Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C08E3_2
(636 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|7495668|pir||T32354 hypothetical protein C08E3.4 - Caenorhabd... 428 e-119
gi|32564809|ref|NP_494008.2| putative cytoplasmic protein family... 359 2e-98
gi|17531633|ref|NP_494010.1| cyclin-like F-box and Protein of un... 228 1e-58
gi|17531631|ref|NP_494009.1| cyclin-like F-box and Protein of un... 145 8e-34
gi|17531635|ref|NP_494012.1| cyclin-like F-box and Protein of un... 139 6e-32
gi|17531641|ref|NP_494015.1| cyclin-like F-box and Protein of un... 138 8e-32
gi|32699248|gb|AAB70969.2| Hypothetical protein C08E3.10 [Caenor... 138 8e-32
gi|17531639|ref|NP_494014.1| putative cytoplasmic protein family... 135 7e-31
gi|17531637|ref|NP_494013.1| cyclin-like F-box and Protein of un... 130 2e-29
gi|17531645|ref|NP_494017.1| predicted CDS, putative cytoplasmic... 130 3e-29
gi|17534061|ref|NP_494052.1| cyclin-like F-box and Protein of un... 116 4e-25
gi|32699249|gb|AAB70963.2| Hypothetical protein C08E3.5 [Caenorh... 111 1e-23
gi|17563966|ref|NP_506963.1| putative cytoplasmic protein family... 103 2e-21
gi|17560554|ref|NP_506398.1| cyclin-like F-box and Protein of un... 91 2e-17
gi|17550870|ref|NP_508309.1| cyclin-like F-box and Protein of un... 91 2e-17
gi|49035104|gb|AAB66207.2| Hypothetical protein F45C12.8 [Caenor... 84 2e-15
gi|49035143|gb|AAB66190.2| Hypothetical protein T07D3.1 [Caenorh... 83 4e-15
gi|17536079|ref|NP_493845.1| putative cytoplasmic protein family... 83 4e-15
gi|17564170|ref|NP_506746.1| cyclin-like F-box and Protein of un... 79 7e-14
gi|7507552|pir||T24767 hypothetical protein T09F5.11 - Caenorhab... 79 7e-14
gi|47606781|sp|Q09336|YOF9_CAEEL Hypothetical protein ZK1290.9 i... 77 3e-13
gi|34555909|emb|CAB07340.2| Hypothetical protein F10A3.2 [Caenor... 77 4e-13
gi|17559464|ref|NP_507065.1| predicted CDS, cyclin-like F-box an... 70 3e-11
gi|17561154|ref|NP_507392.1| cyclin-like F-box and Protein of un... 65 1e-09
gi|17559796|ref|NP_504580.1| putative cytoplasmic protein family... 64 2e-09
gi|17558538|ref|NP_507448.1| predicted CDS, cyclin-like F-box an... 62 1e-08
gi|17561150|ref|NP_507390.1| cyclin-like F-box and Protein of un... 61 2e-08
gi|17555026|ref|NP_497304.1| cyclin-like F-box and Protein of un... 60 3e-08
gi|17564010|ref|NP_506827.1| cyclin-like F-box and Protein of un... 59 8e-08
gi|17540364|ref|NP_500327.1| putative cytoplasmic protein family... 59 8e-08
gi|30145758|emb|CAD89750.1| Hypothetical protein T25E12.12 [Caen... 59 1e-07
gi|17560982|ref|NP_507061.1| protein of unknown function DUF38 a... 59 1e-07
gi|32566983|ref|NP_507232.2| protein of unknown function DUF38 a... 58 2e-07
gi|7508443|pir||T25281 hypothetical protein T25E12.11 - Caenorha... 58 2e-07
gi|17558196|ref|NP_506704.1| predicted CDS, cyclin-like F-box an... 58 2e-07
gi|17542926|ref|NP_500678.1| predicted CDS, cyclin-like F-box an... 57 3e-07
gi|17542918|ref|NP_500676.1| u6 small nuclear RNA (4F695) [Caeno... 57 4e-07
gi|17566368|ref|NP_507277.1| cyclin-like F-box and Protein of un... 57 4e-07
gi|17566392|ref|NP_507290.1| cyclin-like F-box and Protein of un... 56 5e-07
gi|17555602|ref|NP_497448.1| cyclin-like F-box and Protein of un... 55 1e-06
gi|34850041|gb|AAC17005.2| Hypothetical protein F56C3.2 [Caenorh... 55 1e-06
gi|17568223|ref|NP_508255.1| cyclin-like F-box and Protein of un... 55 1e-06
gi|17556202|ref|NP_497534.1| predicted CDS, cyclin-like F-box an... 55 1e-06
gi|17536139|ref|NP_494084.1| predicted CDS, cyclin-like F-box an... 54 2e-06
gi|17565394|ref|NP_506838.1| cyclin-like F-box and Protein of un... 54 2e-06
gi|17534521|ref|NP_494046.1| putative cytoplasmic protein family... 54 2e-06
gi|17566384|ref|NP_507285.1| predicted CDS, cyclin-like F-box an... 54 2e-06
gi|17543462|ref|NP_502641.1| cyclin-like F-box and Protein of un... 54 3e-06
gi|17566380|ref|NP_507283.1| predicted CDS, cyclin-like F-box fa... 54 3e-06
gi|17566378|ref|NP_507282.1| predicted CDS, cyclin-like F-box fa... 54 3e-06
gi|17552578|ref|NP_497512.1| predicted CDS, cyclin-like F-box an... 54 3e-06
gi|17552576|ref|NP_497513.1| cyclin-like F-box and Protein of un... 54 3e-06
gi|17561692|ref|NP_507467.1| putative cytoplasmic protein family... 53 4e-06
gi|17561146|ref|NP_507388.1| cyclin-like F-box and Protein of un... 53 4e-06
gi|17556719|ref|NP_497375.1| predicted CDS, cyclin-like F-box an... 53 6e-06
gi|17555038|ref|NP_497300.1| cyclin-like F-box and Protein of un... 53 6e-06
gi|17556594|ref|NP_497378.1| predicted CDS, cyclin-like F-box an... 53 6e-06
gi|17543930|ref|NP_502739.1| cyclin-like F-box and Protein of un... 53 6e-06
gi|17543752|ref|NP_502778.1| predicted CDS, protein of unknown f... 52 7e-06
gi|17566466|ref|NP_507893.1| cyclin-like F-box and Protein of un... 52 9e-06
gi|17566472|ref|NP_507898.1| cyclin-like F-box and Protein of un... 52 9e-06
gi|17566474|ref|NP_507897.1| cyclin-like F-box and Protein of un... 52 1e-05
gi|17566374|ref|NP_507280.1| cyclin-like F-box and Protein of un... 52 1e-05
gi|17556721|ref|NP_497373.1| predicted CDS, cyclin-like F-box an... 51 2e-05
gi|17566470|ref|NP_507896.1| feminization Of Germline FOG-2, cyc... 51 2e-05
gi|17552766|ref|NP_497124.1| cyclin-like F-box and Protein of un... 51 2e-05
gi|17555028|ref|NP_497303.1| cyclin-like F-box and Protein of un... 51 2e-05
gi|17510067|ref|NP_493019.1| putative protein family member (1M4... 51 2e-05
gi|32698040|emb|CAA21741.2| Hypothetical protein Y47H9C.10 [Caen... 51 2e-05
gi|17558540|ref|NP_507447.1| cyclin-like F-box and Protein of un... 51 2e-05
gi|17556586|ref|NP_497385.1| cyclin-like F-box and Protein of un... 50 3e-05
gi|17566382|ref|NP_507284.1| predicted CDS, putative cytoplasmic... 50 4e-05
gi|17556775|ref|NP_497363.1| predicted CDS, cyclin-like F-box an... 50 4e-05
gi|17531643|ref|NP_494016.1| predicted CDS, putative protein fam... 50 4e-05
gi|17566376|ref|NP_507281.1| cyclin-like F-box and Protein of un... 50 4e-05
gi|17566468|ref|NP_507895.1| cyclin-like F-box and Protein of un... 50 5e-05
gi|33620962|gb|AAB65278.2| Hypothetical protein F17A9.1 [Caenorh... 50 5e-05
gi|17551458|ref|NP_508314.1| cyclin-like F-box and Protein of un... 50 5e-05
gi|17510235|ref|NP_493038.1| cyclin-like F-box and Protein of un... 49 6e-05
gi|17562698|ref|NP_507832.1| predicted CDS, cyclin-like F-box an... 49 6e-05
gi|17563968|ref|NP_506964.1| cyclin-like F-box and Protein of un... 49 6e-05
gi|17561148|ref|NP_507389.1| cyclin-like F-box and Protein of un... 49 8e-05
gi|17556602|ref|NP_497387.1| predicted CDS, protein of unknown f... 49 1e-04
gi|17565048|ref|NP_507824.1| putative cytoplasmic protein family... 48 1e-04
gi|7507718|pir||T33684 hypothetical protein T12B5.12 - Caenorhab... 48 2e-04
gi|17538115|ref|NP_495583.1| cyclin-like F-box and Protein of un... 47 3e-04
gi|17565954|ref|NP_507584.1| cyclin-like F-box and Protein of un... 47 3e-04
gi|32565399|ref|NP_497446.2| cyclin-like F-box and Protein of un... 47 3e-04
gi|17558522|ref|NP_503432.1| predicted CDS, cyclin-like F-box an... 47 3e-04
gi|17564298|ref|NP_507106.1| cyclin-like F-box and Protein of un... 47 3e-04
gi|29570408|gb|AAO91685.1| Hypothetical protein Y22D7AR.9 [Caeno... 47 3e-04
gi|7510785|pir||T27601 hypothetical protein ZC47.12 - Caenorhabd... 47 4e-04
gi|17565402|ref|NP_507537.1| cyclin-like F-box and Protein of un... 46 5e-04
gi|7510795|pir||T27599 hypothetical protein ZC47.9 - Caenorhabdi... 46 5e-04
gi|17556715|ref|NP_497377.1| predicted CDS, cyclin-like F-box an... 46 5e-04
gi|17556779|ref|NP_497368.1| predicted CDS, cyclin-like F-box an... 46 5e-04
gi|32565209|ref|NP_497381.2| cyclin-like F-box and Protein of un... 46 7e-04
gi|17570013|ref|NP_510419.1| cyclin-like F-box and Protein of un... 46 7e-04
gi|17556767|ref|NP_497365.1| predicted CDS, cyclin-like F-box an... 46 7e-04
gi|17556769|ref|NP_497366.1| predicted CDS, cyclin-like F-box an... 46 7e-04
gi|17556773|ref|NP_497364.1| cyclin-like F-box and Protein of un... 46 7e-04
gi|17552570|ref|NP_497515.1| cyclin-like F-box and Protein of un... 45 9e-04
gi|17556755|ref|NP_497358.1| cyclin-like F-box and Protein of un... 45 0.001
gi|17565608|ref|NP_503556.1| predicted CDS, protein of unknown f... 45 0.001
gi|17556598|ref|NP_497382.1| predicted CDS, cyclin-like F-box an... 45 0.001
gi|7496779|pir||T19604 hypothetical protein C31C9.4 - Caenorhabd... 45 0.001
gi|17555196|ref|NP_497523.1| predicted CDS, putative mitochondri... 45 0.002
gi|17555202|ref|NP_497525.1| predicted CDS, putative cytoplasmic... 44 0.002
gi|17556787|ref|NP_497370.1| cyclin-like F-box and Protein of un... 44 0.003
gi|17566080|ref|NP_507530.1| cyclin-like F-box and Protein of un... 44 0.003
gi|17556584|ref|NP_497386.1| cyclin-like F-box and Protein of un... 44 0.003
gi|17558528|ref|NP_507449.1| predicted CDS, cyclin-like F-box an... 44 0.003
gi|17557372|ref|NP_506878.1| cyclin-like F-box and Protein of un... 44 0.003
gi|17550772|ref|NP_510807.1| cyclin-like F-box and Protein of un... 44 0.003
gi|17552568|ref|NP_497516.1| predicted CDS, cyclin-like F-box an... 44 0.003
gi|7510783|pir||T27592 hypothetical protein ZC47.1 - Caenorhabdi... 44 0.003
gi|17556771|ref|NP_497367.1| predicted CDS, cyclin-like F-box an... 43 0.004
gi|17561690|ref|NP_507468.1| cyclin-like F-box and Protein of un... 43 0.004
gi|14530343|emb|CAB07161.2| Hypothetical protein C06H5.1 [Caenor... 43 0.004
gi|7495580|pir||T19028 hypothetical protein C06H5.1 - Caenorhabd... 43 0.004
gi|17566364|ref|NP_507275.1| cyclin-like F-box and Protein of un... 43 0.004
gi|17556588|ref|NP_497384.1| cyclin-like F-box and Protein of un... 43 0.004
gi|17561582|ref|NP_507460.1| cyclin-like F-box and Protein of un... 43 0.006
gi|17567995|ref|NP_508366.1| cyclin-like F-box and Protein of un... 43 0.006
gi|39579643|emb|CAE56642.1| Hypothetical protein CBG24403 [Caeno... 43 0.006
gi|7507723|pir||T33676 hypothetical protein T12B5.5 - Caenorhabd... 42 0.008
gi|17555204|ref|NP_497524.1| predicted CDS, cyclin-like F-box an... 42 0.008
gi|39579646|emb|CAE56645.1| Hypothetical protein CBG24406 [Caeno... 42 0.008
gi|17556717|ref|NP_497376.1| predicted CDS, cyclin-like F-box an... 42 0.008
gi|32565379|ref|NP_497298.2| predicted CDS, putative cytoplasmic... 42 0.008
gi|17565400|ref|NP_507536.1| cyclin-like F-box and Protein of un... 42 0.008
gi|25148588|ref|NP_494270.2| cyclin-like F-box and Protein of un... 42 0.010
gi|7503264|pir||T32285 hypothetical protein F42G2.4 - Caenorhabd... 42 0.010
gi|17556783|ref|NP_497372.1| predicted CDS, cyclin-like F-box an... 42 0.010
gi|32564782|ref|NP_872001.1| cyclin-like F-box and Protein of un... 42 0.010
gi|17556204|ref|NP_497535.1| predicted CDS, cyclin-like F-box an... 42 0.010
gi|17556600|ref|NP_497380.1| predicted CDS, cyclin-like F-box an... 42 0.013
gi|17557722|ref|NP_507510.1| predicted CDS, cyclin-like F-box an... 42 0.013
gi|39579279|emb|CAE56952.1| Hypothetical protein CBG24802 [Caeno... 42 0.013
gi|39590098|emb|CAE61096.1| Hypothetical protein CBG04851 [Caeno... 42 0.013
gi|39587823|emb|CAE67841.1| Hypothetical protein CBG13427 [Caeno... 41 0.017
gi|17560668|ref|NP_507008.1| cyclin-like F-box and Protein of un... 41 0.017
gi|17556785|ref|NP_497371.1| predicted CDS, cyclin-like F-box an... 41 0.017
gi|7510786|pir||T27590 hypothetical protein ZC47.13 - Caenorhabd... 41 0.017
gi|17555040|ref|NP_497302.1| cyclin-like F-box and Protein of un... 41 0.017
gi|7494907|pir||T18734 hypothetical protein B0391.6 - Caenorhabd... 41 0.017
gi|17556590|ref|NP_497383.1| predicted CDS, cyclin-like F-box an... 41 0.022
gi|17557368|ref|NP_506876.1| putative cytoskeletal protein famil... 41 0.022
gi|39587817|emb|CAE67835.1| Hypothetical protein CBG13419 [Caeno... 41 0.022
gi|49035157|gb|AAT48620.1| Hypothetical protein F42G2.4a [Caenor... 41 0.022
gi|49035158|gb|AAT48621.1| Hypothetical protein F42G2.4b [Caenor... 41 0.022
gi|17533287|ref|NP_494269.1| predicted CDS, putative cytoplasmic... 40 0.029
gi|17532541|ref|NP_494091.1| protein of unknown function DUF38 a... 40 0.029
gi|17561152|ref|NP_507391.1| cyclin-like F-box and Protein of un... 40 0.029
gi|17555044|ref|NP_497301.1| predicted CDS, putative cytoplasmic... 40 0.029
gi|45430252|gb|AAC68937.2| Hypothetical protein T12B5.13 [Caenor... 40 0.029
gi|17565426|ref|NP_504572.1| cyclin-like F-box and Protein of un... 40 0.037
gi|39582417|emb|CAE74801.1| Hypothetical protein CBG22632 [Caeno... 40 0.037
gi|39590024|emb|CAE61022.1| Hypothetical protein CBG04764 [Caeno... 40 0.037
gi|17555928|ref|NP_499435.1| putative cytoplasmic protein family... 40 0.049
gi|17505364|ref|NP_492787.1| cyclin-like F-box and Protein of un... 40 0.049
gi|17565404|ref|NP_507538.1| predicted CDS, cyclin-like F-box an... 40 0.049
gi|17536141|ref|NP_494089.1| putative cytoplasmic protein family... 39 0.083
gi|17555024|ref|NP_497305.1| cyclin-like F-box and Protein of un... 38 0.14
gi|17531895|ref|NP_495070.1| putative protein family member (2F8... 38 0.14
gi|17560388|ref|NP_507384.1| cyclin-like F-box and Protein of un... 38 0.14
gi|17570499|ref|NP_508071.1| predicted CDS, cyclin-like F-box an... 38 0.19
gi|17557360|ref|NP_506881.1| cyclin-like F-box and Protein of un... 38 0.19
gi|7494906|pir||T18728 hypothetical protein B0391.5 - Caenorhabd... 38 0.19
gi|39590092|emb|CAE61090.1| Hypothetical protein CBG04843 [Caeno... 37 0.24
gi|32697987|emb|CAE11303.1| Hypothetical protein F28F8.8 [Caenor... 37 0.32
gi|17533921|ref|NP_494273.1| putative cytoplasmic protein family... 34 0.33
gi|17551296|ref|NP_510413.1| predicted CDS, cyclin-like F-box an... 37 0.41
gi|17534375|ref|NP_494659.1| cyclin-like F-box and Protein of un... 37 0.41
gi|17510243|ref|NP_493039.1| cyclin-like F-box and Protein of un... 36 0.54
gi|17551460|ref|NP_508315.1| putative protein family member (XC3... 36 0.54
gi|7510151|pir||T27120 hypothetical protein Y53C10A.8 - Caenorha... 36 0.54
gi|17532195|ref|NP_496870.1| predicted CDS, cyclin-like F-box an... 36 0.54
gi|17561590|ref|NP_507465.1| predicted CDS, cyclin-like F-box an... 36 0.70
gi|17563026|ref|NP_503412.1| predicted CDS, cyclin-like F-box an... 35 0.92
gi|39589945|emb|CAE60943.1| Hypothetical protein CBG04669 [Caeno... 35 0.92
gi|38232156|gb|AAR14915.1| MB2 [Plasmodium berghei] 35 0.92
gi|17557362|ref|NP_506880.1| cyclin-like F-box and Protein of un... 35 0.92
gi|30145722|emb|CAD89725.1| Hypothetical protein B0391.6 [Caenor... 35 0.92
gi|17557364|ref|NP_506879.1| cyclin-like F-box and Protein of un... 35 0.92
gi|7509472|pir||T22376 hypothetical protein Y20C6A.1 - Caenorhab... 35 1.2
gi|17532193|ref|NP_496869.1| cyclin-like F-box and Protein of un... 35 1.2
gi|7504166|pir||T33613 hypothetical protein F54D10.2 - Caenorhab... 35 1.6
gi|32564758|ref|NP_494660.2| putative cytoplasmic protein family... 35 1.6
gi|17565420|ref|NP_507573.1| cyclin-like F-box and Protein of un... 35 1.6
gi|17565408|ref|NP_507540.1| cyclin-like F-box and Protein of un... 35 1.6
gi|17555584|ref|NP_497449.1| predicted CDS, protein of unknown f... 35 1.6
gi|17565364|ref|NP_507203.1| predicted CDS, cyclin-like F-box an... 34 2.0
gi|17564680|ref|NP_507237.1| putative cytoplasmic protein (36.9 ... 34 2.0
gi|39590189|emb|CAE61187.1| Hypothetical protein CBG04960 [Caeno... 34 2.0
gi|17565406|ref|NP_507539.1| predicted CDS, cyclin-like F-box an... 34 2.0
gi|20807840|ref|NP_623011.1| Translation initiation factor 2 (GT... 34 2.7
gi|17532883|ref|NP_496931.1| predicted CDS, putative protein fam... 34 2.7
gi|33300422|emb|CAB07255.2| Hypothetical protein K10G4.5 [Caenor... 33 3.5
gi|17562494|ref|NP_507379.1| cyclin-like F-box and Protein of un... 33 3.5
gi|39579280|emb|CAE56953.1| Hypothetical protein CBG24803 [Caeno... 33 4.6
gi|39590113|emb|CAE61111.1| Hypothetical protein CBG04868 [Caeno... 33 4.6
gi|39580079|emb|CAE56839.1| Hypothetical protein CBG24664 [Caeno... 33 4.6
gi|23100082|ref|NP_693548.1| hypothetical protein OB2627 [Oceano... 33 6.0
gi|39582833|emb|CAE71609.1| Hypothetical protein CBG18569 [Caeno... 33 6.0
gi|39582886|emb|CAE71662.1| Hypothetical protein CBG18634 [Caeno... 33 6.0
gi|17506555|ref|NP_493496.1| cyclin-like F-box and Protein of un... 33 6.0
gi|27764291|emb|CAD60571.1| unnamed protein product [Podospora a... 33 6.0
gi|37532474|ref|NP_920539.1| hypothetical protein [Oryza sativa ... 33 6.0
gi|17532539|ref|NP_494092.1| protein of unknown function DUF38 a... 32 7.8
gi|17560420|ref|NP_503290.1| predicted CDS, putative cytoplasmic... 32 7.8
gi|17568453|ref|NP_510502.1| cyclin-like F-box and Protein of un... 32 7.8
gi|39590048|emb|CAE61046.1| Hypothetical protein CBG04791 [Caeno... 32 7.8
gi|39588617|emb|CAE58141.1| Hypothetical protein CBG01230 [Caeno... 32 7.8
>gi|7495668|pir||T32354 hypothetical protein C08E3.4 -
Caenorhabditis elegans
Length = 211
Score = 428 bits (1101), Expect = e-119
Identities = 211/211 (100%), Positives = 211/211 (100%)
Frame = -1
Query: 636 MSVALCQSELTNRTCILYEVLDKKSIKESFDNFCRKKKSRTKFIAGVGKSLRSAKNLTSK 457
MSVALCQSELTNRTCILYEVLDKKSIKESFDNFCRKKKSRTKFIAGVGKSLRSAKNLTSK
Sbjct: 1 MSVALCQSELTNRTCILYEVLDKKSIKESFDNFCRKKKSRTKFIAGVGKSLRSAKNLTSK 60
Query: 456 TVQTQFVAYPELAQLLPIFPAERLKKLILNGLDGQEYKQLIDLDQWKQARIFHGYAENLI 277
TVQTQFVAYPELAQLLPIFPAERLKKLILNGLDGQEYKQLIDLDQWKQARIFHGYAENLI
Sbjct: 61 TVQTQFVAYPELAQLLPIFPAERLKKLILNGLDGQEYKQLIDLDQWKQARIFHGYAENLI 120
Query: 276 IPIEKFFHFERFDVHLARFTEADALRLRAMIDRSAHFGFAGICCNYMNNSALKRIFNVEH 97
IPIEKFFHFERFDVHLARFTEADALRLRAMIDRSAHFGFAGICCNYMNNSALKRIFNVEH
Sbjct: 121 IPIEKFFHFERFDVHLARFTEADALRLRAMIDRSAHFGFAGICCNYMNNSALKRIFNVEH 180
Query: 96 ENFYQTPDERSFDVQCRPGEISITKFGYTVE 4
ENFYQTPDERSFDVQCRPGEISITKFGYTVE
Sbjct: 181 ENFYQTPDERSFDVQCRPGEISITKFGYTVE 211