Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C09G5_3
(852 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [... 332 8e-90
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno... 270 4e-71
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 94 3e-18
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 94 5e-18
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ... 84 3e-15
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ... 84 4e-15
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno... 81 3e-14
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 79 1e-13
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 79 1e-13
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno... 77 4e-13
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ... 77 6e-13
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno... 75 2e-12
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 74 4e-12
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ... 73 7e-12
gi|25385147|pir||A88640 protein C34H4.4 [imported] - Caenorhabdi... 71 3e-11
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 71 3e-11
gi|687634|gb|AAA62504.1| collagen 70 6e-11
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 70 8e-11
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno... 70 8e-11
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 69 1e-10
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 69 1e-10
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 69 2e-10
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 69 2e-10
gi|17508175|ref|NP_491106.1| COLlagen structural gene (col-49) [... 67 4e-10
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-... 66 8e-10
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 66 1e-09
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno... 66 1e-09
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ... 65 2e-09
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 65 2e-09
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 64 3e-09
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat... 64 4e-09
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 64 4e-09
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [... 64 4e-09
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno... 64 4e-09
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno... 64 4e-09
gi|39595517|emb|CAE60555.1| Hypothetical protein CBG04182 [Caeno... 64 4e-09
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col... 64 5e-09
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno... 63 7e-09
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno... 63 7e-09
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C... 63 7e-09
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno... 63 7e-09
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 63 9e-09
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno... 63 9e-09
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno... 63 9e-09
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 62 1e-08
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >... 62 1e-08
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 62 1e-08
gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD) ... 62 1e-08
gi|39596219|emb|CAE69856.1| Hypothetical protein CBG16184 [Caeno... 62 1e-08
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ... 62 2e-08
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [... 62 2e-08
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ... 62 2e-08
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno... 62 2e-08
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 61 3e-08
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ... 61 3e-08
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ... 61 3e-08
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno... 61 4e-08
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ... 60 5e-08
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 60 6e-08
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 60 6e-08
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 60 6e-08
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ... 59 1e-07
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C... 59 1e-07
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno... 58 3e-07
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ... 58 3e-07
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl... 58 3e-07
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 58 3e-07
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno... 57 4e-07
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 57 7e-07
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 57 7e-07
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [... 57 7e-07
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 56 1e-06
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno... 56 1e-06
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 56 1e-06
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ... 55 1e-06
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 55 1e-06
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno... 55 1e-06
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 55 1e-06
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno... 55 2e-06
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno... 55 3e-06
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno... 54 3e-06
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 54 4e-06
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ... 54 4e-06
gi|50732245|ref|XP_418546.1| PREDICTED: similar to PAX transcrip... 53 7e-06
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno... 53 7e-06
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [... 53 7e-06
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [... 53 1e-05
gi|39585299|emb|CAE61621.1| Hypothetical protein CBG05547 [Caeno... 53 1e-05
gi|2144796|pir||I36912 involucrin S - douroucouli (fragment) >gn... 53 1e-05
gi|39597491|emb|CAE59721.1| Hypothetical protein CBG03154 [Caeno... 52 1e-05
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno... 52 1e-05
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 52 1e-05
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno... 52 1e-05
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 52 1e-05
gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals ... 52 2e-05
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [... 52 2e-05
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd... 52 2e-05
gi|124727|sp|P24708|INVO_AOTTR Involucrin >gnl|BL_ORD_ID|1836165... 52 2e-05
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 41 2e-05
gi|39579123|emb|CAE56688.1| Hypothetical protein CBG24466 [Caeno... 52 2e-05
gi|27802760|emb|CAD60849.1| SI:zC14A17.12.1 (novel protein simil... 52 2e-05
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [... 52 2e-05
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ... 52 2e-05
gi|23480318|gb|EAA16908.1| Drosophila melanogaster CG8797 gene p... 51 3e-05
gi|124736|sp|P14708|INVO_PONPY Involucrin >gnl|BL_ORD_ID|1318093... 51 3e-05
gi|1513204|gb|AAC48703.1| involucrin 51 3e-05
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 51 3e-05
gi|124734|sp|P14591|INVO_PANPA Involucrin >gnl|BL_ORD_ID|553935 ... 51 4e-05
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 51 4e-05
gi|84434|pir||PS0036 collagen col-7 - Caenorhabditis elegans (fr... 50 5e-05
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno... 50 5e-05
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 50 5e-05
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 50 5e-05
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 50 6e-05
gi|2144789|pir||I37061 involucrin M - gorilla >gnl|BL_ORD_ID|838... 50 6e-05
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [... 50 6e-05
gi|2144790|pir||I37060 involucrin L - gorilla >gnl|BL_ORD_ID|150... 50 6e-05
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ... 50 8e-05
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 50 8e-05
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 50 8e-05
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 49 1e-04
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 49 1e-04
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno... 49 1e-04
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno... 49 1e-04
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 49 1e-04
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 49 1e-04
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 49 1e-04
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 49 1e-04
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 49 1e-04
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno... 49 1e-04
gi|33285196|gb|AAF99925.2| Collagen protein 111 [Caenorhabditis ... 49 1e-04
gi|16552857|dbj|BAB71393.1| unnamed protein product [Homo sapiens] 49 1e-04
gi|39589826|emb|CAE67061.1| Hypothetical protein CBG12469 [Caeno... 49 1e-04
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 49 1e-04
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 49 1e-04
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 49 1e-04
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 49 2e-04
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 49 2e-04
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 49 2e-04
gi|17557218|ref|NP_505646.1| COLlagen structural gene (30.6 kD) ... 48 2e-04
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 48 2e-04
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 48 2e-04
gi|39588000|emb|CAE57231.1| Hypothetical protein CBG00101 [Caeno... 48 2e-04
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 48 2e-04
gi|27367908|ref|NP_763435.1| TPR repeat containing protein [Vibr... 48 2e-04
gi|124731|sp|P07476|INVO_HUMAN Involucrin >gnl|BL_ORD_ID|1848736... 48 3e-04
gi|11423493|ref|XP_001677.1| similar to Involucrin [Homo sapiens... 48 3e-04
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 48 3e-04
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno... 48 3e-04
gi|2078275|gb|AAC47745.1| collagen [Meloidogyne javanica] 47 4e-04
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 47 4e-04
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 47 4e-04
gi|84432|pir||JS0170 collagen col-19 - Caenorhabditis elegans >g... 47 5e-04
gi|33284886|emb|CAE17632.1| SI:bZ1G18.6.4 (novel protein similar... 47 5e-04
gi|41149760|ref|XP_370692.1| similar to hypothetical protein DKF... 47 5e-04
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 47 5e-04
gi|1513206|gb|AAC48704.1| involucrin 47 5e-04
gi|124732|sp|P17941|INVO_HYLLA Involucrin >gnl|BL_ORD_ID|1811533... 47 7e-04
gi|39583250|emb|CAE60042.1| Hypothetical protein CBG03553 [Caeno... 47 7e-04
gi|17506297|ref|NP_492086.1| COLlagen structural gene (col-35) [... 47 7e-04
gi|17542298|ref|NP_501532.1| COLlagen structural gene (col-118) ... 47 7e-04
gi|25395729|pir||H88449 protein F54D8.1 [imported] - Caenorhabdi... 47 7e-04
gi|48125360|ref|XP_396577.1| similar to ENSANGP00000003262 [Apis... 47 7e-04
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 47 7e-04
gi|17553572|ref|NP_498086.1| collagen alpha precursor, DumPY : s... 47 7e-04
gi|2498204|sp|Q05682|CALD_HUMAN Caldesmon (CDM) >gnl|BL_ORD_ID|3... 47 7e-04
gi|32566102|ref|NP_508100.2| COLlagen structural gene (col-19) [... 47 7e-04
gi|39595235|emb|CAE60272.1| Hypothetical protein CBG03851 [Caeno... 46 9e-04
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 46 9e-04
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 46 9e-04
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno... 46 9e-04
gi|467292|gb|AAA17387.1| glutamine-asparagine rich protein 46 9e-04
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628... 46 9e-04
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 46 0.001
gi|17540620|ref|NP_502115.1| COLlagen structural gene (col-126) ... 46 0.001
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder... 46 0.001
gi|17540622|ref|NP_502116.1| predicted CDS, COLlagen structural ... 46 0.001
gi|17542824|ref|NP_501756.1| COLlagen structural gene (col-123) ... 46 0.001
gi|39587723|emb|CAE58661.1| Hypothetical protein CBG01830 [Caeno... 46 0.001
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 45 0.002
gi|44680105|ref|NP_149129.2| caldesmon 1 isoform 1 [Homo sapiens] 45 0.002
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno... 45 0.002
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 45 0.002
gi|17539078|ref|NP_502507.1| COLlagen structural gene (col-131) ... 45 0.002
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo... 45 0.002
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 45 0.002
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 45 0.002
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 39 0.002
gi|115347|sp|P27393|CA24_ASCSU Collagen alpha 2(IV) chain precur... 45 0.003
gi|17531393|ref|NP_496311.1| nematode cuticle collagen, BLIstere... 45 0.003
gi|17507511|ref|NP_492619.1| COLlagen structural gene (col-64) [... 45 0.003
gi|37619788|emb|CAA86755.2| Hypothetical protein C09G5.6 [Caenor... 45 0.003
gi|28901310|ref|NP_800965.1| hypothetical protein VPA1455 [Vibri... 45 0.003
gi|460246|gb|AAC46611.1| a2 (IV) basement membrane collagen 45 0.003
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot... 44 0.003
gi|39586931|emb|CAE62866.1| Hypothetical protein CBG07049 [Caeno... 44 0.003
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ... 44 0.003
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 44 0.003
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor... 44 0.003
gi|17539090|ref|NP_502514.1| COLlagen structural gene (col-132) ... 44 0.003
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 44 0.004
gi|39596974|emb|CAE59201.1| Hypothetical protein CBG02512 [Caeno... 44 0.004
gi|47208936|emb|CAF90803.1| unnamed protein product [Tetraodon n... 44 0.004
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 44 0.004
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 44 0.004
gi|47223062|emb|CAG07149.1| unnamed protein product [Tetraodon n... 34 0.005
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (... 44 0.006
gi|42660665|ref|XP_208835.4| similar to hypothetical protein FLJ... 44 0.006
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ... 44 0.006
gi|30145696|emb|CAD89749.1| Hypothetical protein M199.5 [Caenorh... 44 0.006
gi|29290086|gb|AAO67558.1| Gag protein [Drosophila virilis] >gnl... 44 0.006
gi|48096897|ref|XP_392541.1| similar to ENSANGP00000014221 [Apis... 44 0.006
gi|50757733|ref|XP_415624.1| PREDICTED: similar to acyl-CoA oxid... 44 0.006
gi|124737|sp|P24712|INVO_SAGOE Involucrin >gnl|BL_ORD_ID|574947 ... 44 0.006
gi|11345236|gb|AAG34656.1| involucrin [Mus musculus] 44 0.006
gi|39586155|emb|CAE69231.1| Hypothetical protein CBG15273 [Caeno... 44 0.006
gi|39582634|emb|CAE73738.1| Hypothetical protein CBG21264 [Caeno... 43 0.008
gi|28829071|gb|AAO51637.1| similar to Dictyostelium discoideum (... 43 0.008
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 43 0.008
gi|2708813|gb|AAC50042.1| ATA20 [Arabidopsis thaliana] 43 0.008
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 43 0.008
gi|46442788|gb|EAL02075.1| hypothetical protein CaO19.13926 [Can... 43 0.008
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 43 0.008
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 43 0.008
gi|50414778|gb|AAH77291.1| Unknown (protein for IMAGE:4970050) [... 43 0.008
gi|17540820|ref|NP_500070.1| COLlagen structural gene (28.0 kD) ... 43 0.008
gi|17539868|ref|NP_501416.1| predicted CDS, COLlagen structural ... 43 0.008
gi|17540078|ref|NP_500607.1| COLlagen structural gene (col-111) ... 43 0.008
gi|15232576|ref|NP_188159.1| anther development protein, putativ... 43 0.008
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 43 0.010
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 43 0.010
gi|6320845|ref|NP_010924.1| Non-essential subunit of the exocyst... 43 0.010
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 43 0.010
gi|24585169|ref|NP_724173.1| CG31797-PA [Drosophila melanogaster... 43 0.010
gi|50556618|ref|XP_505717.1| hypothetical protein [Yarrowia lipo... 43 0.010
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 43 0.010
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 43 0.010
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ... 43 0.010
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 43 0.010
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 43 0.010
gi|50731940|ref|XP_418425.1| PREDICTED: similar to collagen, typ... 38 0.012
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita] 42 0.013
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc... 42 0.013
gi|47217567|emb|CAG02494.1| unnamed protein product [Tetraodon n... 42 0.013
gi|39581447|emb|CAE74729.1| Hypothetical protein CBG22547 [Caeno... 42 0.013
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 42 0.013
gi|32419885|ref|XP_330386.1| predicted protein [Neurospora crass... 42 0.013
gi|124729|sp|P24709|INVO_CEBAL Involucrin >gnl|BL_ORD_ID|1943485... 42 0.013
gi|17534799|ref|NP_493702.1| COLlagen structural gene (col-69) [... 42 0.013
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det... 42 0.013
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 42 0.017
gi|46320109|ref|ZP_00220502.1| COG1530: Ribonucleases G and E [B... 42 0.017
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate... 42 0.017
gi|39597388|emb|CAE59617.1| Hypothetical protein CBG03026 [Caeno... 42 0.017
gi|23508562|ref|NP_701231.1| hypothetical protein [Plasmodium fa... 42 0.017
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 42 0.017
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 42 0.017
gi|124738|sp|P24711|INVO_TARBA Involucrin >gnl|BL_ORD_ID|1371644... 42 0.017
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 42 0.017
gi|39591910|emb|CAE75130.1| Hypothetical protein CBG23058 [Caeno... 42 0.017
gi|26325886|dbj|BAC26697.1| unnamed protein product [Mus musculus] 42 0.017
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 42 0.017
gi|17557828|ref|NP_505635.1| COLlagen structural gene (col-148) ... 42 0.017
gi|17538077|ref|NP_495159.1| COLlagen structural gene (col-74) [... 42 0.017
gi|33668516|gb|AAO39707.1| GRINL1A complex protein 1 Gcom1 precu... 42 0.017
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ... 42 0.022
gi|7595898|gb|AAF64489.1| prespore protein MF12 [Dictyostelium d... 42 0.022
gi|17536751|ref|NP_495952.1| predicted CDS, COLlagen structural ... 42 0.022
gi|39596336|emb|CAE69974.1| Hypothetical protein CBG16372 [Caeno... 42 0.022
gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [... 42 0.022
gi|21757308|dbj|BAC05084.1| unnamed protein product [Homo sapiens] 42 0.022
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 42 0.022
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 42 0.022
gi|25148570|ref|NP_740973.1| M protein repeat containing protein... 42 0.022
gi|13279176|gb|AAH04303.1| Unknown (protein for IMAGE:3623592) [... 42 0.022
gi|12006358|gb|AAG44841.1| Tara [Homo sapiens] 41 0.029
gi|42567462|ref|NP_195370.2| trichohyalin-related [Arabidopsis t... 41 0.029
gi|17557278|ref|NP_505375.1| COLlagen structural gene (28.8 kD) ... 41 0.029
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 41 0.029
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis] 41 0.029
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ... 41 0.029
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|... 41 0.029
gi|47059089|ref|NP_080957.2| DVL-binding protein DAPLE [Mus musc... 41 0.029
gi|28316334|dbj|BAC56950.1| hair follicle protein AHF [Mus muscu... 41 0.029
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 41 0.029
gi|50748610|ref|XP_421324.1| PREDICTED: similar to thyroid hormo... 41 0.029
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis] 41 0.029
gi|37676035|ref|NP_936431.1| TPR repeat containing protein [Vibr... 41 0.029
gi|25407733|pir||B85431 trichohyalin like protein [imported] - A... 41 0.029
gi|20455321|sp|Q99KW3|TARA_MOUSE TRIO and F-actin binding protei... 41 0.038
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 41 0.038
gi|39593808|emb|CAE62101.1| Hypothetical protein CBG06131 [Caeno... 41 0.038
gi|20336766|ref|NP_008963.2| Tara-like protein isoform 1 [Homo s... 41 0.038
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus] 41 0.038
gi|39594543|emb|CAE72121.1| Hypothetical protein CBG19217 [Caeno... 41 0.038
gi|39579838|emb|CAE56847.1| Hypothetical protein CBG24674 [Caeno... 41 0.038
gi|50401121|sp|Q95XZ5|NPBL_CAEEL Nipped-B-like protein pqn-85 (P... 41 0.038
gi|124730|sp|P24710|INVO_GALCR Involucrin >gnl|BL_ORD_ID|1873056... 41 0.038
gi|11345238|gb|AAG34657.1| involucrin [Mus musculus] 41 0.038
gi|19584412|emb|CAD28497.1| hypothetical protein [Homo sapiens] 41 0.038
gi|17539916|ref|NP_500598.1| COLlagen structural gene (col-110) ... 41 0.038
gi|39644673|gb|AAH13278.2| HRIHFB2122 protein [Homo sapiens] 41 0.038
gi|7335658|gb|AAC27083.2| M protein [Streptococcus pyogenes] 41 0.038
gi|42733836|gb|AAS38754.1| hypothetical protein [Dictyostelium d... 41 0.038
gi|20521960|dbj|BAB33332.2| KIAA1662 protein [Homo sapiens] 41 0.038
gi|39104546|dbj|BAC98227.2| mKIAA1662 protein [Mus musculus] 41 0.038
gi|29789371|ref|NP_613045.1| TRIO and F-actin binding protein; T... 41 0.038
gi|27503073|gb|AAH42760.1| TRIO and F-actin binding protein [Mus... 41 0.038
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ... 41 0.038
gi|33598984|gb|AAQ23117.1| M73 [Streptococcus pyogenes] 41 0.038
gi|17537109|ref|NP_493687.1| prion-like Q/N-rich domain protein,... 41 0.038
gi|34785442|gb|AAH57524.1| LOC402861 protein [Danio rerio] 41 0.038
gi|11345242|gb|AAG34659.1| involucrin [Mus musculus] 41 0.038
gi|24640804|ref|NP_572555.1| CG17440-PA [Drosophila melanogaster... 41 0.038
gi|39597300|emb|CAE59528.1| Hypothetical protein CBG02923 [Caeno... 41 0.038
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 41 0.038
gi|34875175|ref|XP_213526.2| similar to structural protein FBF1 ... 40 0.049
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 40 0.049
gi|6680506|ref|NP_032438.1| involucrin [Mus musculus] >gnl|BL_OR... 40 0.049
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 40 0.049
gi|39587924|emb|CAE67943.1| Hypothetical protein CBG13543 [Caeno... 40 0.049
gi|39596084|emb|CAE69720.1| Hypothetical protein CBG15991 [Caeno... 40 0.049
gi|39593313|emb|CAE64783.1| Hypothetical protein CBG09576 [Caeno... 40 0.049
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno... 40 0.049
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 40 0.049
gi|17534889|ref|NP_495294.1| COLlagen structural gene (col-75) [... 40 0.049
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 40 0.049
gi|17543780|ref|NP_502799.1| putative nuclear protein, with 2 co... 40 0.049
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo... 40 0.064
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (... 40 0.064
gi|40556098|ref|NP_955183.1| CNPV160 N1R/p28-like protein [Canar... 40 0.064
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ... 40 0.064
gi|23619293|ref|NP_705255.1| reticulocyte binding protein 2 homo... 40 0.064
gi|13345187|gb|AAK19244.1| reticulocyte binding protein 2 homolo... 40 0.064
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc... 40 0.064
gi|46316651|ref|ZP_00217230.1| COG1530: Ribonucleases G and E [B... 40 0.064
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 40 0.064
gi|437639|gb|AAA72295.1| [Plasmodium falciparum 3' end.], gene p... 40 0.064
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (... 40 0.064
gi|39587615|emb|CAE58553.1| Hypothetical protein CBG01712 [Caeno... 40 0.064
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r... 40 0.064
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr... 40 0.064
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ... 40 0.064
gi|47226837|emb|CAG06679.1| unnamed protein product [Tetraodon n... 40 0.064
gi|33413774|gb|AAN39445.1| normocyte binding protein 2a [Plasmod... 40 0.064
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 40 0.084
gi|28374176|gb|AAH46263.1| LOC398566 protein [Xenopus laevis] 40 0.084
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 40 0.084
gi|23612612|ref|NP_704173.1| hypothetical protein [Plasmodium fa... 40 0.084
gi|28870994|ref|NP_793613.1| ribonuclease, Rne/Rng family protei... 40 0.084
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno... 40 0.084
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster... 40 0.084
gi|2935563|gb|AAC05160.1| M protein [Streptococcus pyogenes] 40 0.084
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster... 40 0.084
gi|49118234|gb|AAH73238.1| Unknown (protein for IMAGE:5440135) [... 40 0.084
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 40 0.084
gi|5815245|gb|AAD52614.1| SANT domain protein SMRTER [Drosophila... 40 0.084
gi|17137252|ref|NP_477190.1| CG16858-PA [Drosophila melanogaster... 40 0.084
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me... 40 0.084
gi|47217186|emb|CAG11022.1| unnamed protein product [Tetraodon n... 40 0.084
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D... 40 0.084
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster... 40 0.084
gi|283629|pir||S27770 hypothetical protein 1 - African malaria m... 40 0.084
gi|17569623|ref|NP_509801.1| esophageal gland cell secretory pro... 40 0.084
gi|7441224|pir||T13990 collagen type IV alpha 2 - fruit fly (Dro... 40 0.084
gi|39586913|emb|CAE62848.1| Hypothetical protein CBG07027 [Caeno... 39 0.11
gi|17542460|ref|NP_499889.1| COLlagen structural gene (col-100) ... 39 0.11
gi|732526|gb|AAA64312.1| alpha2(IV) collagen 39 0.11
gi|47847440|dbj|BAD21392.1| mFLJ00158 protein [Mus musculus] 39 0.11
gi|584868|sp|P17140|CA24_CAEEL Collagen alpha 2(IV) chain precur... 39 0.11
gi|17568911|ref|NP_510664.1| CoLlagen, Basement membrane type, L... 39 0.11
gi|24641597|ref|NP_536797.2| CG4013-PA [Drosophila melanogaster]... 39 0.11
gi|47223366|emb|CAG04227.1| unnamed protein product [Tetraodon n... 39 0.11
gi|953173|emb|CAA80537.1| a2(IV) collagen [Caenorhabditis elegans] 39 0.11
gi|17568913|ref|NP_510663.1| CoLlagen, Basement membrane type, L... 39 0.11
gi|50288897|ref|XP_446878.1| unnamed protein product [Candida gl... 39 0.11
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 39 0.11
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 39 0.11
gi|31541804|ref|NP_766159.2| RIKEN cDNA 1110033G01 [Mus musculus... 39 0.11
gi|1828|emb|CAA35992.1| trichohyalin [Ovis sp.] 39 0.11
gi|30410760|ref|NP_082542.2| procollagen, type XVI, alpha 1; [a]... 39 0.11
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 39 0.11
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 39 0.11
gi|15789646|ref|NP_279470.1| Vng0394c [Halobacterium sp. NRC-1] ... 39 0.11
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 39 0.11
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 39 0.11
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib... 39 0.11
gi|23452508|gb|AAN33053.1| nestin [Rattus norvegicus] 39 0.11
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 39 0.11
gi|27977392|gb|AAO25621.1| paraflagellar rod protein 4 [Leishman... 39 0.11
gi|20379994|gb|AAH27766.1| Col16a1 protein [Mus musculus] 39 0.11
gi|13182946|gb|AAK14999.1| centromere binding protein 1 [Candida... 39 0.11
gi|7496462|pir||T15597 hypothetical protein C25A11.4b - Caenorha... 39 0.14
gi|49086320|ref|XP_405216.1| hypothetical protein AN1079.2 [Aspe... 39 0.14
gi|4379341|emb|CAA08789.1| fibrillar collagen [Podocoryne carnea] 39 0.14
gi|7496461|pir||T15598 hypothetical protein C25A11.4a - Caenorha... 39 0.14
gi|15230788|ref|NP_189665.1| hypothetical protein [Arabidopsis t... 39 0.14
gi|39587704|emb|CAE58642.1| Hypothetical protein CBG01810 [Caeno... 39 0.14
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 39 0.14
gi|902016|gb|AAB17102.1| EmmL2(A207) [Streptococcus pyogenes] 39 0.14
gi|25148106|ref|NP_741868.1| apical Junction Molecule AJM-1, Jun... 39 0.14
gi|17568589|ref|NP_509537.1| apical Junction Molecule AJM-1, Jun... 39 0.14
gi|35505404|gb|AAH57711.1| MGC68848 protein [Xenopus laevis] 39 0.14
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 39 0.14
gi|30687943|ref|NP_851046.1| auxin-responsive factor (ARF7) [Ara... 39 0.14
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto... 39 0.14
gi|4103243|gb|AAD04807.1| BIPOSTO [Arabidopsis thaliana] 39 0.14
gi|30687957|ref|NP_568400.2| auxin-responsive factor (ARF7) [Ara... 39 0.14
gi|7505675|pir||T32092 hypothetical protein K09F6.6 - Caenorhabd... 39 0.14
gi|50548613|ref|XP_501776.1| hypothetical protein [Yarrowia lipo... 39 0.14
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 39 0.14
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass... 39 0.14
gi|34855745|ref|XP_214901.2| similar to RIKEN cDNA 2610507L03 [R... 39 0.14
gi|17568587|ref|NP_509538.1| apical Junction Molecule AJM-1, Jun... 39 0.14
gi|25148758|ref|NP_503544.2| troponin T (tnt-4) [Caenorhabditis ... 39 0.14
gi|32566812|ref|NP_872157.1| troponin T (tnt-4) [Caenorhabditis ... 39 0.14
gi|4104929|gb|AAD02218.1| auxin response factor 7 [Arabidopsis t... 39 0.14
gi|30687949|ref|NP_851047.1| auxin-responsive factor (ARF7) [Ara... 39 0.14
gi|28491656|ref|XP_194467.2| similar to hypothetical protein FLJ... 39 0.14
gi|19310546|gb|AAL85006.1| unknown protein [Arabidopsis thaliana] 39 0.14
gi|17568591|ref|NP_509536.1| apical Junction Molecule AJM-1, Jun... 39 0.14
gi|42660685|ref|XP_375272.1| similar to hypothetical protein FLJ... 39 0.14
gi|23509641|ref|NP_702308.1| hypothetical protein [Plasmodium fa... 39 0.14
gi|31982452|ref|NP_031766.2| procollagen, type IX, alpha 1 [Mus ... 39 0.19
gi|5921191|sp|Q05722|CA19_MOUSE Collagen alpha 1(IX) chain precu... 39 0.19
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738... 39 0.19
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 39 0.19
gi|115309|sp|P17139|CA14_CAEEL Collagen alpha 1(IV) chain precur... 39 0.19
gi|42660674|ref|XP_377369.1| similar to hypothetical protein FLJ... 39 0.19
gi|28422746|gb|AAH46970.1| Col9a1 protein [Mus musculus] 39 0.19
gi|24640806|ref|NP_572556.1| CG17446-PA [Drosophila melanogaster... 39 0.19
gi|42733225|emb|CAA81584.4| Hypothetical protein K04H4.1a [Caeno... 39 0.19
gi|23479124|gb|EAA16038.1| repeat organellar protein-related [Pl... 39 0.19
gi|3986196|dbj|BAA34955.1| myosin heavy chain [Dugesia japonica] 39 0.19
gi|39591701|emb|CAE71279.1| Hypothetical protein CBG18162 [Caeno... 39 0.19
gi|9453839|dbj|BAB03273.1| myosin [Chara corallina] 39 0.19
gi|1082285|pir||H54024 protein kinase (EC 2.7.1.37) cdc2-related... 39 0.19
gi|227522|prf||1705298A collagen alpha1(IV) 39 0.19
gi|15676451|ref|NP_273590.1| conserved hypothetical protein [Nei... 39 0.19
gi|6472600|dbj|BAA87057.1| unconventional myosin heavy chain [Ch... 39 0.19
gi|42733226|emb|CAE52901.2| Hypothetical protein K04H4.1b [Caeno... 39 0.19
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays] 39 0.19
gi|47212403|emb|CAF92018.1| unnamed protein product [Tetraodon n... 39 0.19
gi|3970872|dbj|BAA34800.1| HRIHFB2122 [Homo sapiens] 39 0.19
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n... 39 0.19
gi|39593742|emb|CAE62035.1| Hypothetical protein CBG06051 [Caeno... 39 0.19
gi|39592327|emb|CAE63404.1| Hypothetical protein CBG07843 [Caeno... 39 0.19
gi|1082284|pir||B54024 protein kinase (EC 2.7.1.37) cdc2-related... 39 0.19
gi|16550282|dbj|BAB70944.1| unnamed protein product [Homo sapiens] 39 0.19
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 39 0.19
gi|31235077|ref|XP_319177.1| ENSANGP00000012409 [Anopheles gambi... 39 0.19
gi|24659567|ref|NP_648056.1| CG10107-PA [Drosophila melanogaster... 39 0.19
gi|12847742|dbj|BAB27690.1| unnamed protein product [Mus musculu... 39 0.19
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 39 0.19
gi|482198|pir||S40991 collagen alpha 1(IV) chain precursor - Cae... 39 0.19
gi|47220230|emb|CAF98995.1| unnamed protein product [Tetraodon n... 38 0.24
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (... 38 0.24
gi|34596293|gb|AAQ76826.1| GRINL1A complex protein Gcom3 precurs... 38 0.24
gi|17561652|ref|NP_505094.1| myosin heavy chain family member (5... 38 0.24
gi|39582788|emb|CAE74251.1| Hypothetical protein CBG21938 [Caeno... 38 0.24
gi|7484702|pir||T10738 hypothetical protein FbLate-2 - sea-islan... 38 0.24
gi|38343901|emb|CAE51956.2| M protein [Streptococcus pyogenes] 38 0.24
gi|34879630|ref|XP_225043.2| similar to Collagen alpha 2(IV) cha... 38 0.24
gi|47214667|emb|CAG00903.1| unnamed protein product [Tetraodon n... 38 0.24
gi|11994246|dbj|BAB01421.1| unnamed protein product [Arabidopsis... 38 0.24
gi|49899935|gb|AAH76947.1| Unknown (protein for MGC:89327) [Xeno... 38 0.24
gi|36031080|ref|NP_034062.2| procollagen, type IV, alpha 2 [Mus ... 38 0.24
gi|5732904|gb|AAD49332.1| M protein precursor [Streptococcus pyo... 38 0.24
gi|25410974|pir||B84434 hypothetical protein At2g02200 [imported... 38 0.24
gi|24647827|ref|NP_732289.1| CG7847-PB [Drosophila melanogaster]... 38 0.24
gi|22655493|gb|AAN04082.1| M76 [Streptococcus pyogenes] 38 0.24
gi|24647825|ref|NP_524395.2| CG7847-PA [Drosophila melanogaster]... 38 0.24
gi|47221995|emb|CAG08250.1| unnamed protein product [Tetraodon n... 38 0.24
gi|48863061|ref|ZP_00316955.1| hypothetical protein Mdeg02001125... 38 0.24
gi|24581820|ref|NP_723044.1| CG4145-PA [Drosophila melanogaster]... 38 0.32
gi|25150292|ref|NP_510092.2| MYOsin heavy chain structural gene ... 38 0.32
gi|127750|sp|P12845|MYSC_CAEEL Myosin heavy chain C (MHC C) >gnl... 38 0.32
gi|7512342|pir||T08621 centrosome associated protein CEP250 - hu... 38 0.32
gi|39597664|emb|CAE68355.1| Hypothetical protein CBG14092 [Caeno... 38 0.32
gi|47228710|emb|CAG07442.1| unnamed protein product [Tetraodon n... 38 0.32
gi|1085500|pir||S42617 collagen alpha 1(IX) chain - mouse >gnl|B... 38 0.32
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 38 0.32
gi|39593522|emb|CAE61814.1| Hypothetical protein CBG05782 [Caeno... 38 0.32
gi|31198741|ref|XP_308318.1| ENSANGP00000010717 [Anopheles gambi... 38 0.32
gi|37595258|gb|AAQ94514.1| M protein [Streptococcus pyogenes] 38 0.32
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 38 0.32
gi|13811671|gb|AAK40236.1| glutamate-rich protein [Plasmodium re... 38 0.32
gi|12669901|gb|AAG21334.2| hypothetical esophageal gland cell se... 38 0.32
gi|16332372|ref|NP_277028.1| cell division cycle 2-like 1 (PITSL... 38 0.32
gi|17558914|ref|NP_506120.1| predicted CDS, filamentous hemagglu... 38 0.32
gi|45433533|ref|NP_956114.2| Unknown (protein for MGC:66194); wu... 38 0.32
gi|37589184|gb|AAH59196.1| Unknown (protein for MGC:66194) [Dani... 38 0.32
gi|34596303|gb|AAQ76831.1| GRINL1A combined protein Gcom11 precu... 38 0.32
gi|507162|gb|AAA19583.1| PITSLRE alpha 2-3 38 0.32
gi|32265052|gb|AAP41549.1| GRINL1A complex protein 2 precursor [... 38 0.32
gi|115310|sp|P08120|CA14_DROME Collagen alpha 1(IV) chain precur... 38 0.32
gi|39586574|emb|CAE73701.1| Hypothetical protein CBG21212 [Caeno... 38 0.32
gi|47218602|emb|CAG10301.1| unnamed protein product [Tetraodon n... 38 0.32
gi|34596313|gb|AAQ76836.1| GRINL1A combined protein Gcom13 precu... 38 0.32
gi|16332370|ref|NP_277027.1| cell division cycle 2-like 1 (PITSL... 38 0.32
>gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79)
[Caenorhabditis elegans]
gi|2493776|sp|Q09233|YQ33_CAEEL Putative cuticle collagen C09G5.3
gi|7495770|pir||T19141 hypothetical protein C09G5.3 -
Caenorhabditis elegans
gi|3874100|emb|CAA86756.1| Hypothetical protein C09G5.3
[Caenorhabditis elegans]
Length = 283
Score = 332 bits (850), Expect = 8e-90
Identities = 179/283 (63%), Positives = 179/283 (63%)
Frame = +1
Query: 1 MDSRFVTYFASAISASVLVTTIFVCWNVTHDLNTLQAMSDRNMQDFKAISDRTWDKMMFK 180
MDSRFVTYFASAISASVLVTTIFVCWNVTHDLNTLQAMSDRNMQDFKAISDRTWDKMMFK
Sbjct: 1 MDSRFVTYFASAISASVLVTTIFVCWNVTHDLNTLQAMSDRNMQDFKAISDRTWDKMMFK 60
Query: 181 QQSSPPSPSLIFGRNKRSGDKCNCSEEPSNCXXXXXXXXXEKGNDGVDGVDGIPGFPGEN 360
QQSSPPSPSLIFGRNKRSGDKCNCSEEPSNC EKGNDGVDGVDGIPGFPGEN
Sbjct: 61 QQSSPPSPSLIFGRNKRSGDKCNCSEEPSNCPGGPPGPPGEKGNDGVDGVDGIPGFPGEN 120
Query: 361 GGAALDQPADGTCIKCXXXXXXXXXXXXXXXXXXDVGEDGEPGVPGNDGADXXXXXXXXX 540
GGAALDQPADGTCIKC DVGEDGEPGVPGNDGAD
Sbjct: 121 GGAALDQPADGTCIKCPPGPRGPPGPQGEEGPSGDVGEDGEPGVPGNDGADGTPGKSGAP 180
Query: 541 XXXXXXXXXXXXXXXXXXXXKAIGEXXXXXXXXXXXTDGRRGENXXXXXXXXXXXXXXXX 720
KAIGE TDGRRGEN
Sbjct: 181 GGKGPQGPPGTPGRPGQPGRKAIGEAGPKGPPGAPGTDGRRGENGTDGDDGVDGQPGDEG 240
Query: 721 XAGKDXXXXXXXXXXXXXXXXXXXXDGAYCPCPARSISKVAIQ 849
AGKD DGAYCPCPARSISKVAIQ
Sbjct: 241 DAGKDGTPGEPGPQGEQGTEGQPGTDGAYCPCPARSISKVAIQ 283