-32
gi|17563494|ref|NP_505108.1| predicted CDS, serpin (srp-8) [Caen... 142 1e-32
gi|4126465|dbj|BAA36581.1| alpha-1-antiproteinase [Xenopus laevis] 142 1e-32
gi|2137083|pir||S60036 alpha-1-antitrypsin precursor - golden ha... 142 1e-32
gi|6572147|emb|CAB63098.1| serine protease inhibitor (serpin-3) ... 142 2e-32
gi|38328348|gb|AAH62169.1| Serpinb6c protein [Mus musculus] 142 2e-32
gi|6759388|emb|CAB69785.1| putative serine protease inhibitor [A... 142 2e-32
gi|21313654|ref|NP_082273.1| serine (or cysteine) proteinase inh... 141 3e-32
gi|34810820|pdb|1OO8|A Chain A, Crystal Structure Of A1pi-Pittsb... 141 3e-32
gi|20070105|ref|NP_035585.1| serine (or cysteine) proteinase inh... 141 3e-32
gi|18251228|gb|AAL65909.1| NK21B [Mus musculus] >gnl|BL_ORD_ID|3... 141 3e-32
gi|6572149|emb|CAB63099.1| serine protease inhibitor (serpin-4) ... 141 3e-32
gi|24586107|ref|NP_724512.1| CG9453-PA [Drosophila melanogaster]... 141 3e-32
gi|2392173|pdb|1ATU| Uncleaved Alpha-1-Antitrypsin 141 3e-32
gi|31210383|ref|XP_314158.1| ENSANGP00000023448 [Anopheles gambi... 141 3e-32
gi|24586105|ref|NP_524955.2| CG9453-PB [Drosophila melanogaster]... 141 3e-32
gi|2507388|sp|P09006|CPI6_RAT Contrapsin-like protease inhibitor... 140 4e-32
gi|24586104|ref|NP_724511.1| CG9453-PC [Drosophila melanogaster]... 140 4e-32
gi|45552463|ref|NP_995754.1| CG9453-PK [Drosophila melanogaster]... 140 4e-32
gi|45552473|ref|NP_995759.1| CG9453-PF [Drosophila melanogaster]... 140 4e-32
gi|30354678|gb|AAH52216.1| BC052216 protein [Mus musculus] 140 4e-32
gi|34875368|ref|XP_341523.1| similar to SPI6 [Rattus norvegicus] 140 4e-32
gi|50749042|ref|XP_426460.1| PREDICTED: similar to alpha-1-antit... 140 4e-32
gi|3982489|gb|AAC83412.1| alpha-1-antitrypsin; serine protease i... 140 4e-32
gi|50748650|ref|XP_421343.1| PREDICTED: similar to alpha-1-antit... 140 5e-32
gi|1942629|pdb|1KCT| Alpha1-Antitrypsin 140 5e-32
gi|462410|sp|P05619|ILEU_HORSE Leukocyte elastase inhibitor (LEI... 140 5e-32
gi|231459|sp|P22922|A1AT_BOMMO Antitrypsin precursor (AT) >gnl|B... 140 5e-32
gi|180550|gb|AAA35688.1| plasma serine protease inhibitor precur... 140 5e-32
gi|225768|prf||1313184B alpha1 antitrypsin 140 5e-32
gi|13928716|ref|NP_113719.1| serine protease inhibitor 2c [Rattu... 140 7e-32
gi|2116650|dbj|BAA20264.1| alpha-1-antitrypsin [Cercopithecus ae... 140 7e-32
gi|13489087|ref|NP_109591.1| serine (or cysteine) proteinase inh... 140 7e-32
gi|15826846|ref|NP_035586.1| serine (or cysteine) proteinase inh... 140 7e-32
gi|34857087|ref|XP_342264.1| serine (or cysteine) proteinase inh... 140 7e-32
gi|4826904|ref|NP_005016.1| serine (or cysteine) proteinase inhi... 140 7e-32
gi|30584099|gb|AAP36298.1| Homo sapiens serine (or cysteine) pro... 140 7e-32
gi|84752|pir||JX0130 antitrypsin precursor - silkworm 139 9e-32
gi|112888|sp|P01010|A1AT_PAPAN Alpha-1-antitrypsin precursor (Al... 139 9e-32
gi|50748654|ref|XP_421345.1| PREDICTED: similar to alpha-1-antit... 139 1e-31
gi|40353064|gb|AAH64768.1| Serine (or cysteine) proteinase inhib... 139 1e-31
gi|29477191|gb|AAH50060.1| Serine (or cysteine) proteinase inhib... 139 1e-31
gi|17390079|gb|AAH18043.1| Serine (or cysteine) proteinase inhib... 139 1e-31
gi|13195769|gb|AAB26244.2| acrosomal serine protease inhibitor [... 139 1e-31
gi|6678087|ref|NP_033273.1| serine (or cysteine) proteinase inhi... 139 1e-31
gi|15826844|ref|NP_035584.1| serine (or cysteine) proteinase inh... 139 2e-31
gi|47531077|gb|AAT35220.1| serine protease inhibitor jellypin [C... 139 2e-31
gi|15826842|ref|NP_035582.1| serine (or cysteine) proteinase inh... 139 2e-31
gi|41235787|ref|NP_958764.1| serpinb3d [Mus musculus] >gnl|BL_OR... 139 2e-31
gi|2118384|pir||I38202 leupin precursor - human 139 2e-31
gi|6016389|sp|P70458|IPSP_MOUSE Plasma serine protease inhibitor... 139 2e-31
gi|34875511|ref|XP_344593.1| similar to NK13 [Rattus norvegicus] 138 2e-31
gi|50734130|ref|XP_418980.1| PREDICTED: similar to serine (or cy... 138 2e-31
gi|38328370|gb|AAH62236.1| Unknown (protein for MGC:72900) [Ratt... 137 3e-31
gi|28948408|pdb|1IZ2|A Chain A, Interactions Causing The Kinetic... 137 3e-31
gi|45552467|ref|NP_995756.1| CG9453-PI [Drosophila melanogaster]... 137 3e-31
gi|45552465|ref|NP_995755.1| CG9453-PJ [Drosophila melanogaster]... 137 3e-31
gi|7861758|gb|AAF70387.1| neuroserpin [Rattus norvegicus] 137 3e-31
gi|461443|sp|Q03044|A1AT_DIDMA Alpha-1-antiproteinase precursor ... 137 3e-31
gi|220698|dbj|BAA00648.1| contrapsin-like protease inhibitor (CP... 137 4e-31
gi|1942953|pdb|1PSI| Intact Recombined Alpha1-Antitrypsin Mutan... 137 4e-31
gi|191388|gb|AAA37078.1| pregnancy protein 60 kDa 137 4e-31
gi|417185|sp|P80229|ILEU_PIG Leukocyte elastase inhibitor (LEI) ... 137 4e-31
gi|29825631|gb|AAO92271.1| squamous cell carcinoma antigen 2 [Ho... 137 4e-31
gi|27370468|ref|NP_766541.1| serine (or cysteine) proteinase inh... 137 4e-31
gi|26352698|dbj|BAC39979.1| unnamed protein product [Mus musculus] 137 4e-31
gi|6678101|ref|NP_033282.1| serine (or cysteine) proteinase inhi... 137 4e-31
gi|16758618|ref|NP_446231.1| serine (or cysteine) proteinase inh... 137 4e-31
gi|49258046|gb|AAH74366.1| Unknown (protein for MGC:84260) [Xeno... 137 4e-31
gi|46142696|ref|ZP_00149456.2| COG4826: Serine protease inhibito... 137 4e-31
gi|112876|sp|P23035|A1AF_RABIT Alpha-1-antiproteinase F precurso... 137 4e-31
gi|31874844|emb|CAD98106.1| hypothetical protein [Homo sapiens] 137 4e-31
gi|13787109|pdb|1HP7|A Chain A, A 2.1 Angstrom Structure Of An U... 137 6e-31
gi|50659080|ref|NP_001076.2| serine (or cysteine) proteinase inh... 137 6e-31
gi|1340142|emb|CAA48671.1| alpha1-antichymotrypsin [Homo sapiens] 137 6e-31
gi|20141722|sp|P35237|PTI6_HUMAN Placental thrombin inhibitor (C... 137 6e-31
gi|5453886|ref|NP_006208.1| protease inhibitor 14 [Homo sapiens]... 137 6e-31
gi|177933|gb|AAA51560.1| alpha-1-antichymotrypsin precursor 137 6e-31
gi|4165890|gb|AAD08810.1| alpha-1-antichymotrypsin precursor [Ho... 137 6e-31
gi|177831|gb|AAB59495.1| alpha-1-antitrypsin 136 8e-31
gi|15990507|gb|AAH15642.1| Serine (or cysteine) proteinase inhib... 136 8e-31
gi|50363217|ref|NP_000286.3| serine (or cysteine) proteinase inh... 136 8e-31
gi|6137432|pdb|1QLP|A Chain A, 2.0 Angstrom Structure Of Intact ... 136 8e-31
gi|21961493|gb|AAH34554.1| SERPINA3 protein [Homo sapiens] 136 8e-31
gi|41152086|ref|NP_004559.4| serine (or cysteine) proteinase inh... 136 8e-31
gi|177836|gb|AAA51547.1| alpha-1-antitrypsin precursor 136 1e-30
gi|28076869|ref|NP_002965.1| serine (or cysteine) proteinase inh... 136 1e-30
gi|50748648|ref|XP_421342.1| PREDICTED: similar to Serpina1d-pro... 135 1e-30
gi|6980544|pdb|1QMN|A Chain A, Alpha1-Antichymotrypsin Serpin In... 135 1e-30
gi|15080499|gb|AAH11991.1| Serine (or cysteine) proteinase inhib... 135 1e-30
gi|92335|pir||B29131 kallikrein-binding protein precursor - rat ... 135 1e-30
gi|38649345|gb|AAH63325.1| Unknown (protein for MGC:74171) [Mus ... 135 1e-30
gi|539661|pir||A48681 placental thrombin inhibitor - human >gnl|... 135 1e-30
gi|481621|pir||S38962 serpin - pig 135 1e-30
gi|627784|pir||A54968 alpha-1-antitrypsin precursor - rabbit >gn... 135 1e-30
gi|423323|pir||JX0267 alpha-1-antiproteinase S-1 precursor - rab... 135 1e-30
gi|2118396|pir||S54981 alpha-1-antiproteinase isoform E precurso... 135 2e-30
gi|6855601|gb|AAF29581.1| PRO0684 [Homo sapiens] 135 2e-30
gi|224224|prf||1012287A antitrypsin alpha1 mutant 135 2e-30
gi|34935459|ref|XP_234518.2| similar to serine (or cysteine) pro... 135 2e-30
gi|266407|sp|P05545|CPI1_RAT Contrapsin-like protease inhibitor ... 135 2e-30
gi|29825635|gb|AAO92273.1| squamous cell carcinoma antigen 2 [Ho... 135 2e-30
gi|2804191|dbj|BAA24420.1| alpha,-antitrypsin-like protein [Sper... 135 2e-30
gi|177827|gb|AAA51546.1| alpha-1-antitrypsin 134 3e-30
gi|17978303|ref|NP_536723.1| serine (or cysteine) proteinase inh... 134 3e-30
gi|2144574|pir||ITHUC alpha-1-antichymotrypsin precursor - human 134 3e-30
gi|28948486|pdb|1LQ8|A Chain A, Crystal Structure Of Cleaved Pro... 134 4e-30
gi|6981576|ref|NP_036789.1| serine protease inhibitor 2b; contra... 134 4e-30
gi|20140144|sp|Q96P15|SB11_HUMAN Serpin B11 >gnl|BL_ORD_ID|12131... 134 4e-30
gi|25140427|gb|AAN71633.1| serine protease inhibitor serpin 1b [... 134 4e-30
gi|20140270|sp|Q9JK88|SPI2_MOUSE Serpin I2 precursor (Serine pro... 134 4e-30
gi|33468991|ref|NP_080736.1| serine (or cysteine) proteinase inh... 134 4e-30
gi|12841103|dbj|BAB25079.1| unnamed protein product [Mus musculus] 134 4e-30
gi|17223664|gb|AAK61376.1| serine proteinase inhibitor serpin-2 ... 134 4e-30
gi|23100627|ref|NP_694094.1| serine proteinase inhibitor [Oceano... 134 5e-30
gi|16226025|gb|AAL16057.1| serine proteinase inhibitor SERPINB11... 134 5e-30
gi|3183086|sp|Q90935|NEUS_CHICK Neuroserpin precursor (Axonin-2)... 134 5e-30
gi|50752506|ref|XP_422809.1| PREDICTED: similar to neuroserpin [... 134 5e-30
gi|32450604|gb|AAH54232.1| MGC64421 protein [Xenopus laevis] 133 6e-30
gi|7522623|pir||JC7118 headpin serine proteinase inhibitor - hum... 133 6e-30
gi|25140429|gb|AAN71634.1| serine protease inhibitor serpin 1c [... 133 6e-30
gi|37681941|gb|AAQ97848.1| serine proteinase inhibitor, clade B,... 133 6e-30
gi|119509|sp|Q00387|EP45_XENLA ESTROGEN-REGULATED PROTEIN EP45 P... 133 6e-30
gi|3205171|dbj|BAA28760.1| ATS-22 [Oryctolagus cuniculus] 133 8e-30
gi|6018510|emb|CAA04937.1| hurpin [Homo sapiens] 133 8e-30
gi|15277553|gb|AAH12874.1| Serpina1b protein [Mus musculus] 133 8e-30
gi|6685945|sp|Q60396|SI24_APOSY Serine proteinase inhibitor 2.4 ... 132 1e-29
gi|13537194|dbj|BAB40773.1| SCCA2b [Homo sapiens] 132 1e-29
gi|22507353|ref|NP_683744.1| serine proteinase inhibitor member ... 132 1e-29
gi|8393956|ref|NP_036529.1| serine (or cysteine) proteinase inhi... 132 1e-29
gi|20092202|ref|NP_618277.1| serine protease inhibitor [Methanos... 132 2e-29
gi|862467|dbj|BAA06909.1| limulus intracellular coagulation inhi... 131 2e-29
gi|21429884|gb|AAM50620.1| GH09216p [Drosophila melanogaster] 131 2e-29
gi|177809|gb|AAA51543.1| alpha-1-antichymotrypsin 131 2e-29
gi|2133935|pir||I50494 serine proteinase inhibitor CP9 - common ... 131 2e-29
gi|24582753|ref|NP_524957.2| CG8137-PA [Drosophila melanogaster]... 131 3e-29
gi|38073715|ref|XP_138237.2| hypothetical protein XP_138237 [Mus... 131 3e-29
gi|50748646|ref|XP_421341.1| PREDICTED: similar to Serine (or cy... 131 3e-29
gi|57233|emb|CAA34407.1| unnamed protein product [Rattus norvegi... 131 3e-29
gi|47523844|ref|NP_999560.1| similar to serine (or cysteine) pro... 131 3e-29
gi|6678095|ref|NP_033279.1| serine (or cysteine) proteinase inhi... 130 4e-29
gi|6572145|emb|CAB63097.1| serine protease inhibitor (serpin-2) ... 130 4e-29
gi|112884|sp|P22325|A1AS_CAVPO Alpha-1-antiproteinase S precurso... 130 4e-29
gi|21355737|ref|NP_652024.1| CG11331-PA [Drosophila melanogaster... 130 4e-29
gi|115852|sp|P23775|CBG_RABIT Corticosteroid-binding globulin (C... 130 4e-29
gi|6686381|sp|O54758|ALMS_TAMSI Alpha-1-antitrypsin-like protein... 130 4e-29
gi|15489078|gb|AAH13651.1| Serine (or cysteine) proteinase inhib... 130 5e-29
gi|6678093|ref|NP_033278.1| serine (or cysteine) proteinase inhi... 130 5e-29
gi|34881479|ref|XP_222494.2| similar to squamous cell carcinoma ... 130 5e-29
gi|40645286|dbj|BAD06478.1| alpha1-antitrypsin-like protein [Tam... 130 5e-29
gi|33504509|ref|NP_878283.1| serine (or cysteine) proteinase inh... 130 7e-29
gi|27807517|ref|NP_777214.1| serine (or cysteine) proteinase inh... 130 7e-29
gi|29612515|gb|AAH49975.1| BC049975 protein [Mus musculus] 130 7e-29
gi|30519704|emb|CAD90255.1| alpha-1-antiproteinase-like protein ... 130 7e-29
gi|225769|prf||1313184C chymotrypsin inhibitor 130 7e-29
gi|20346068|ref|XP_111521.1| similar to SPI3C [Mus musculus] 129 9e-29
gi|1083848|pir||JX0346 alpha-1-antiproteinase precursor - Mongol... 129 9e-29
gi|27685295|ref|XP_225269.1| similar to serine (or cysteine) pro... 129 9e-29
gi|1078956|pir||A55533 intracellular coagulation inhibitor type ... 129 1e-28
gi|112875|sp|P22324|A1AF_CAVPO Alpha-1-antiproteinase F precurso... 129 1e-28
gi|17366190|sp|O54763|A1AT_CALCN Alpha-1-antiproteinase precurso... 129 1e-28
gi|92743|pir||S08102 serine proteinase inhibitor 1 - rat >gnl|BL... 129 2e-28
gi|116960|sp|P22323|COTR_CAVPO Serine proteinase inhibitor A3K p... 129 2e-28
gi|2507387|sp|P05544|CPI3_RAT Contrapsin-like protease inhibitor... 129 2e-28
gi|6680586|ref|NP_032484.1| serine (or cysteine) proteinase inhi... 128 2e-28
gi|5734506|emb|CAB52710.1| serpin [Triticum aestivum] 128 2e-28
gi|4090872|gb|AAD09285.1| putative serpin [Hyphantria cunea] >gn... 128 3e-28
gi|47225177|emb|CAF98804.1| unnamed protein product [Tetraodon n... 128 3e-28
gi|27777657|ref|NP_776249.1| serine (or cysteine) proteinase inh... 128 3e-28
gi|50734133|ref|XP_418981.1| PREDICTED: similar to MGC64421 prot... 127 4e-28
gi|47523270|ref|NP_998952.1| alpha-1-antichymotrypsin 2 [Sus scr... 127 5e-28
gi|21483500|gb|AAM52725.1| LP08647p [Drosophila melanogaster] 127 5e-28
gi|17933714|ref|NP_524805.1| CG12172-PA [Drosophila melanogaster... 127 5e-28
gi|18426822|ref|NP_569088.1| serine (or cysteine) proteinase inh... 127 5e-28
gi|31199799|ref|XP_308847.1| ENSANGP00000021651 [Anopheles gambi... 126 8e-28
gi|30584889|gb|AAP36700.1| Homo sapiens serine (or cysteine) pro... 126 8e-28
gi|494175|pdb|1HLE|A Chain A, Horse Leukocyte Elastase Inhibitor... 126 8e-28
gi|4758906|ref|NP_004146.1| serine (or cysteine) proteinase inhi... 126 8e-28
gi|47169560|tpe|CAE51415.1| TPA: serine proteinase inhibitor B3-... 126 8e-28
gi|443345|pdb|2ACH|A Chain A, Alpha1 Antichymotrypsin 126 8e-28
gi|14028769|gb|AAK52495.1| chymotrypsin inhibitor CI-8A [Bombyx ... 126 1e-27
gi|2094884|emb|CAA72915.1| serine protease inhibitor-like protei... 126 1e-27
gi|6686808|emb|CAB64714.1| antithrombin [Salmo salar] 125 1e-27
gi|17223662|gb|AAK61375.1| serine proteinase inhibitor serpin-1 ... 125 2e-27
gi|15826848|ref|NP_035589.1| serine (or cysteine) proteinase inh... 125 2e-27
gi|50734142|ref|XP_418984.1| PREDICTED: similar to ovalbumin-rel... 125 2e-27
gi|223433|prf||0805684B inhibitor,alpha1 protease 125 2e-27
gi|12621138|ref|NP_075246.1| protein C inhibitor [Rattus norvegi... 125 2e-27
gi|40645284|dbj|BAD06477.1| alpha1-antitrypsin-like protein [Tam... 125 2e-27
gi|37182522|gb|AAQ89063.1| ASYL692 [Homo sapiens] 124 3e-27
gi|2982150|pdb|3CAA|A Chain A, Cleaved Antichymotrypsin A347r 124 3e-27
gi|2982038|pdb|1AS4|A Chain A, Cleaved Antichymotrypsin A349r 124 3e-27
gi|34875374|ref|XP_214459.2| similar to serine (or cysteine) pro... 124 3e-27
gi|2982165|pdb|4CAA|A Chain A, Cleaved Antichymotrypsin T345r 124 4e-27
gi|1195581|gb|AAB35653.1| antithrombin; AT-III [Gallus gallus] 124 4e-27
gi|12834891|dbj|BAB23079.1| unnamed protein product [Mus musculu... 124 4e-27
gi|2094882|emb|CAA72914.1| serine protease inhibitor-like protei... 124 4e-27
gi|20859253|ref|XP_138240.1| similar to hypothetical protein A03... 124 4e-27
gi|29165290|gb|AAO65242.1| germinal center B-cell expressed tran... 124 5e-27
gi|6686380|sp|O54757|ALMM_TAMSI Alpha-1-antitrypsin-like protein... 124 5e-27
gi|6435591|pdb|1BY7|A Chain A, Human Plasminogen Activator Inhib... 124 5e-27
gi|12843390|dbj|BAB25964.1| unnamed protein product [Mus musculus] 123 7e-27
gi|5734504|emb|CAB52709.1| serpin [Triticum aestivum] 123 7e-27
gi|38541769|gb|AAH62869.1| Serpina1 protein [Danio rerio] >gnl|B... 123 9e-27
gi|27733415|gb|AAO21505.1| serpin 3a [Manduca sexta] >gnl|BL_ORD... 123 9e-27
gi|112890|sp|P12725|A1AT_SHEEP Alpha-1-antiproteinase precursor ... 122 1e-26
gi|26345114|dbj|BAC36206.1| unnamed protein product [Mus musculus] 122 1e-26
gi|22024059|ref|NP_610245.2| CG9455-PA [Drosophila melanogaster]... 122 1e-26
gi|2130110|pir||S65782 serpin - wheat >gnl|BL_ORD_ID|980271 gi|8... 122 1e-26
gi|27806941|ref|NP_776307.1| serine (or cysteine) proteinase inh... 122 1e-26
gi|7245932|pdb|1QMB|A Chain A, Cleaved Alpha-1-Antitrypsin Polymer 122 1e-26
gi|48141072|ref|XP_393539.1| similar to serpin 4 [Apis mellifera] 122 1e-26
gi|34935456|ref|XP_234512.2| similar to Alpha-1-antitrypsin-rela... 122 1e-26
gi|34881548|ref|XP_343824.1| serine (or cysteine) proteinase inh... 122 2e-26
gi|576007|pdb|1ATT|B Chain B, Antithrombin Iii (Atiii) (Synchrot... 122 2e-26
gi|7438218|pir||T06183 serpin - barley >gnl|BL_ORD_ID|130748 gi|... 122 2e-26
gi|1168462|sp|P41361|ANT3_BOVIN Antithrombin-III (ATIII) >gnl|BL... 122 2e-26
gi|45382463|ref|NP_990228.1| heterochromatin-associated protein ... 122 2e-26
gi|207160|gb|AAA42205.1| thyroxine-binding globulin 122 2e-26
gi|7438222|pir||T06597 serpin homolog WZS3 - wheat >gnl|BL_ORD_I... 121 3e-26
gi|13385352|ref|NP_080143.1| serine (or cysteine) proteinase inh... 121 3e-26
gi|45384240|ref|NP_990622.1| heat shock protein 47 [Gallus gallu... 121 3e-26
gi|34878872|ref|XP_222495.2| similar to RIKEN cDNA 2310046M08 [R... 121 3e-26
gi|21429880|gb|AAM50618.1| GH08778p [Drosophila melanogaster] 121 3e-26
gi|41053961|ref|NP_956230.1| Unknown (protein for MGC:64178); wu... 121 3e-26
gi|13386038|ref|NP_080811.1| visceral adipose-specific SERPIN; v... 121 3e-26
gi|47210867|emb|CAF92600.1| unnamed protein product [Tetraodon n... 121 3e-26
gi|15022803|ref|NP_035583.1| serine (or cysteine) proteinase inh... 121 3e-26
gi|38073726|ref|XP_138241.2| similar to hypothetical protein A03... 121 3e-26
gi|32816046|gb|AAP88383.1| visceral adipose-specific SERPIN [Mus... 121 3e-26
gi|16307529|gb|AAH10313.1| Serine (or cysteine) proteinase inhib... 120 4e-26
gi|11514321|pdb|1EZX|A Chain A, Crystal Structure Of A Serpin:pr... 120 4e-26
gi|27685293|ref|XP_225268.1| similar to serine (or cysteine) pro... 120 4e-26
gi|23100626|ref|NP_694093.1| serine proteinase inhibitor [Oceano... 120 4e-26
gi|231240|pdb|7API|A Chain A, Modified Alpha1-Antitrypsin (Modif... 120 4e-26
gi|7546268|pdb|1D5S|A Chain A, Crystal Structure Of Cleaved Anti... 120 4e-26
gi|27413904|ref|NP_766640.1| serine (or cysteine) proteinase inh... 120 4e-26
gi|2804193|dbj|BAA24421.1| alpha,-antitrypsin-like protein [Sper... 120 4e-26
gi|15079234|gb|AAH11217.1| Serine (or cysteine) proteinase inhib... 120 6e-26
gi|33859636|ref|NP_035588.1| serine (or cysteine) proteinase inh... 120 6e-26
gi|20858957|ref|XP_127127.1| similar to contraspin [Mus musculus... 120 7e-26
gi|16741103|gb|AAH16407.1| Serine (or cysteine) proteinase inhib... 120 7e-26
gi|18044689|gb|AAH19802.1| Serine (or cysteine) proteinase inhib... 120 7e-26
gi|46559749|ref|NP_808588.2| thyroxine-binding globulin; alpha-1... 120 7e-26
gi|34867677|ref|XP_216782.2| similar to serine protease inhibito... 120 7e-26
gi|34935467|ref|XP_234496.2| hypothetical protein XP_234496 [Rat... 120 7e-26
gi|38328425|gb|AAH62143.1| Visceral adipose-specific SERPIN [Mus... 120 7e-26
gi|6686382|sp|O54759|ALST_TAMSI Alpha-1-antitrypsin-like protein... 120 7e-26
gi|4507377|ref|NP_000345.1| serine (or cysteine) proteinase inhi... 119 1e-25
gi|15826578|pdb|1JTI|A Chain A, Loop-Inserted Structure Of P1-P1... 119 1e-25
gi|21361302|ref|NP_006206.2| serine (or cysteine) proteinase inh... 119 1e-25
gi|42662201|dbj|BAD11156.1| serpin-2 [Haemaphysalis longicornis] 119 1e-25
gi|28375497|emb|CAD66567.1| unnamed protein product [Homo sapiens] 119 1e-25
gi|112887|sp|P26595|A1AT_MUSCR Alpha-1-antiproteinase precursor ... 119 1e-25
gi|50734139|ref|XP_418983.1| PREDICTED: similar to ovalbumin-rel... 119 1e-25
gi|129296|sp|P01014|OVAY_CHICK Gene Y protein (Ovalbumin-related... 119 1e-25
gi|178751|gb|AAA35543.1| alpha-2-antiplasmin precursor 119 1e-25
gi|1708609|sp|P29622|KAIN_HUMAN Kallistatin precursor (Kallikrei... 119 1e-25
gi|1378128|gb|AAC47338.1| serpin 1 119 1e-25
gi|21228777|ref|NP_634699.1| Serine protease inhibitor [Methanos... 119 1e-25
gi|18252782|ref|NP_543120.1| serine (or cysteine) proteinase inh... 119 1e-25
gi|6686383|sp|O54760|ALSI_TAMSI Alpha-1-antitrypsin-like protein... 119 1e-25
gi|1351236|sp|P05543|THBG_HUMAN Thyroxine-binding globulin precu... 119 2e-25
gi|48428572|sp|P61640|THBG_PANTR Thyroxine-binding globulin prec... 119 2e-25
gi|31340900|ref|NP_777193.2| serine (or cysteine) proteinase inh... 119 2e-25
gi|3136338|gb|AAC16664.1| ovalbumin [Meleagris gallopavo] 119 2e-25
gi|1705661|sp|P49920|CBG_SHEEP Corticosteroid-binding globulin p... 119 2e-25
gi|477547|pir||A49190 corticosteroid-binding globulin - sheep 119 2e-25
gi|42476312|ref|NP_714955.2| serine (or cysteine) proteinase inh... 119 2e-25
gi|21309939|gb|AAM46107.1| alpha-1-antitrypsin [Sphenodon puncta... 119 2e-25
gi|1082955|pir||JX0364 antithrombin III - pig 119 2e-25
gi|11386143|ref|NP_000925.1| alpha-2-plasmin inhibitor; alpha-2-... 119 2e-25
gi|112907|sp|P08697|A2AP_HUMAN Alpha-2-antiplasmin precursor (Al... 119 2e-25
gi|21594846|gb|AAH31592.1| Alpha-2-plasmin inhibitor [Homo sapiens] 119 2e-25
gi|50442|emb|CAA38948.1| contrapsin [Mus musculus] 118 2e-25
gi|18140913|gb|AAL60465.1| antithrombin [Struthio camelus] 118 2e-25
gi|50734136|ref|XP_418982.1| PREDICTED: similar to plasminogen a... 118 2e-25
gi|38504669|ref|NP_942130.1| serine (or cysteine) proteinase inh... 118 2e-25
gi|33096781|emb|CAE11879.1| hypothetical protein [Homo sapiens] 118 2e-25
gi|1709895|sp|P50452|SPB8_HUMAN Cytoplasmic antiproteinase 2 (CA... 118 2e-25
gi|416622|sp|P32262|ANT3_SHEEP Antithrombin-III precursor (ATIII... 118 3e-25
gi|19922006|ref|NP_610633.1| CG7722-PA [Drosophila melanogaster]... 118 3e-25
gi|21490001|ref|NP_659565.1| kallistatin [Rattus norvegicus] >gn... 117 4e-25
gi|50748652|ref|XP_421344.1| PREDICTED: similar to alpha-1-antit... 117 4e-25
gi|28566340|gb|AAO43266.1| ovalbumin [Gallus gallus] 117 4e-25
gi|47224820|emb|CAG06390.1| unnamed protein product [Tetraodon n... 117 4e-25
gi|4502595|ref|NP_001747.1| corticosteroid binding globulin prec... 117 4e-25
gi|4505149|ref|NP_003775.1| serine (or cysteine) proteinase inhi... 117 4e-25
gi|223299|prf||0705172A ovalbumin 117 5e-25
gi|129293|sp|P01012|OVAL_CHICK Ovalbumin (Plakalbumin) (Allergen... 117 5e-25
gi|45384056|ref|NP_990483.1| ovalbumin [Gallus gallus] >gnl|BL_O... 117 5e-25
gi|230201|pdb|1OVA|A Chain A, Ovalbumin (Egg Albumin) >gnl|BL_OR... 117 5e-25
gi|50734186|ref|XP_426040.1| PREDICTED: similar to heterochromat... 117 5e-25
gi|4774082|dbj|BAA77461.1| antithrombin III [Takifugu rubripes] 117 5e-25
gi|34878875|ref|XP_222490.2| similar to NK10 [Rattus norvegicus] 117 6e-25
gi|18140915|gb|AAL60466.1| antithrombin [Chelydra serpentina] 117 6e-25
gi|38073721|ref|XP_194860.2| hypothetical protein XP_194860 [Mus... 117 6e-25
gi|21717801|ref|NP_620180.1| OL-64 protein [Rattus norvegicus] >... 117 6e-25
gi|33604191|gb|AAH56259.1| Corticosteroid binding globulin, prec... 117 6e-25
gi|16506824|ref|NP_081824.1| serine (or cysteine) proteinase inh... 117 6e-25
gi|39793873|gb|AAH64004.1| Serine (or cysteine) proteinase inhib... 117 6e-25
gi|576006|pdb|1ATT|A Chain A, Antithrombin Iii (Atiii) (Synchrot... 117 6e-25
gi|34878795|ref|XP_222497.2| similar to hypothetical protein 543... 116 8e-25
gi|1078955|pir||A53120 intracellular coagulation inhibitor LICI ... 116 1e-24
gi|535509|gb|AAA50448.1| alpha1-antichymotrypsin isoform pHHK12 116 1e-24
gi|34811330|pdb|1UHG|A Chain A, Crystal Structure Of S-Ovalbumin... 116 1e-24
gi|348255|pir||S31505 serine proteinase inhibitor 2.4 - rat (fra... 116 1e-24
gi|1705660|sp|P50451|CBG_SAISC Corticosteroid-binding globulin p... 115 1e-24
gi|18858869|ref|NP_571279.1| heat shock protein 47 [Danio rerio]... 115 2e-24
gi|4505595|ref|NP_002566.1| serine (or cysteine) proteinase inhi... 115 2e-24
gi|25310862|pir||A84646 probable serpin [imported] - Arabidopsis... 115 2e-24
gi|27370288|ref|NP_766440.1| serine (or cysteine) proteinase inh... 115 2e-24
gi|189545|gb|AAA36413.1| plasminogen activator inhibitor >gnl|BL... 115 2e-24
gi|48425163|pdb|1OYH|I Chain I, Crystal Structure Of P13 Alanine... 115 2e-24
gi|1729928|sp|P50450|THBG_SHEEP Thyroxine-binding globulin precu... 115 2e-24
gi|38569436|ref|NP_932145.2| serine (or cysteine) proteinase inh... 115 2e-24
gi|17998551|ref|NP_536722.1| serine (or cysteine) proteinase inh... 115 2e-24
gi|45238335|emb|CAD12372.2| serpin-like protease inhibitor [Echi... 115 2e-24
gi|999513|pdb|1ATH|A Chain A, Antithrombin Iii >gnl|BL_ORD_ID|16... 114 3e-24
gi|999514|pdb|1ATH|B Chain B, Antithrombin Iii 114 3e-24
gi|11067431|ref|NP_067728.1| plasminogen activator inhibitor 2 t... 114 3e-24
gi|46395464|ref|NP_766639.1| serine (or cysteine) proteinase inh... 114 3e-24
gi|4502261|ref|NP_000479.1| serine (or cysteine) proteinase inhi... 114 3e-24
gi|47522932|ref|NP_999223.1| thyroxine-binding globulin [Sus scr... 114 3e-24
gi|21913559|gb|AAL78042.1| transforming growth factor beta repre... 114 3e-24
gi|6002112|emb|CAB56697.1| serpin, putative [Drosophila melanoga... 114 3e-24
gi|37700305|gb|AAR00595.1| putative serpin [Oryza sativa (japoni... 114 4e-24
gi|40539102|gb|AAR87358.1| putative serine protease inhibitor [O... 114 4e-24
gi|20988602|gb|AAH29736.1| Serine (or cysteine) proteinase inhib... 114 5e-24
gi|576554|dbj|BAA06212.1| antithrombin III variant [Homo sapiens] 114 5e-24
gi|416561|sp|P32759|A1AT_CYPCA Alpha-1-antitrypsin homolog precu... 113 7e-24
gi|27807209|ref|NP_777095.1| alpha-2-plasmin inhibitor [Bos taur... 113 7e-24
gi|45526413|ref|ZP_00177618.1| COG4826: Serine protease inhibito... 113 7e-24
gi|20091086|ref|NP_617161.1| squamous cell carcinoma antigen [Me... 113 7e-24
gi|17864502|ref|NP_524851.1| CG1857-PA [Drosophila melanogaster]... 113 7e-24
gi|47939314|gb|AAH71301.1| Hsp47 protein [Danio rerio] 113 7e-24
gi|7341330|gb|AAF61252.1| serpin-2 [Bombyx mori] 113 7e-24
gi|16923954|ref|NP_476449.1| serine (or cysteine) proteinase inh... 113 9e-24
gi|1310677|emb|CAA66232.1| protein z-type serpin [Hordeum vulgar... 113 9e-24
gi|46446353|ref|YP_007718.1| putative serine protease [Parachlam... 113 9e-24
gi|90280|pir||JH0493 alpha-1-antichymotrypsin-like protein EB22/... 112 1e-23
gi|8569387|pdb|1DZH|I Chain I, P14-Fluorescein-N135q-S380c-Antit... 112 1e-23
gi|207042|gb|AAA42172.1| serine protease inhibitor 1 112 1e-23
gi|17942678|pdb|1K9O|I Chain I, Crystal Structure Of Michaelis S... 112 1e-23
gi|20141080|sp|Q09055|HP55_TAMSI Hibernation specific plasma pro... 112 1e-23
gi|15214956|gb|AAH12609.1| Serine (or cysteine) proteinase inhib... 112 2e-23
gi|2398729|emb|CAA04047.1| serpin [Mus musculus] 112 2e-23
gi|8569385|pdb|1DZG|I Chain I, N135q-S380c-Antithrombin-Iii 112 2e-23
gi|27881769|gb|AAH44329.1| Hsp47-prov protein [Xenopus laevis] 112 2e-23
gi|29165294|gb|AAO65244.1| germinal center B-cell expressed tran... 112 2e-23
gi|24582532|ref|NP_609128.1| CG6717-PA [Drosophila melanogaster]... 112 2e-23
gi|416571|sp|Q03383|ACH1_BOMMO Antichymotrypsin I precursor (ACH... 112 2e-23
gi|18140917|gb|AAL60467.1| antithrombin [Xenopus laevis] >gnl|BL... 112 2e-23
gi|30354039|gb|AAH51664.1| Serpinb9c protein [Mus musculus] 111 3e-23
gi|41053947|ref|NP_956235.1| Unknown (protein for MGC:77645); wu... 111 3e-23
gi|18478579|gb|AAL73207.1| antithrombin III [Sphenodon punctatus] 111 3e-23
gi|47222690|emb|CAG00124.1| unnamed protein product [Tetraodon n... 111 3e-23
gi|20807990|ref|NP_623161.1| serine protease inhibitor [Thermoan... 110 4e-23
gi|179161|gb|AAA51796.1| antithrombin III 110 4e-23
gi|4826902|ref|NP_005015.1| serine (or cysteine) proteinase inhi... 110 4e-23
gi|40217254|emb|CAD58653.1| C1 inhibitor [Oncorhynchus mykiss] 110 6e-23
gi|4505789|ref|NP_002630.1| serine (or cysteine) proteinase inhi... 110 6e-23
gi|27807205|ref|NP_777093.1| serine (or cysteine) proteinase inh... 110 6e-23
gi|7438221|pir||T06488 serpin WZS2 - wheat >gnl|BL_ORD_ID|182711... 110 6e-23
gi|134436|sp|P14754|SERA_MANSE Alaserpin precursor (Serpin 1) >g... 110 6e-23
gi|2149091|gb|AAB58491.1| serpin-2 [Manduca sexta] 110 6e-23
gi|112498|pir||B39088 alpha-1-antiproteinase F precursor - guine... 110 8e-23
gi|34334933|gb|AAQ64953.1| Spn43Ac [Drosophila melanogaster] 110 8e-23
gi|34334929|gb|AAQ64951.1| Spn43Ac [Drosophila melanogaster] 110 8e-23
gi|4699766|pdb|1SEK| The Structure Of Active Serpin K From Mand... 110 8e-23
gi|4884500|dbj|BAA77781.1| antithrombin III [Cavia porcellus] 110 8e-23
gi|1378129|gb|AAC47339.1| serpin 1 109 1e-22
gi|23113227|ref|ZP_00098622.1| COG4826: Serine protease inhibito... 109 1e-22
gi|31199795|ref|XP_308845.1| ENSANGP00000021812 [Anopheles gambi... 109 1e-22
gi|33590487|gb|AAQ22769.1| ovalbumin [Coturnix coturnix] 109 1e-22
gi|34875501|ref|XP_225265.2| similar to SPI3C [Rattus norvegicus] 109 1e-22
gi|6678103|ref|NP_033283.1| serine (or cysteine) proteinase inhi... 109 1e-22
gi|27370538|ref|NP_766612.1| hypothetical protein A030003A19 [Mu... 109 1e-22
gi|34334927|gb|AAQ64950.1| Spn43Ac [Drosophila melanogaster] 109 1e-22
gi|34334937|gb|AAQ64955.1| Spn43Ac [Drosophila melanogaster] 109 1e-22
gi|28207867|emb|CAD62587.1| unnamed protein product [Homo sapiens] 108 2e-22
gi|6755098|ref|NP_035241.1| serine (or cysteine) proteinase inhi... 108 2e-22
gi|201038|gb|AAA40129.1| spi2 proteinase inhibitor 108 2e-22
gi|1378125|gb|AAC47335.1| serpin 1 108 2e-22
gi|29165296|gb|AAO65245.1| germinal center B-cell expressed tran... 108 2e-22
gi|1378124|gb|AAC47334.1| serpin 1 108 2e-22
gi|431347|gb|AAA29334.1| serine protease inhibitor 108 2e-22
gi|37545994|ref|XP_170754.3| similar to serine (or cysteine) pro... 108 2e-22
gi|34334925|gb|AAQ64949.1| Spn43Ac [Drosophila melanogaster] 108 2e-22
gi|47169532|tpe|CAE51401.1| TPA: serine protease inhibitor B3 [R... 108 2e-22
gi|34334941|gb|AAQ64957.1| Spn43Ac [Drosophila melanogaster] 108 2e-22
gi|34334939|gb|AAQ64956.1| Spn43Ac [Drosophila melanogaster] 108 2e-22
gi|12018164|gb|AAG45431.1| corticosteroid binding globulin precu... 108 2e-22
gi|34334943|gb|AAQ64958.1| Spn43Ac [Drosophila melanogaster] 108 3e-22
gi|1378126|gb|AAC47336.1| serpin 1 108 3e-22
gi|28193194|emb|CAD62339.1| unnamed protein product [Homo sapiens] 108 3e-22
gi|34334931|gb|AAQ64952.1| Spn43Ac [Drosophila melanogaster] 108 3e-22
gi|34334935|gb|AAQ64954.1| Spn43Ac [Drosophila melanogaster] 108 3e-22
gi|7705879|ref|NP_057270.1| serine (or cysteine) proteinase inhi... 108 3e-22
gi|45550666|ref|NP_649205.3| CG6680-PA [Drosophila melanogaster]... 108 3e-22
gi|18158628|pdb|1JJO|C Chain C, Crystal Structure Of Mouse Neuro... 107 4e-22
gi|129294|sp|P19104|OVAL_COTJA Ovalbumin >gnl|BL_ORD_ID|1929212 ... 107 4e-22
gi|37182316|gb|AAQ88960.1| SERPINA10 [Homo sapiens] 107 4e-22
gi|15489028|gb|AAH13632.1| Serine (or cysteine) proteinase inhib... 107 4e-22
>gi|17563482|ref|NP_503315.1| serpin (srp-1) [Caenorhabditis elegans]
gi|25294066|pir||A88940 protein C05E4.3 [imported] - Caenorhabditis
elegans
gi|2435565|gb|AAB71272.1| Serpin protein 1 [Caenorhabditis elegans]
gi|42405399|gb|AAS13527.1| serine or cysteine protease inhibitor
[Caenorhabditis elegans]
Length = 366
Score = 723 bits (1866), Expect = 0.0
Identities = 366/366 (100%), Positives = 366/366 (100%)
Frame = +1
Query: 1 MSFSLINSTFTEAQFGIKLLSDLTSDQLTPCVFSPVSILLSLALVHLGAKGHTRHDIRNS 180
MSFSLINSTFTEAQFGIKLLSDLTSDQLTPCVFSPVSILLSLALVHLGAKGHTRHDIRNS
Sbjct: 1 MSFSLINSTFTEAQFGIKLLSDLTSDQLTPCVFSPVSILLSLALVHLGAKGHTRHDIRNS 60
Query: 181 VVNGSTDEQFIEHFSFINKLLNSSVNDVETLIANRLFVSPEQAIRKAFTDELREHYNAET 360
VVNGSTDEQFIEHFSFINKLLNSSVNDVETLIANRLFVSPEQAIRKAFTDELREHYNAET
Sbjct: 61 VVNGSTDEQFIEHFSFINKLLNSSVNDVETLIANRLFVSPEQAIRKAFTDELREHYNAET 120
Query: 361 ATIDFKKSQEAAKIMNQFISESTKGKIPDMIKPDNLKDVDAILINAIFFQGDWRRKFGEP 540
ATIDFKKSQEAAKIMNQFISESTKGKIPDMIKPDNLKDVDAILINAIFFQGDWRRKFGEP
Sbjct: 121 ATIDFKKSQEAAKIMNQFISESTKGKIPDMIKPDNLKDVDAILINAIFFQGDWRRKFGEP 180
Query: 541 AESNFSISATENRLVPMLRETRDYFYNKDDEWQVIGIPFKDKSAWFAIFLPTRRFALAEN 720
AESNFSISATENRLVPMLRETRDYFYNKDDEWQVIGIPFKDKSAWFAIFLPTRRFALAEN
Sbjct: 181 AESNFSISATENRLVPMLRETRDYFYNKDDEWQVIGIPFKDKSAWFAIFLPTRRFALAEN 240
Query: 721 LKSLNAAKFHNLINNVYQEYIFLTFPKFKMDYKINLKTALAKFGLAELFTEQADLSGIGP 900
LKSLNAAKFHNLINNVYQEYIFLTFPKFKMDYKINLKTALAKFGLAELFTEQADLSGIGP
Sbjct: 241 LKSLNAAKFHNLINNVYQEYIFLTFPKFKMDYKINLKTALAKFGLAELFTEQADLSGIGP 300
Query: 901 GLQLASATHQALIEVDQVGTRAAAATEAKIFFTSASSDEPLHIRVDHPFLFAIIKDNSPL 1080
GLQLASATHQALIEVDQVGTRAAAATEAKIFFTSASSDEPLHIRVDHPFLFAIIKDNSPL
Sbjct: 301 GLQLASATHQALIEVDQVGTRAAAATEAKIFFTSASSDEPLHIRVDHPFLFAIIKDNSPL 360
Query: 1081 FLGTYT 1098
FLGTYT
Sbjct: 361 FLGTYT 366