Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C09D4_4
(597 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508673|ref|NP_491608.1| ribosomal Protein, Large subunit (2... 276 3e-73
gi|39595569|emb|CAE67070.1| Hypothetical protein CBG12479 [Caeno... 273 1e-72
gi|28200276|gb|AAO31770.1| ribosomal protein L19 [Branchiostoma ... 197 2e-49
gi|40643028|emb|CAD91441.1| ribosomal protein L19 [Crassostrea g... 197 2e-49
gi|28630352|gb|AAN73380.1| ribosomal protein L19 [Branchiostoma ... 197 2e-49
gi|17136322|ref|NP_476631.1| CG2746-PA [Drosophila melanogaster]... 191 9e-48
gi|27819985|gb|AAL28765.2| LD16326p [Drosophila melanogaster] 191 9e-48
gi|1079135|pir||A61627 ribosomal protein L19 - fruit fly (Drosop... 190 1e-47
gi|31209477|ref|XP_313705.1| ENSANGP00000017616 [Anopheles gambi... 190 2e-47
gi|38048301|gb|AAR10053.1| similar to Drosophila melanogaster Rp... 190 2e-47
gi|22758856|gb|AAN05588.1| ribosomal protein L19 [Argopecten irr... 189 3e-47
gi|47086009|ref|NP_998373.1| zgc:77733; 60s ribosomal protein L1... 187 2e-46
gi|15293907|gb|AAK95146.1| ribosomal protein L19 [Ictalurus punc... 185 5e-46
gi|38503331|sp|Q8HXN9|RL19_MACFA 60S ribosomal protein L19 >gnl|... 184 1e-45
gi|27735452|gb|AAH41546.1| Rpl19-prov protein [Xenopus laevis] 184 1e-45
gi|50604184|gb|AAH77657.1| Unknown (protein for MGC:89675) [Xeno... 184 1e-45
gi|31873372|emb|CAD97677.1| hypothetical protein [Homo sapiens] 184 1e-45
gi|6677773|ref|NP_033104.1| ribosomal protein L19 [Mus musculus]... 184 1e-45
gi|4506609|ref|NP_000972.1| ribosomal protein L19; 60S ribosomal... 184 1e-45
gi|48099732|ref|XP_394931.1| similar to CG2746-PA [Apis mellifera] 184 1e-45
gi|49671163|gb|AAH75206.1| Unknown (protein for MGC:84202) [Xeno... 179 3e-44
gi|32401377|gb|AAP80858.1| ribosomal protein L19 [Triticum aesti... 178 8e-44
gi|29837764|gb|AAP05800.1| putative ribosomal protein L19 [Oryza... 176 3e-43
gi|28630344|gb|AAN73379.1| ribosomal protein L19 [Myxine glutinosa] 176 4e-43
gi|19075307|ref|NP_587807.1| 60S ribosomal protein L19B [Schizos... 174 8e-43
gi|19113507|ref|NP_596715.1| 60s ribosomal protein, L19 [Schizos... 174 1e-42
gi|12407954|gb|AAG53669.1| ribosomal protein L19-like protein [T... 173 2e-42
gi|16798651|gb|AAL29467.1| ribosomal protein L19 [Sus scrofa] 172 3e-42
gi|28630180|gb|AAN73354.1| ribosomal protein L19 [Scyliorhinus c... 172 4e-42
gi|15218602|ref|NP_171777.1| 60S ribosomal protein L19 (RPL19A) ... 172 5e-42
gi|7440943|pir||T01426 ribosomal protein L19.T2H3.3 - Arabidopsi... 172 5e-42
gi|44966600|gb|AAS49557.1| ribosomal protein L19 [Protopterus do... 172 5e-42
gi|15235290|ref|NP_192132.1| 60S ribosomal protein L19 (RPL19C) ... 172 5e-42
gi|44966542|gb|AAS49556.1| ribosomal protein L19 [Latimeria chal... 171 7e-42
gi|132736|sp|P14329|RL19_DICDI 60S ribosomal protein L19 (Vegeta... 171 1e-41
gi|44969305|gb|AAS49603.1| ribosomal protein L19 [Gallus gallus] 171 1e-41
gi|40287526|gb|AAR83877.1| 60S ribosomal protein L19 [Capsicum a... 170 2e-41
gi|18087585|gb|AAL58923.1| At1g02780/T14P4_3 [Arabidopsis thaliana] 169 3e-41
gi|42657419|ref|XP_209704.2| similar to hypothetical protein [Ho... 169 4e-41
gi|38104335|gb|EAA50922.1| hypothetical protein MG04681.4 [Magna... 169 5e-41
gi|15228314|ref|NP_188300.1| 60S ribosomal protein L19 (RPL19B) ... 169 5e-41
gi|38085919|ref|XP_141608.3| similar to 60S ribosomal protein L1... 168 6e-41
gi|33772501|gb|AAQ54652.1| 60S ribosomal protein L19 [Oikopleura... 167 1e-40
gi|46136717|ref|XP_390050.1| hypothetical protein FG09874.1 [Gib... 167 1e-40
gi|50553939|ref|XP_504378.1| hypothetical protein [Yarrowia lipo... 167 2e-40
gi|32410357|ref|XP_325659.1| hypothetical protein [Neurospora cr... 167 2e-40
gi|34860179|ref|XP_212945.2| similar to 60S ribosomal protein L1... 166 3e-40
gi|49097034|ref|XP_409977.1| hypothetical protein AN5840.2 [Aspe... 165 5e-40
gi|34856180|ref|XP_212869.2| similar to 60S ribosomal protein L1... 165 5e-40
gi|11276820|pir||T43307 ribosomal protein L19 - fission yeast (S... 165 7e-40
gi|23612225|ref|NP_703805.1| 60S ribosomal protein L19, putative... 165 7e-40
gi|34881295|ref|XP_228526.2| similar to 60S ribosomal protein L1... 165 7e-40
gi|50284963|ref|XP_444910.1| unnamed protein product [Candida gl... 164 1e-39
gi|28630178|gb|AAN73353.1| ribosomal protein L19 [Petromyzon mar... 162 6e-39
gi|50428295|ref|XP_462135.1| unnamed protein product [Debaryomyc... 160 1e-38
gi|6319444|ref|NP_009526.1| Protein component of the large (60S)... 159 5e-38
gi|602897|emb|CAA54504.1| ribosomal protein L19 [Saccharomyces c... 157 2e-37
gi|50256689|gb|EAL19412.1| hypothetical protein CNBH1040 [Crypto... 157 2e-37
gi|49069920|ref|XP_399249.1| hypothetical protein UM01634.1 [Ust... 157 2e-37
gi|50309009|ref|XP_454510.1| unnamed protein product [Kluyveromy... 155 4e-37
gi|45190782|ref|NP_985036.1| AER179Cp [Eremothecium gossypii] >g... 155 7e-37
gi|26224758|gb|AAN76335.1| ribosomal protein L19 [Homo sapiens] ... 154 9e-37
gi|34935672|ref|XP_234722.2| similar to 60S ribosomal protein L1... 150 2e-35
gi|49258854|pdb|1S1I|P Chain P, Structure Of The Ribosomal 80s-E... 145 5e-34
gi|38089085|ref|XP_356062.1| similar to 60S ribosomal protein L1... 145 7e-34
gi|46228346|gb|EAK89245.1| 60S ribosomal protein L19 [Cryptospor... 139 3e-32
gi|47193987|emb|CAG13834.1| unnamed protein product [Tetraodon n... 131 1e-29
gi|38087176|ref|XP_146092.3| similar to 60S ribosomal protein L1... 130 1e-29
gi|34881962|ref|XP_229366.2| similar to 60S ribosomal protein L1... 130 2e-29
gi|13812263|ref|NP_113301.1| 60S ribosomal protein L19 [Guillard... 130 2e-29
gi|34880123|ref|XP_228958.2| similar to ribosomal protein L19 [R... 129 4e-29
gi|34881946|ref|XP_229736.2| similar to 60S ribosomal protein L1... 127 2e-28
gi|34882399|ref|XP_229846.2| similar to ribosomal protein L19 [R... 127 2e-28
gi|50760768|ref|XP_418124.1| PREDICTED: similar to 60S ribosomal... 125 5e-28
gi|34882403|ref|XP_346151.1| similar to 60S ribosomal protein L1... 125 5e-28
gi|34881960|ref|XP_229409.2| similar to 60S ribosomal protein L1... 125 6e-28
gi|29246648|gb|EAA38237.1| GLP_72_20393_19803 [Giardia lamblia A... 125 8e-28
gi|38047805|gb|AAR09805.1| similar to Drosophila melanogaster Rp... 124 1e-27
gi|41146965|ref|XP_373099.1| similar to hypothetical protein [Ho... 124 1e-27
gi|34881972|ref|XP_229350.2| similar to hypothetical protein [Ra... 124 2e-27
gi|34881968|ref|XP_229363.2| similar to 60S ribosomal protein L1... 121 8e-27
gi|5441539|emb|CAB46824.1| Ribosomal protein [Canis familiaris] 117 1e-25
gi|14591516|ref|NP_143597.1| 50S ribosomal protein L19 [Pyrococc... 114 1e-24
gi|34883191|ref|XP_229333.2| similar to 60S ribosomal protein L1... 113 2e-24
gi|19074358|ref|NP_585864.1| 60S RIBOSOMAL PROTEIN L19 [Encephal... 113 3e-24
gi|14520539|ref|NP_126014.1| LSU ribosomal protein L19E [Pyrococ... 112 7e-24
gi|38075573|ref|XP_356705.1| similar to 60S ribosomal protein L1... 110 1e-23
gi|18978178|ref|NP_579535.1| LSU ribosomal protein L19E [Pyrococ... 110 2e-23
gi|10241877|dbj|BAB13702.1| ribosomal protein PfeL19 [Pyrococcus... 109 3e-23
gi|38076109|ref|XP_139014.2| similar to hypothetical protein [Mu... 109 4e-23
gi|20093471|ref|NP_613318.1| Ribosomal protein L19E [Methanopyru... 109 4e-23
gi|34881958|ref|XP_229347.2| similar to 60S ribosomal protein L1... 104 1e-21
gi|34881942|ref|XP_229361.2| similar to 60S ribosomal protein L1... 104 1e-21
gi|34882417|ref|XP_229742.2| similar to 60S ribosomal protein L1... 102 5e-21
gi|45478094|gb|AAS66218.1| LRRGT00127 [Rattus norvegicus] 100 2e-20
gi|34882993|ref|XP_229336.2| similar to Spindlin homolog (Protei... 98 1e-19
gi|11499491|ref|NP_070732.1| LSU ribosomal protein L19E (rpl19E)... 96 4e-19
gi|34879616|ref|XP_223709.2| similar to hypothetical protein [Ra... 89 6e-17
gi|15668650|ref|NP_247449.1| LSU ribosomal protein L19E [Methano... 89 6e-17
gi|45478092|gb|AAS66217.1| LRRGT00126 [Rattus norvegicus] 88 1e-16
gi|46444981|gb|EAL04252.1| hypothetical protein CaO19.13325 [Can... 88 1e-16
gi|21228244|ref|NP_634166.1| LSU ribosomal protein L19E [Methano... 87 2e-16
gi|7440944|pir||T03648 probable ribosomal protein L19 - maize (f... 87 3e-16
gi|1350677|sp|Q08066|RL19_MAIZE 60S RIBOSOMAL PROTEIN L19 87 3e-16
gi|20089960|ref|NP_616035.1| ribosomal protein L19e [Methanosarc... 86 4e-16
gi|48838701|ref|ZP_00295641.1| COG2147: Ribosomal protein L19E [... 86 5e-16
gi|15678052|ref|NP_275166.1| ribosomal protein L19 [Methanotherm... 86 5e-16
gi|475257|gb|AAA18552.1| putative ribosomal protein L19 [Zea mays] 86 5e-16
gi|34882209|ref|XP_229413.2| similar to 60S ribosomal protein L1... 84 3e-15
gi|132740|sp|P14024|RL19_METVA 50S RIBOSOMAL PROTEIN L19E (ORF E... 83 3e-15
gi|41615168|ref|NP_963666.1| NEQ379 [Nanoarchaeum equitans Kin4-... 83 3e-15
gi|45358980|ref|NP_988537.1| LSU ribosomal protein L19E [Methano... 82 6e-15
gi|34874835|ref|XP_236984.2| similar to polyductin [Rattus norve... 80 2e-14
gi|34932816|ref|XP_229843.2| similar to 60S ribosomal protein L1... 80 2e-14
gi|46141837|ref|ZP_00147298.2| COG2147: Ribosomal protein L19E [... 80 2e-14
gi|27363129|gb|AAO11518.1| ribosomal protein L19 [Chlamys farreri] 80 2e-14
gi|15790650|ref|NP_280474.1| 50S ribosomal protein L19E; Rpl19e ... 79 8e-14
gi|132738|sp|P14119|RL19_HALMA 50S ribosomal protein L19E (Hmal1... 73 3e-12
gi|15897606|ref|NP_342211.1| LSU ribosomal protein L19E (rpl19E)... 72 6e-12
gi|10120932|pdb|1FFK|M Chain M, Crystal Structure Of The Large R... 71 1e-11
gi|14600652|ref|NP_147169.1| 50S ribosomal protein L19 [Aeropyru... 71 2e-11
gi|3914709|sp|O05639|RL19_SULAC 50S ribosomal protein L19E >gnl|... 70 3e-11
gi|48852508|ref|ZP_00306694.1| COG2147: Ribosomal protein L19E [... 68 1e-10
gi|34882237|ref|XP_346140.1| similar to 60S ribosomal protein L1... 66 4e-10
gi|15920624|ref|NP_376293.1| 151aa long hypothetical 50S ribosom... 65 7e-10
gi|48477730|ref|YP_023436.1| large subunit ribosomal protein L19... 65 1e-09
gi|34882989|ref|XP_229431.2| similar to Y-LINKED TESTIS-SPECIFIC... 64 2e-09
gi|23573623|gb|AAN38747.1| ribosomal protein L19 [Spodoptera fru... 59 9e-08
gi|23481153|gb|EAA17516.1| 60S ribosomal protein L19 [Plasmodium... 58 1e-07
gi|38083399|ref|XP_358511.1| hypothetical protein XP_358511 [Mus... 56 6e-07
gi|47184040|emb|CAG13863.1| unnamed protein product [Tetraodon n... 55 7e-07
gi|554467|gb|AAA41503.1| ribosomal protein L19 51 2e-05
gi|13541174|ref|NP_110862.1| 50S ribosomal protein L19E [Thermop... 51 2e-05
gi|18313097|ref|NP_559764.1| ribosomal protein L19 [Pyrobaculum ... 50 2e-05
gi|16082255|ref|NP_394709.1| probable 50S ribosomal protein L19 ... 50 3e-05
gi|34852883|ref|XP_344801.1| similar to 60S ribosomal protein L1... 46 5e-04
gi|6539652|gb|AAF15968.1| ribosomal protein L19 [Phodopus sungorus] 44 0.003
gi|34857427|ref|XP_345408.1| similar to 60S ribosomal protein L1... 42 0.007
gi|34882421|ref|XP_225800.2| similar to Y-LINKED TESTIS-SPECIFIC... 40 0.032
gi|39597865|emb|CAE68557.1| Hypothetical protein CBG14390 [Caeno... 39 0.095
gi|45478090|gb|AAS66216.1| LRRG00125 [Rattus norvegicus] 37 0.27
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g... 36 0.47
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 36 0.61
gi|42733978|gb|AAS38875.1| similar to Dictyostelium discoideum (... 36 0.61
gi|50729316|ref|XP_425509.1| PREDICTED: similar to wingless-type... 35 0.80
gi|39584651|emb|CAE72404.1| Hypothetical protein CBG19563 [Caeno... 35 1.4
gi|37202062|gb|AAQ89646.1| At4g16030 [Arabidopsis thaliana] 35 1.4
gi|15234776|ref|NP_193338.1| 60S ribosomal protein L19, putative... 35 1.4
gi|45190780|ref|NP_985034.1| AER177Wp [Eremothecium gossypii] >g... 35 1.4
gi|7511511|pir||T32347 outward rectifier potassium channel homol... 34 1.8
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 34 1.8
gi|50285809|ref|XP_445333.1| unnamed protein product [Candida gl... 34 1.8
gi|17536613|ref|NP_494333.1| TWiK family of potassium channels (... 34 1.8
gi|31044148|gb|AAP42860.1| NanA6 [Streptomyces nanchangensis] 34 1.8
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 34 2.3
gi|37575611|gb|AAQ93596.1| hypothetical protein pSCL2.9.69.3c [S... 33 3.0
gi|23103532|ref|ZP_00090012.1| COG2828: Uncharacterized protein ... 33 3.0
gi|46108154|ref|XP_381135.1| hypothetical protein FG00959.1 [Gib... 33 3.0
gi|41055369|ref|NP_957391.1| similar to forkhead box M1 [Danio r... 33 3.0
gi|34851919|ref|XP_226464.2| similar to AT motif-binding factor ... 33 4.0
gi|16945420|emb|CAB91345.2| hypothetical protein [Neurospora cra... 33 5.2
gi|18202263|sp|O97775|ANDR_PANTR Androgen receptor (Dihydrotesto... 33 5.2
gi|49523567|emb|CAF18245.1| STYLOSA protein [Antirrhinum majus] 33 5.2
gi|17564964|ref|NP_507993.1| papilin (5V147) [Caenorhabditis ele... 33 5.2
gi|28828976|gb|AAO51556.1| similar to Plasmodium falciparum. Pro... 33 5.2
gi|34853625|ref|XP_342415.1| similar to SH2 domain-containing Ep... 32 6.8
gi|82823|pir||S10050 ribosomal protein L19.e - fission yeast (Sc... 32 6.8
gi|15218462|ref|NP_177383.1| expressed protein [Arabidopsis thal... 32 8.8
gi|46121973|ref|XP_385540.1| hypothetical protein FG05364.1 [Gib... 32 8.8
gi|32471674|ref|NP_864667.1| hypothetical protein-signal peptide... 32 8.8
gi|47208417|emb|CAF92198.1| unnamed protein product [Tetraodon n... 32 8.8
gi|6688177|emb|CAB65108.1| DIPB protein [Homo sapiens] 32 8.8
gi|7340940|gb|AAF61180.1| fruitless type C [Drosophila heteroneura] 32 8.8
gi|45478088|gb|AAS66215.1| LRRG00124 [Rattus norvegicus] 32 8.8
gi|50404847|ref|YP_053939.1| DNA-binding protein, putative [Para... 32 8.8
gi|50421927|ref|XP_459522.1| unnamed protein product [Debaryomyc... 32 8.8
>gi|17508673|ref|NP_491608.1| ribosomal Protein, Large subunit (23.7
kD) (rpl-19) [Caenorhabditis elegans]
gi|3122680|sp|O02639|RL19_CAEEL 60S ribosomal protein L19
gi|7495739|pir||T29135 hypothetical protein C09D4.5 -
Caenorhabditis elegans
gi|2076889|gb|AAB53979.1| Ribosomal protein, large subunit protein
19 [Caenorhabditis elegans]
Length = 198
Score = 276 bits (705), Expect = 3e-73
Identities = 150/198 (75%), Positives = 150/198 (75%)
Frame = -1
Query: 597 MSNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLIIRKPVTVHSX 418
MSNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLIIRKPVTVHS
Sbjct: 1 MSNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLIIRKPVTVHSR 60
Query: 417 XXXXXXXXXXXXXRHTGYGKRRGTANARMPEKTLWIXXXXXXXXXXXXXRDAKKLDKHLY 238
RHTGYGKRRGTANARMPEKTLWI RDAKKLDKHLY
Sbjct: 61 FRAREYEEARRKGRHTGYGKRRGTANARMPEKTLWIRRMRVLRNLLRRYRDAKKLDKHLY 120
Query: 237 HELYLRAKGNNFKNKKNLIEYIFKKKTENKRAKQLADQAQAXXXXXXXXXXXXXXXXXXX 58
HELYLRAKGNNFKNKKNLIEYIFKKKTENKRAKQLADQAQA
Sbjct: 121 HELYLRAKGNNFKNKKNLIEYIFKKKTENKRAKQLADQAQARRDKNKESRKRREERQVVK 180
Query: 57 XXELLRKISQSEKVIAGK 4
ELLRKISQSEKVIAGK
Sbjct: 181 RAELLRKISQSEKVIAGK 198