Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C09G5_4
(972 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ... 211 2e-53
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno... 188 2e-46
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ... 158 2e-37
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno... 156 6e-37
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C... 144 2e-33
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno... 144 4e-33
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [... 142 1e-32
gi|84434|pir||PS0036 collagen col-7 - Caenorhabditis elegans (fr... 109 8e-23
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 92 1e-17
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 81 3e-14
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 77 5e-13
gi|687634|gb|AAA62504.1| collagen 75 2e-12
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 75 2e-12
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ... 74 7e-12
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 73 1e-11
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno... 73 1e-11
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 68 4e-10
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 67 5e-10
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ... 67 8e-10
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno... 67 8e-10
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 65 2e-09
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 65 2e-09
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno... 64 4e-09
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 64 4e-09
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 63 1e-08
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ... 62 2e-08
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 62 2e-08
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 62 3e-08
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 62 3e-08
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 61 4e-08
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 60 7e-08
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 60 1e-07
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ... 59 1e-07
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 59 2e-07
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 58 3e-07
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno... 58 4e-07
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 57 5e-07
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|... 56 1e-06
gi|39579123|emb|CAE56688.1| Hypothetical protein CBG24466 [Caeno... 56 1e-06
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno... 56 1e-06
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ... 55 2e-06
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno... 55 3e-06
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 53 1e-05
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 53 1e-05
gi|546193|gb|AAB30382.1| cuticle collagen {N- and C-domains, clo... 53 1e-05
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 52 2e-05
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ... 51 3e-05
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno... 51 3e-05
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 50 6e-05
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 50 6e-05
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 50 1e-04
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno... 50 1e-04
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 50 1e-04
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-... 49 1e-04
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 49 1e-04
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 49 2e-04
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno... 49 2e-04
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno... 49 2e-04
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [... 49 2e-04
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 49 2e-04
gi|46434336|gb|EAK93748.1| hypothetical protein CaO19.4488 [Cand... 48 3e-04
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 48 3e-04
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 48 3e-04
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [... 48 3e-04
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [... 47 5e-04
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 47 5e-04
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,... 47 7e-04
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno... 47 7e-04
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [... 47 9e-04
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ... 47 9e-04
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ... 47 9e-04
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa... 46 0.001
gi|46434301|gb|EAK93714.1| hypothetical protein CaO19.11964 [Can... 46 0.001
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 46 0.001
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 46 0.001
gi|39587723|emb|CAE58661.1| Hypothetical protein CBG01830 [Caeno... 46 0.001
gi|17539090|ref|NP_502514.1| COLlagen structural gene (col-132) ... 46 0.001
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 45 0.002
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno... 45 0.002
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her... 45 0.003
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ... 45 0.003
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 44 0.004
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 44 0.004
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 44 0.004
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno... 44 0.006
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno... 44 0.006
gi|17539868|ref|NP_501416.1| predicted CDS, COLlagen structural ... 44 0.006
gi|39582634|emb|CAE73738.1| Hypothetical protein CBG21264 [Caeno... 44 0.007
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno... 44 0.007
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 44 0.007
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 43 0.009
gi|19112576|ref|NP_595784.1| hypothetical coiled-coil protein [S... 43 0.009
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ... 43 0.012
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >... 43 0.012
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno... 43 0.012
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 43 0.012
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 43 0.012
gi|34534595|dbj|BAC87055.1| unnamed protein product [Homo sapiens] 43 0.012
gi|34869750|ref|XP_223980.2| similar to RPGR-interacting protein... 43 0.012
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 43 0.012
gi|37619788|emb|CAA86755.2| Hypothetical protein C09G5.6 [Caenor... 42 0.016
gi|23487174|gb|EAA20984.1| MIF4G domain, putative [Plasmodium yo... 42 0.016
gi|17531393|ref|NP_496311.1| nematode cuticle collagen, BLIstere... 42 0.016
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 42 0.016
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd... 42 0.016
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus... 42 0.021
gi|23509816|ref|NP_702483.1| hypothetical protein [Plasmodium fa... 42 0.021
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ... 42 0.021
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis] 42 0.027
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 42 0.027
gi|38080873|ref|XP_207119.2| similar to hypothetical protein [Mu... 42 0.027
gi|49077026|ref|XP_402424.1| hypothetical protein UM04809.1 [Ust... 42 0.027
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can... 42 0.027
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa... 42 0.027
gi|45478244|gb|AAS66293.1| LRRGT00202 [Rattus norvegicus] 41 0.047
gi|46441612|gb|EAL00908.1| hypothetical protein CaO19.14093 [Can... 41 0.047
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 41 0.047
gi|10140993|ref|NP_065570.1| putative immediate early protein [A... 41 0.047
gi|31543315|ref|NP_035010.2| nucleolin [Mus musculus] >gnl|BL_OR... 41 0.047
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand... 40 0.061
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 40 0.061
gi|28829875|gb|AAO52372.1| similar to Dictyostelium discoideum (... 40 0.061
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno... 40 0.061
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 40 0.061
gi|46309585|ref|NP_908998.1| retrotransposon-like 1 [Mus musculu... 40 0.061
gi|23479961|gb|EAA16652.1| SPRY domain, putative [Plasmodium yoe... 40 0.061
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno... 40 0.061
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 40 0.061
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno... 40 0.080
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 40 0.080
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [... 40 0.080
gi|46437420|gb|EAK96767.1| hypothetical protein CaO19.2850 [Cand... 40 0.080
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 40 0.080
gi|17508597|ref|NP_492170.1| AdaPTin or adaptin-related protein ... 40 0.080
gi|46437473|gb|EAK96819.1| hypothetical protein CaO19.10369 [Can... 40 0.080
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno... 40 0.080
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno... 40 0.080
gi|23508380|ref|NP_701049.1| hypothetical protein [Plasmodium fa... 40 0.080
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 40 0.080
gi|23509159|ref|NP_701827.1| hypothetical protein [Plasmodium fa... 40 0.080
gi|17508599|ref|NP_492171.1| AdaPTin or adaptin-related protein ... 40 0.080
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri... 40 0.080
gi|23486696|gb|EAA20872.1| hypothetical protein [Plasmodium yoel... 40 0.080
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati... 40 0.10
gi|42734064|gb|AAS38936.1| similar to Plasmodium falciparum (iso... 40 0.10
gi|9738913|gb|AAF97846.1| ABA binding protein [Hordeum vulgare] 40 0.10
gi|23479216|gb|EAA16104.1| hypothetical protein [Plasmodium yoel... 40 0.10
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 40 0.10
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno... 40 0.10
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 40 0.10
gi|23510031|ref|NP_702697.1| hypothetical protein [Plasmodium fa... 40 0.10
gi|50260382|gb|EAL23041.1| hypothetical protein CNBA8080 [Crypto... 39 0.14
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col... 39 0.14
gi|23613480|ref|NP_703324.1| glutamic acid-rich protein (garp) [... 39 0.14
gi|50426497|ref|XP_461845.1| unnamed protein product [Debaryomyc... 39 0.14
gi|39580381|emb|CAE71741.1| Hypothetical protein CBG18725 [Caeno... 39 0.14
gi|39586319|emb|CAE66730.1| Hypothetical protein CBG12079 [Caeno... 39 0.14
gi|28829296|gb|AAO51838.1| similar to hypothetical protein [Schi... 39 0.14
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 39 0.14
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 39 0.14
gi|23482054|gb|EAA18150.1| mature-parasite-infected erythrocyte ... 39 0.14
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec... 39 0.14
gi|4154097|gb|AAD04750.1| unknown [Human herpesvirus 8] 39 0.14
gi|23508430|ref|NP_701099.1| hypothetical protein [Plasmodium fa... 39 0.18
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno... 39 0.18
gi|21450271|ref|NP_659141.1| nuclear receptor coactivator 5 [Mus... 39 0.18
gi|39586987|emb|CAE62922.1| Hypothetical protein CBG07120 [Caeno... 39 0.18
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 39 0.18
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo... 39 0.18
gi|23481834|gb|EAA17992.1| probable RNA 3'-terminal phosphate cy... 39 0.18
gi|39580382|emb|CAE71742.1| Hypothetical protein CBG18726 [Caeno... 39 0.18
gi|49078064|ref|XP_402822.1| hypothetical protein UM05207.1 [Ust... 39 0.18
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi... 39 0.18
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass... 39 0.18
gi|32415627|ref|XP_328292.1| predicted protein [Neurospora crass... 39 0.18
gi|32482140|gb|AAP84416.1| FCA protein [Triticum aestivum] 39 0.18
gi|34525758|gb|AAQ73925.1| erythrocyte membrane protein 1 [Plasm... 39 0.18
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc... 39 0.23
gi|50419303|ref|XP_458176.1| unnamed protein product [Debaryomyc... 39 0.23
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 39 0.23
gi|23486190|gb|EAA20743.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [... 39 0.23
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [... 39 0.23
gi|39586364|emb|CAE74021.1| Hypothetical protein CBG21669 [Caeno... 39 0.23
gi|23613415|ref|NP_703259.1| asparagine-rich antigen Pfa35-2 [Pl... 39 0.23
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [... 39 0.23
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 39 0.23
gi|23612269|ref|NP_703849.1| hypothetical protein [Plasmodium fa... 39 0.23
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 38 0.30
gi|32482065|gb|AAP84389.1| FCA protein [Triticum aestivum] 38 0.30
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 38 0.30
gi|1580781|gb|AAB09603.1| beige-like protein [Homo sapiens] 38 0.30
gi|23508651|ref|NP_701320.1| hypothetical protein [Plasmodium fa... 38 0.30
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 38 0.30
gi|32482118|gb|AAP84411.1| FCA protein [Triticum aestivum] 38 0.30
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 38 0.30
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm... 38 0.30
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 38 0.30
gi|18858381|ref|NP_571122.1| calreticulin [Danio rerio] >gnl|BL_... 38 0.30
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl... 38 0.30
gi|16904381|ref|NP_006717.1| LPS-responsive vesicle trafficking,... 38 0.30
gi|23490473|gb|EAA22241.1| hypothetical protein [Plasmodium yoel... 38 0.30
gi|32482092|gb|AAP84399.1| FCA protein [Triticum aestivum] 38 0.30
gi|27503844|gb|AAH42232.1| MGC52607 protein [Xenopus laevis] 38 0.40
gi|104205|pir||S17196 transcription factor UBF2 - African clawed... 38 0.40
gi|65265|emb|CAA42523.1| a xenopus upstream binding factor [Xeno... 38 0.40
gi|50555313|ref|XP_505065.1| hypothetical protein [Yarrowia lipo... 38 0.40
gi|32482069|gb|AAP84391.1| FCA protein [Triticum aestivum] 38 0.40
gi|39590156|emb|CAE61154.1| Hypothetical protein CBG04920 [Caeno... 38 0.40
gi|39586591|emb|CAE73718.1| Hypothetical protein CBG21232 [Caeno... 38 0.40
gi|32482125|gb|AAP84413.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482130|gb|AAP84415.1| FCA protein [Triticum aestivum] 38 0.40
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 38 0.40
gi|32482059|gb|AAP84387.1| FCA protein [Triticum aestivum] 38 0.40
gi|23613722|ref|NP_704743.1| hypothetical protein [Plasmodium fa... 38 0.40
gi|23486500|gb|EAA20810.1| unknown protein, putative [Plasmodium... 38 0.40
gi|24213723|ref|NP_711204.1| conserved hypothetical protein [Lep... 38 0.40
gi|39583527|emb|CAE73985.1| Hypothetical protein CBG21616 [Caeno... 38 0.40
gi|39597388|emb|CAE59617.1| Hypothetical protein CBG03026 [Caeno... 38 0.40
gi|17552718|ref|NP_498862.1| C.Elegans Chromodomain protein (33.... 38 0.40
gi|32482388|gb|AAP84383.1| FCA protein [Triticum aestivum] 38 0.40
gi|21434741|gb|AAM53530.1| beige-like protein; CDC4L protein [Ho... 38 0.40
gi|32482367|gb|AAP84376.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482106|gb|AAP84405.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482067|gb|AAP84390.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482394|gb|AAP84386.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482096|gb|AAP84401.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482381|gb|AAP84380.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482383|gb|AAP84381.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482114|gb|AAP84409.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482076|gb|AAP84394.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482373|gb|AAP84379.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482072|gb|AAP84392.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482123|gb|AAP84412.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482110|gb|AAP84407.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482094|gb|AAP84400.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482079|gb|AAP84395.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482390|gb|AAP84384.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482100|gb|AAP84402.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482061|gb|AAP84388.1| FCA protein [Triticum aestivum] 38 0.40
gi|39588109|emb|CAE57341.1| Hypothetical protein CBG00277 [Caeno... 38 0.40
gi|32482149|gb|AAP84420.1| FCA-D1 [Triticum aestivum] 38 0.40
gi|32482116|gb|AAP84410.1| FCA protein [Triticum aestivum] 38 0.40
gi|50550293|ref|XP_502619.1| hypothetical protein [Yarrowia lipo... 38 0.40
gi|32482112|gb|AAP84408.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482142|gb|AAP84417.1| FCA-A1 [Triticum aestivum] >gnl|BL_OR... 38 0.40
gi|28558064|sp|Q8K3H7|CRTC_CRIGR Calreticulin precursor (CRP55) ... 38 0.40
gi|32482055|gb|AAP84374.1| FCA-A1 [Triticum aestivum] 38 0.40
gi|46121879|ref|XP_385493.1| hypothetical protein FG05317.1 [Gib... 38 0.40
gi|42519751|ref|NP_965681.1| hypothetical protein LJ0574 [Lactob... 38 0.40
gi|32482385|gb|AAP84382.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482127|gb|AAP84414.1| FCA protein [Triticum aestivum] 38 0.40
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis] 38 0.40
gi|32482074|gb|AAP84393.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482147|gb|AAP84419.1| FCA-B2 [Triticum aestivum] 38 0.40
gi|32482108|gb|AAP84406.1| FCA protein [Triticum aestivum] 38 0.40
gi|32482104|gb|AAP84404.1| FCA protein [Triticum aestivum] 38 0.40
gi|12847171|dbj|BAB27464.1| unnamed protein product [Mus musculus] 37 0.52
gi|136657|sp|P25980|UBF2_XENLA Nucleolar transcription factor 2 ... 37 0.52
gi|23482746|gb|EAA18637.1| hypothetical protein [Plasmodium yoel... 37 0.52
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 37 0.52
gi|113005|sp|P22620|ABRA_PLAFC 101 kDa malaria antigen (P101) (A... 37 0.52
gi|23508971|ref|NP_701639.1| 101 kd malaria antigen [Plasmodium ... 37 0.52
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 37 0.52
gi|7158835|gb|AAF37556.1| p101/acidic basic repeat antigen [Plas... 37 0.52
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 37 0.52
gi|47565158|ref|ZP_00236201.1| spore germination protein IA [Bac... 37 0.52
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r... 37 0.52
gi|32482081|gb|AAP84396.1| FCA protein [Triticum aestivum] 37 0.52
gi|128843|sp|P09405|NUCL_MOUSE Nucleolin (Protein C23) >gnl|BL_O... 37 0.52
gi|26325114|dbj|BAC26311.1| unnamed protein product [Mus musculus] 37 0.52
gi|113007|sp|P23745|ABRA_PLAFG 101 kDa malaria antigen (P101) (A... 37 0.52
gi|50257630|gb|EAL20335.1| hypothetical protein CNBF1460 [Crypto... 37 0.52
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C... 37 0.52
gi|23508771|ref|NP_701439.1| hypothetical protein [Plasmodium fa... 37 0.52
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 37 0.52
gi|32482102|gb|AAP84403.1| FCA protein [Triticum aestivum] 37 0.52
gi|2116688|dbj|BAA11178.1| deltaEF1 [Gallus gallus] 37 0.52
gi|45384096|ref|NP_990462.1| deltaEF1 [Gallus gallus] >gnl|BL_OR... 37 0.52
gi|39583246|emb|CAE60038.1| Hypothetical protein CBG03549 [Caeno... 37 0.52
gi|39586363|emb|CAE74020.1| Hypothetical protein CBG21668 [Caeno... 37 0.52
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 37 0.52
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis] 37 0.52
gi|25742663|ref|NP_446340.1| myelin transcription factor 1-like;... 37 0.52
gi|6679000|ref|NP_032692.1| myelin transcription factor 1-like; ... 37 0.52
gi|50414818|gb|AAH77321.1| Unknown (protein for MGC:80275) [Xeno... 37 0.68
gi|24639705|ref|NP_476674.2| CG12212-PA [Drosophila melanogaster... 37 0.68
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 37 0.68
gi|7511945|pir||T13594 hypothetical protein peb - fruit fly (Dro... 37 0.68
gi|419976|pir||S29130 calreticulin (clone 8) - African clawed fr... 37 0.68
gi|27802723|emb|CAD60828.1| SI:bZ1D10.2 (novel protein similar t... 37 0.68
gi|46435159|gb|EAK94547.1| hypothetical protein CaO19.1047 [Cand... 37 0.68
gi|7511868|pir||T13893 gene hindsight protein - fruit fly (Droso... 37 0.68
gi|23510237|ref|NP_702903.1| erythrocyte membrane protein 1 (PfE... 37 0.68
gi|28302252|gb|AAH46699.1| Calr-prov protein [Xenopus laevis] 37 0.68
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 37 0.68
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno... 37 0.68
gi|32422107|ref|XP_331497.1| predicted protein [Neurospora crass... 37 0.68
gi|30794328|ref|NP_851362.1| cyclic nucleotide gated channel bet... 37 0.68
gi|50405707|ref|XP_456492.1| unnamed protein product [Debaryomyc... 37 0.68
gi|46436702|gb|EAK96060.1| hypothetical protein CaO19.11847 [Can... 37 0.68
gi|26006249|dbj|BAC41467.1| mKIAA1106 protein [Mus musculus] 37 0.68
gi|23613114|ref|NP_703436.1| chromosome condensation protein, pu... 37 0.68
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 37 0.68
gi|108693|pir||A40437 glutamic acid-rich protein, retinal - bovi... 37 0.68
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi] 37 0.68
gi|11345234|gb|AAG34655.1| involucrin [Mus musculus] 37 0.68
gi|50545265|ref|XP_500170.1| hypothetical protein [Yarrowia lipo... 37 0.68
gi|39595447|emb|CAE60485.1| Hypothetical protein CBG04099 [Caeno... 37 0.68
gi|34558672|gb|AAQ75078.1| RAD2 [Cryptosporidium parvum] 37 0.68
gi|46226699|gb|EAK87678.1| XPG, DNA excision repair protein, fla... 37 0.68
gi|46431932|gb|EAK91449.1| hypothetical protein CaO19.7807 [Cand... 37 0.68
gi|17566482|ref|NP_507901.1| plasmodium falciparum trophozoite a... 37 0.68
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 37 0.68
gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD) ... 37 0.88
gi|7550159|gb|AAB21604.2| immunodominant 45-55 kda antigen [Pneu... 37 0.88
gi|4760402|gb|AAD29126.1| variant-specific surface protein [Plas... 37 0.88
gi|32565168|ref|NP_871885.1| putative protein family member, wit... 37 0.88
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno... 37 0.88
gi|46437429|gb|EAK96776.1| hypothetical protein CaO19.2859 [Cand... 37 0.88
gi|17505873|ref|NP_492830.1| putative prenylated protein family ... 37 0.88
gi|29828894|ref|NP_823528.1| hypothetical protein SAV2352 [Strep... 37 0.88
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno... 37 0.88
gi|23619008|ref|NP_704970.1| hypothetical protein [Plasmodium fa... 37 0.88
gi|17158415|ref|NP_477835.1| wsv313 [shrimp white spot syndrome ... 37 0.88
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot... 37 0.88
gi|50255862|gb|EAL18593.1| hypothetical protein CNBJ0190 [Crypto... 37 0.88
gi|29290093|gb|AAO67564.1| Pol protein [Drosophila virilis] 37 0.88
gi|15021546|gb|AAK77823.1| ORF154 [shrimp white spot syndrome vi... 37 0.88
gi|46437481|gb|EAK96827.1| hypothetical protein CaO19.10377 [Can... 37 0.88
gi|19481961|gb|AAL89237.1| WSSV369 [shrimp white spot syndrome v... 37 0.88
gi|17025966|dbj|BAB72094.1| histone acetyltransferase MORF [Maca... 37 0.88
gi|49121568|ref|XP_412424.1| hypothetical protein AN8287.2 [Aspe... 37 0.88
gi|23510025|ref|NP_702691.1| CGI-201 protein, short form [Plasmo... 37 0.88
gi|19115358|ref|NP_594446.1| hypothetical protein; extensin-like... 37 0.88
gi|29245456|gb|EAA37093.1| GLP_227_3888_5990 [Giardia lamblia AT... 37 0.88
gi|485519|pir||S33659 55K antigen - Pneumocystis carinii 37 0.88
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis] 37 0.88
gi|37046775|gb|AAH57987.1| 4930563C04Rik protein [Mus musculus] 37 0.88
gi|23957728|ref|NP_473185.2| hypothetical protein, conserved [Pl... 37 0.88
gi|10039425|dbj|BAB13348.1| ALR protein [Equus caballus] 37 0.88
gi|38230105|ref|NP_083507.2| proline-, glutamic acid-, leucine-r... 37 0.88
gi|23612884|ref|NP_704423.1| hypothetical protein [Plasmodium fa... 37 0.88
gi|16741201|gb|AAH16444.1| 4930563C04Rik protein [Mus musculus] 37 0.88
gi|47575818|ref|NP_001001253.1| hypothetical protein MGC69541 [X... 37 0.88
gi|50307341|ref|XP_453649.1| unnamed protein product [Kluyveromy... 36 1.2
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo... 36 1.2
gi|46227005|gb|EAK87955.1| membrane associated thioredoxin [Cryp... 36 1.2
gi|12408318|ref|NP_074052.1| Munc13-1 [Rattus norvegicus] >gnl|B... 36 1.2
gi|50401507|sp|Q7TMY8|URB1_MOUSE E3 ubiquitin protein ligase URE-B1 36 1.2
gi|2119370|pir||S58170 calreticulin precursor - maize >gnl|BL_OR... 36 1.2
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ... 36 1.2
gi|136655|sp|P25979|UBF1_XENLA Nucleolar transcription factor 1 ... 36 1.2
gi|16805025|ref|NP_473054.1| hypothetical protein [Plasmodium fa... 36 1.2
gi|33284886|emb|CAE17632.1| SI:bZ1G18.6.4 (novel protein similar... 36 1.2
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 36 1.2
gi|46308601|ref|ZP_00210793.1| COG0532: Translation initiation f... 36 1.2
gi|46442947|gb|EAL02232.1| hypothetical protein CaO19.8420 [Cand... 36 1.2
gi|23509702|ref|NP_702369.1| hypothetical protein [Plasmodium fa... 36 1.2
gi|47124142|gb|AAH70444.1| Ureb1 protein [Mus musculus] 36 1.2
gi|39587464|emb|CAE75118.1| Hypothetical protein CBG23045 [Caeno... 36 1.2
gi|34327956|dbj|BAA20771.2| KIAA0312 [Homo sapiens] 36 1.2
gi|41149776|ref|XP_037523.8| KIAA1076 protein [Homo sapiens] 36 1.2
gi|39579513|emb|CAE56338.1| Hypothetical protein CBG24007 [Caeno... 36 1.2
gi|237420|gb|AAB20096.1| calreticulin [rabbits, sketetal muscle,... 36 1.2
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 36 1.2
gi|32482090|gb|AAP84398.1| FCA protein [Triticum aestivum] 36 1.2
gi|29251343|gb|EAA42825.1| GLP_574_57226_57648 [Giardia lamblia ... 36 1.2
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto... 36 1.2
gi|23613194|ref|NP_703516.1| hypothetical protein [Plasmodium fa... 36 1.2
gi|23613548|ref|NP_704569.1| hypothetical protein [Plasmodium fa... 36 1.2
gi|13529464|gb|AAH05460.1| Nucleolin [Mus musculus] 36 1.2
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ... 36 1.2
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno... 36 1.2
gi|38101565|gb|EAA48511.1| hypothetical protein MG00169.4 [Magna... 36 1.2
gi|6680506|ref|NP_032438.1| involucrin [Mus musculus] >gnl|BL_OR... 36 1.2
gi|50744910|ref|XP_419932.1| PREDICTED: similar to myelin transc... 36 1.2
gi|23510226|ref|NP_702892.1| Plasmodium falciparum trophozoite a... 36 1.2
gi|50405879|ref|XP_456580.1| unnamed protein product [Debaryomyc... 36 1.2
gi|25154053|ref|NP_741059.1| predicted CDS, putative protein fam... 36 1.2
gi|23612500|ref|NP_704061.1| erythrocyte membrane protein 1 (PfE... 36 1.2
gi|49069416|ref|XP_398997.1| hypothetical protein UM01382.1 [Ust... 36 1.2
gi|50401532|sp|Q7Z6Z7|URB1_HUMAN E3 ubiquitin protein ligase URE... 36 1.2
gi|28277246|gb|AAH44068.1| Crc-prov protein [Xenopus laevis] 36 1.2
gi|23613862|ref|NP_704883.1| vesicle transport protein, putative... 36 1.2
gi|117504|sp|P15253|CRTC_RABIT Calreticulin precursor (CRP55) (C... 36 1.2
gi|49022808|dbj|BAC41411.2| mKIAA0312 protein [Mus musculus] 36 1.2
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 36 1.5
gi|46315323|ref|ZP_00215906.1| COG0793: Periplasmic protease [Bu... 36 1.5
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ... 36 1.5
gi|345588|pir||S29129 calreticulin precursor (clone 3) - African... 36 1.5
gi|39587623|emb|CAE58561.1| Hypothetical protein CBG01723 [Caeno... 36 1.5
gi|2271479|gb|AAC53450.1| sex determining protein [Mus musculus ... 36 1.5
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 36 1.5
gi|32420087|ref|XP_330487.1| predicted protein [Neurospora crass... 36 1.5
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 36 1.5
gi|50310441|ref|XP_455240.1| unnamed protein product [Kluyveromy... 36 1.5
gi|23619067|ref|NP_705029.1| hypothetical protein [Plasmodium fa... 36 1.5
gi|15235507|ref|NP_192190.1| expressed protein [Arabidopsis thal... 36 1.5
gi|11346341|pir||T46568 ATP-dependent RNA helicase cdc28 [simila... 36 1.5
gi|15241453|ref|NP_199241.1| zinc finger (C3HC4-type RING finger... 36 1.5
gi|46431947|gb|EAK91463.1| hypothetical protein CaO19.174 [Candi... 36 1.5
gi|39593222|emb|CAE64691.1| Hypothetical protein CBG09473 [Caeno... 36 1.5
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno... 36 1.5
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P... 36 1.5
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [... 36 1.5
gi|15235717|ref|NP_195495.1| expressed protein [Arabidopsis thal... 36 1.5
gi|49072784|ref|XP_400677.1| hypothetical protein UM03062.1 [Ust... 36 1.5
gi|23619548|ref|NP_705510.1| hypothetical protein [Plasmodium fa... 36 1.5
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno... 36 1.5
gi|18146874|dbj|BAB82492.1| nucleolar protein [Asterina pectinif... 36 1.5
gi|6996614|dbj|BAA90827.1| nucleic acid-associated protein 36 [A... 36 1.5
gi|17567971|ref|NP_508381.1| thioredoxin-like protein p19 (30.2 ... 36 1.5
gi|19311002|gb|AAL86704.1| Mnn4p [Candida albicans] 35 2.0
gi|15147335|ref|NP_066018.1| nuclear receptor coactivator 5; coa... 35 2.0
gi|33439098|gb|AAQ18694.1| calreticulin [Rhipicephalus sanguineus] 35 2.0
gi|15292493|gb|AAK93515.1| SD04057p [Drosophila melanogaster] 35 2.0
gi|6491868|gb|AAF14051.1| myelin transcription factor 1-like [Ho... 35 2.0
gi|19112478|ref|NP_595686.1| putative ATP-dependent RNA helicase... 35 2.0
gi|42568895|ref|NP_178414.2| ATP/GTP-binding protein family [Ara... 35 2.0
gi|24583482|ref|NP_723603.1| CG31872-PA [Drosophila melanogaster... 35 2.0
gi|27503875|gb|AAH42244.1| MGC53372 protein [Xenopus laevis] 35 2.0
gi|47847440|dbj|BAD21392.1| mFLJ00158 protein [Mus musculus] 35 2.0
gi|19484221|gb|AAH23359.1| 3632451O06Rik protein [Mus musculus] 35 2.0
gi|46228734|gb|EAK89604.1| hypothetical protein, transcripts ide... 35 2.0
gi|11360390|pir||T46608 zinc finger protein Png-1 - mouse >gnl|B... 35 2.0
gi|21166153|gb|AAM43770.1| similar to Mus musculus (Mouse). DEAD... 35 2.0
gi|46931312|gb|AAT06460.1| At4g02810 [Arabidopsis thaliana] 35 2.0
gi|11526821|gb|AAG36793.1| nuclear receptor coactivator CIA [Hom... 35 2.0
gi|6746588|gb|AAF27637.1| ecdysone-inducible gene E1 [Drosophila... 35 2.0
gi|28828918|gb|AAO51504.1| similar to Dictyostelium discoideum (... 35 2.0
gi|2623355|gb|AAC53435.1| sex determining protein [Mus musculus ... 35 2.0
gi|7487146|pir||T02711 probable calmodulin [imported] - Arabidop... 35 2.0
gi|50288037|ref|XP_446447.1| unnamed protein product [Candida gl... 35 2.0
gi|50421003|ref|XP_459044.1| unnamed protein product [Debaryomyc... 35 2.0
gi|33286946|gb|AAH55386.1| Unknown (protein for IMAGE:6795513) [... 35 2.0
gi|45361653|ref|NP_989404.1| hypothetical protein MGC76086 [Xeno... 35 2.0
gi|19862987|sp|Q10752|CC28_SCHPO Putative ATP-dependent RNA heli... 35 2.0
gi|32482371|gb|AAP84378.1| FCA protein [Triticum aestivum] 35 2.0
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 35 2.0
gi|23508849|ref|NP_701517.1| hypothetical protein [Plasmodium fa... 35 2.0
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 35 2.0
gi|32419593|ref|XP_330240.1| predicted protein [Neurospora crass... 35 2.0
gi|24652438|ref|NP_724932.1| CG11763-PA [Drosophila melanogaster... 35 2.0
gi|23509626|ref|NP_702293.1| hypothetical protein [Plasmodium fa... 35 2.0
gi|46249981|gb|AAH68406.1| LOC407703 protein [Danio rerio] 35 2.0
gi|39579446|emb|CAE56167.1| Hypothetical protein CBG23787 [Caeno... 35 2.0
gi|39590714|emb|CAE65084.1| Hypothetical protein CBG09942 [Caeno... 35 2.0
gi|33329250|gb|AAQ10025.1| putative esophageal gland cell secret... 35 2.0
gi|11544574|emb|CAC17668.1| dJ599F21.1 (KIAA1637) [Homo sapiens] 35 2.0
gi|42656368|ref|XP_039762.5| myelin transcription factor 1-like ... 35 2.0
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 35 2.6
gi|23478985|gb|EAA15932.1| KED, putative [Plasmodium yoelii yoelii] 35 2.6
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 35 2.6
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo... 35 2.6
gi|34869674|ref|XP_341308.1| similar to 3632451O06Rik protein [R... 35 2.6
gi|23509412|ref|NP_702079.1| hypothetical protein [Plasmodium fa... 35 2.6
gi|15223289|ref|NP_174552.1| HAC13 protein (HAC13) [Arabidopsis ... 35 2.6
gi|2340056|gb|AAB67287.1| troponin T [Mus musculus] 35 2.6
gi|6319300|ref|NP_009383.1| Protein whose overexpression affects... 35 2.6
gi|2340058|gb|AAB67288.1| troponin T [Mus musculus] 35 2.6
gi|23508177|ref|NP_700847.1| gene 11-1 protein precursor [Plasmo... 35 2.6
gi|19921992|ref|NP_610608.1| CG12340-PA [Drosophila melanogaster... 35 2.6
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens] 35 2.6
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD... 35 2.6
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil... 35 2.6
gi|23613384|ref|NP_703228.1| Ebl-1 like protein, putative [Plasm... 35 2.6
gi|47225643|emb|CAG07986.1| unnamed protein product [Tetraodon n... 35 2.6
gi|21703718|ref|NP_663331.1| RIKEN cDNA B230208J24 [Mus musculus... 35 2.6
gi|23612592|ref|NP_704153.1| hypothetical protein [Plasmodium fa... 35 2.6
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno... 35 2.6
gi|26522598|dbj|BAC44837.1| JESEBL [Plasmodium falciparum] 35 2.6
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens] 35 2.6
gi|15601545|ref|NP_233176.1| hypothetical protein VCA0790 [Vibri... 35 2.6
gi|23481602|gb|EAA17831.1| hypothetical protein [Plasmodium yoel... 35 2.6
gi|23619502|ref|NP_705464.1| hypothetical protein [Plasmodium fa... 35 2.6
gi|50553466|ref|XP_504144.1| hypothetical protein [Yarrowia lipo... 35 2.6
gi|46228499|gb|EAK89369.1| saccharomyces Yor006cp like protein c... 35 2.6
gi|16804991|ref|NP_473020.1| hypothetical protein [Plasmodium fa... 35 2.6
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 35 2.6
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 35 2.6
gi|631545|pir||S43376 calreticulin, brain isoform 1 - bovine >gn... 35 2.6
gi|27806723|ref|NP_776425.1| calreticulin; calrectulin; calregul... 35 2.6
gi|38089141|ref|XP_146248.3| MYST histone acetyltransferase (mon... 35 2.6
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno... 35 2.6
gi|5326838|gb|AAD42061.1| histidine-rich calcium-binding protein... 35 2.6
gi|32482392|gb|AAP84385.1| FCA protein [Triticum aestivum] 35 2.6
gi|39584611|emb|CAE72364.1| Hypothetical protein CBG19514 [Caeno... 35 2.6
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (... 35 2.6
gi|6680836|ref|NP_031617.1| calreticulin [Mus musculus] >gnl|BL_... 35 2.6
gi|207365|gb|AAA96446.1| troponin T class Ia alpha-2 [Rattus nor... 35 2.6
gi|1256736|gb|AAA96476.1| troponin T class Ia beta-2 [Rattus nor... 35 2.6
gi|24641548|ref|NP_572806.1| CG11146-PA [Drosophila melanogaster... 35 3.4
gi|50302725|ref|XP_451299.1| unnamed protein product [Kluyveromy... 35 3.4
gi|23480026|gb|EAA16699.1| hypothetical protein [Plasmodium yoel... 35 3.4
gi|9309332|dbj|BAB03214.1| grpE [Geobacillus thermoglucosidasius] 35 3.4
gi|32421759|ref|XP_331323.1| hypothetical protein [Neurospora cr... 35 3.4
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans] 35 3.4
gi|24656678|ref|NP_647798.1| CG12017-PA [Drosophila melanogaster... 35 3.4
gi|50546607|ref|XP_500773.1| hypothetical protein [Yarrowia lipo... 35 3.4
gi|46432316|gb|EAK91804.1| hypothetical protein CaO19.3704 [Cand... 35 3.4
>gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD)
(col-39) [Caenorhabditis elegans]
gi|2493777|sp|Q09455|CC39_CAEEL Cuticle collagen 39 precursor
gi|7495771|pir||T19142 hypothetical protein C09G5.4 -
Caenorhabditis elegans
gi|3874101|emb|CAA86757.1| Hypothetical protein C09G5.4
[Caenorhabditis elegans]
Length = 323
Score = 211 bits (538), Expect = 2e-53
Identities = 106/135 (78%), Positives = 106/135 (78%)
Frame = +1
Query: 1 MTGPTCLAVVAGISGVFVFGALFSVAQIYNDISSFADNAHRELGEFKGFANDAWNSMVNH 180
MTGPTCLAVVAGISGVFVFGALFSVAQIYNDISSFADNAHRELGEFKGFANDAWNSMVNH
Sbjct: 1 MTGPTCLAVVAGISGVFVFGALFSVAQIYNDISSFADNAHRELGEFKGFANDAWNSMVNH 60
Query: 181 DDATRVARSVFVRRHKKHSQCNCGPQASNCXXXXXXXXXXXXDRGLDXXXXXXXXXXXXX 360
DDATRVARSVFVRRHKKHSQCNCGPQASNC DRGLD
Sbjct: 61 DDATRVARSVFVRRHKKHSQCNCGPQASNCPAGPPGPPGAPGDRGLDGQPGGAGNPGQPG 120
Query: 361 XXXXKSHEQQECIKC 405
KSHEQQECIKC
Sbjct: 121 VAGPKSHEQQECIKC 135
Score = 52.8 bits (125), Expect = 1e-05
Identities = 23/23 (100%), Positives = 23/23 (100%)
Frame = +1
Query: 802 YCPCPSRSGSSSAVETGAAEQGY 870
YCPCPSRSGSSSAVETGAAEQGY
Sbjct: 268 YCPCPSRSGSSSAVETGAAEQGY 290