Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C09G5_5
(954 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ... 184 3e-45
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno... 179 6e-44
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C... 153 5e-36
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [... 151 2e-35
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno... 150 4e-35
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno... 145 1e-33
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ... 139 7e-32
gi|84434|pir||PS0036 collagen col-7 - Caenorhabditis elegans (fr... 123 7e-27
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 110 6e-23
gi|687634|gb|AAA62504.1| collagen 94 6e-18
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 92 1e-17
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 79 1e-13
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ... 74 5e-12
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno... 73 1e-11
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 72 1e-11
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 72 2e-11
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 68 3e-10
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 67 6e-10
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 66 1e-09
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 64 5e-09
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno... 63 1e-08
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 63 1e-08
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 61 4e-08
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 59 2e-07
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 58 3e-07
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 58 4e-07
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 58 4e-07
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 57 6e-07
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 57 6e-07
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno... 57 8e-07
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 57 8e-07
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ... 57 8e-07
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 56 1e-06
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno... 55 2e-06
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 55 2e-06
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ... 55 3e-06
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 55 3e-06
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 55 3e-06
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno... 54 7e-06
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 54 7e-06
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno... 54 7e-06
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 53 9e-06
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 53 9e-06
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 53 1e-05
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 52 2e-05
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 52 2e-05
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 52 2e-05
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ... 52 3e-05
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 52 3e-05
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 51 3e-05
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 51 3e-05
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [... 50 6e-05
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 50 6e-05
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ... 50 7e-05
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 50 1e-04
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno... 50 1e-04
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 50 1e-04
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 50 1e-04
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ... 49 1e-04
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 49 1e-04
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 49 1e-04
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 49 1e-04
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno... 49 2e-04
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 49 2e-04
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno... 49 2e-04
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 49 2e-04
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 49 2e-04
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 49 2e-04
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 49 2e-04
gi|23510226|ref|NP_702892.1| Plasmodium falciparum trophozoite a... 48 3e-04
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 48 4e-04
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 48 4e-04
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 48 4e-04
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 47 5e-04
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [... 47 5e-04
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [... 47 6e-04
gi|23510031|ref|NP_702697.1| hypothetical protein [Plasmodium fa... 47 6e-04
gi|39579123|emb|CAE56688.1| Hypothetical protein CBG24466 [Caeno... 47 6e-04
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 47 8e-04
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 47 8e-04
gi|16198327|gb|AAL14009.1| SD07158p [Drosophila melanogaster] 46 0.001
gi|20129887|ref|NP_610708.1| CG13185-PA [Drosophila melanogaster... 46 0.001
gi|23619548|ref|NP_705510.1| hypothetical protein [Plasmodium fa... 46 0.001
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 46 0.001
gi|50550967|ref|XP_502957.1| hypothetical protein [Yarrowia lipo... 46 0.001
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 46 0.001
gi|47565158|ref|ZP_00236201.1| spore germination protein IA [Bac... 45 0.002
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 45 0.002
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 45 0.002
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno... 45 0.002
gi|323131|pir||C44863 trophozoite antigen R45 (clones R23 and R4... 45 0.002
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa... 45 0.002
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 45 0.002
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 45 0.002
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 45 0.003
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna... 45 0.003
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc... 45 0.003
gi|28374176|gb|AAH46263.1| LOC398566 protein [Xenopus laevis] 45 0.003
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot... 44 0.004
gi|23612220|ref|NP_703800.1| myosin-like protein, putative [Plas... 44 0.004
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno... 44 0.004
gi|33563114|dbj|BAC81700.1| serine-rich protein [Entamoeba histo... 44 0.005
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 44 0.005
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ... 44 0.005
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 44 0.005
gi|32421957|ref|XP_331422.1| predicted protein [Neurospora crass... 44 0.005
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g... 44 0.005
gi|25991430|emb|CAD53080.1| hypothetical protein [Trypanosoma br... 44 0.007
gi|23613862|ref|NP_704883.1| vesicle transport protein, putative... 44 0.007
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 44 0.007
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 44 0.007
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 43 0.009
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno... 43 0.009
gi|23510135|ref|NP_702801.1| hypothetical protein [Plasmodium fa... 43 0.012
gi|25410974|pir||B84434 hypothetical protein At2g02200 [imported... 43 0.012
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi... 43 0.012
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri... 43 0.012
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno... 43 0.012
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 42 0.016
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno... 42 0.016
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi] 42 0.016
gi|50806838|ref|XP_428858.1| PREDICTED: similar to tumor-related... 42 0.016
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-... 42 0.020
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno... 42 0.020
gi|630472|pir||A54138 acidic repetitive protein arp1 - Tetrahyme... 42 0.020
gi|34935443|ref|XP_345716.1| similar to hypothetical protein [Ra... 42 0.020
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [... 42 0.020
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 42 0.020
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 42 0.020
gi|23509439|ref|NP_702106.1| hypothetical protein [Plasmodium fa... 42 0.020
gi|23509422|ref|NP_702089.1| hypothetical protein [Plasmodium fa... 42 0.020
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,... 42 0.027
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [... 42 0.027
gi|305074|gb|AAA29104.1| K2 42 0.027
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ... 42 0.027
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha... 42 0.027
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 42 0.027
gi|17551634|ref|NP_508124.1| kinase (40.9 kD) (XB213) [Caenorhab... 42 0.027
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ... 42 0.027
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 38 0.031
gi|786136|gb|AAA99499.1| polymorphic immunodominant molecule 41 0.035
gi|24374614|ref|NP_718657.1| TPR domain protein [Shewanella onei... 41 0.035
gi|24641032|ref|NP_727427.1| CG2890-PA [Drosophila melanogaster]... 41 0.035
gi|23486147|gb|EAA20734.1| hypothetical protein [Plasmodium yoel... 41 0.035
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno... 41 0.035
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 41 0.035
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ... 41 0.035
gi|46115698|ref|XP_383867.1| hypothetical protein FG03691.1 [Gib... 41 0.035
gi|32410635|ref|XP_325798.1| hypothetical protein [Neurospora cr... 41 0.035
gi|46434336|gb|EAK93748.1| hypothetical protein CaO19.4488 [Cand... 41 0.035
gi|26000376|gb|AAN75486.1| dentin matrix protein 1 [Kerivoula ha... 41 0.045
gi|6472600|dbj|BAA87057.1| unconventional myosin heavy chain [Ch... 41 0.045
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 41 0.045
gi|28571998|ref|NP_788769.1| CG12071-PB [Drosophila melanogaster... 41 0.045
gi|6753682|ref|NP_034210.1| dentin sialophosphoprotein [Mus musc... 41 0.045
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl... 41 0.045
gi|17865460|sp|P97399|DSPP_MOUSE Dentin sialophosphoprotein prec... 41 0.045
gi|9453839|dbj|BAB03273.1| myosin [Chara corallina] 41 0.045
gi|23613490|ref|NP_703334.1| hypothetical protein [Plasmodium fa... 41 0.045
gi|50260382|gb|EAL23041.1| hypothetical protein CNBA8080 [Crypto... 41 0.045
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno... 41 0.045
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil... 40 0.059
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ... 40 0.059
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 40 0.059
gi|33563122|dbj|BAC81704.1| serine-rich protein [Entamoeba histo... 40 0.059
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 40 0.059
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd... 40 0.059
gi|4154097|gb|AAD04750.1| unknown [Human herpesvirus 8] 40 0.059
gi|28828532|gb|AAO51140.1| similar to Homo sapiens (Human). FLJ0... 40 0.059
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno... 40 0.059
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ... 40 0.059
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ... 40 0.059
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr... 40 0.077
gi|24657526|ref|NP_728981.1| CG32251-PA [Drosophila melanogaster... 40 0.077
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno... 40 0.077
gi|24475480|dbj|BAC22735.1| serine-rich protein [Entamoeba histo... 40 0.077
gi|33563136|dbj|BAC81711.1| serine-rich protein [Entamoeba histo... 40 0.077
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C... 40 0.077
gi|23957728|ref|NP_473185.2| hypothetical protein, conserved [Pl... 40 0.077
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [... 40 0.077
gi|23612269|ref|NP_703849.1| hypothetical protein [Plasmodium fa... 40 0.077
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ... 40 0.077
gi|27469150|ref|NP_765787.1| conserved hypothetical protein [Sta... 40 0.077
gi|42662517|ref|XP_377721.1| similar to Hypothetical protein CBG... 40 0.10
gi|39597388|emb|CAE59617.1| Hypothetical protein CBG03026 [Caeno... 40 0.10
gi|3024638|sp|Q62565|SRY_MUSSI Sex-determining region Y protein ... 40 0.10
gi|23613117|ref|NP_703439.1| RNA polymerase I [Plasmodium falcip... 40 0.10
gi|84964|pir||S15008 gene disco protein - fruit fly (Drosophila ... 40 0.10
gi|24642412|ref|NP_523362.2| CG9908-PA [Drosophila melanogaster]... 40 0.10
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno... 40 0.10
gi|37220738|gb|AAQ89710.1| rhoptry associated membrane antigen [... 40 0.10
gi|45185293|ref|NP_983010.1| ABR064Wp [Eremothecium gossypii] >g... 40 0.10
gi|128099|sp|P17691|NEUM_CARAU Neuromodulin (Axonal membrane pro... 40 0.10
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati... 40 0.10
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo... 40 0.10
gi|992950|dbj|BAA05951.1| OPN-c [Homo sapiens] 40 0.10
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp... 40 0.10
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli... 40 0.10
gi|6065831|emb|CAB58233.1| headcase protein [Drosophila melanoga... 39 0.13
gi|46437304|gb|EAK96653.1| hypothetical protein CaO19.9519 [Cand... 39 0.13
gi|46441356|gb|EAL00654.1| hypothetical protein CaO19.2088 [Cand... 39 0.13
gi|28571930|ref|NP_788768.1| CG15532-PC [Drosophila melanogaster... 39 0.13
gi|134874|sp|P16230|SRCH_RABIT Sarcoplasmic reticulum histidine-... 39 0.13
gi|32416166|ref|XP_328561.1| hypothetical protein [Neurospora cr... 39 0.13
gi|46109504|ref|XP_381810.1| hypothetical protein FG01634.1 [Gib... 39 0.13
gi|11345242|gb|AAG34659.1| involucrin [Mus musculus] 39 0.13
gi|50554275|ref|XP_504546.1| hypothetical protein [Yarrowia lipo... 39 0.13
gi|39979119|emb|CAE85494.1| putative protein [Neurospora crassa] 39 0.13
gi|50286091|ref|XP_445474.1| unnamed protein product [Candida gl... 39 0.13
gi|26000388|gb|AAN75484.1| dentin matrix protein 1 [Plecotus tow... 39 0.13
gi|34868438|ref|XP_232942.2| similar to RIKEN cDNA 2610207I16 [R... 39 0.13
gi|46249455|gb|AAH68622.1| LOC414671 protein [Xenopus laevis] 39 0.17
gi|50306211|ref|XP_453068.1| unnamed protein product [Kluyveromy... 39 0.17
gi|26000392|gb|AAN75479.1| dentin matrix protein 1 [Noctilio lep... 39 0.17
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 39 0.17
gi|48597006|ref|NP_001001588.1| MYST histone acetyltransferase (... 39 0.17
gi|42783920|ref|NP_981167.1| spore germination protein GerHA [Ba... 39 0.17
gi|34222535|sp|Q8BL66|EEA1_MOUSE Early endosome antigen 1 >gnl|B... 39 0.17
gi|39590750|emb|CAE65122.1| Hypothetical protein CBG09987 [Caeno... 39 0.17
gi|46434301|gb|EAK93714.1| hypothetical protein CaO19.11964 [Can... 39 0.17
gi|22788805|ref|NP_690517.1| hypothetical protein K06A9.1a [Heli... 39 0.17
gi|124733|sp|P14590|INVO_LEMCA Involucrin >gnl|BL_ORD_ID|1468131... 39 0.17
gi|46444915|gb|EAL04187.1| hypothetical protein CaO19.12167 [Can... 39 0.17
gi|50053824|ref|NP_001001932.1| early endosome antigen 1 [Mus mu... 39 0.17
gi|46444759|gb|EAL04032.1| hypothetical protein CaO19.4697 [Cand... 39 0.17
gi|38090688|ref|XP_125851.4| similar to Early endosome antigen 1... 39 0.17
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc... 39 0.23
gi|33563144|dbj|BAC81715.1| serine-rich protein [Entamoeba histo... 39 0.23
gi|39582634|emb|CAE73738.1| Hypothetical protein CBG21264 [Caeno... 39 0.23
gi|13195656|ref|NP_077192.1| RIKEN cDNA 1110030K22 [Mus musculus... 39 0.23
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc... 39 0.23
gi|39579513|emb|CAE56338.1| Hypothetical protein CBG24007 [Caeno... 39 0.23
gi|26000362|gb|AAN75478.1| dentin matrix protein 1 [Noctilio alb... 39 0.23
gi|3617817|emb|CAA12197.1| SRF related protein [Dictyostelium di... 39 0.23
gi|27531705|dbj|BAC54278.1| equarin-S [Gallus gallus] 39 0.23
gi|31220056|ref|XP_316870.1| ENSANGP00000017739 [Anopheles gambi... 39 0.23
gi|6677817|ref|NP_033126.1| repetin [Mus musculus] >gnl|BL_ORD_I... 39 0.23
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 39 0.23
gi|33859738|ref|NP_084112.1| DNA segment, Chr X, Brigham & Women... 39 0.23
gi|26000372|gb|AAN75485.1| dentin matrix protein 1 [Harpiocephal... 39 0.23
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 39 0.23
gi|24583482|ref|NP_723603.1| CG31872-PA [Drosophila melanogaster... 39 0.23
gi|22788715|ref|NP_690423.1| hypothetical protein HZV_4 [Helioth... 38 0.29
gi|305076|gb|AAA29105.1| K2 38 0.29
gi|10048257|gb|AAG12326.1| glutamate-rich protein [Plasmodium fa... 38 0.29
gi|24475476|dbj|BAC22733.1| serine-rich protein [Entamoeba histo... 38 0.29
gi|21402779|ref|NP_658764.1| hypothetical protein predicted by G... 38 0.29
gi|15232767|ref|NP_190311.1| hypothetical protein [Arabidopsis t... 38 0.29
gi|24654027|ref|NP_725526.1| CG8421-PD [Drosophila melanogaster]... 38 0.29
gi|39939139|ref|NP_950905.1| hypothetical protein [Onion yellows... 38 0.29
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno... 38 0.29
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm... 38 0.29
gi|23508147|ref|NP_700817.1| glutamate-rich protein [Plasmodium ... 38 0.29
gi|15792502|ref|NP_282325.1| highly acidic protein [Campylobacte... 38 0.29
gi|6323686|ref|NP_013757.1| Involved in cell-type-specific trans... 38 0.29
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ... 38 0.29
gi|27367908|ref|NP_763435.1| TPR repeat containing protein [Vibr... 38 0.29
gi|50728478|ref|XP_416138.1| PREDICTED: similar to Early endosom... 38 0.29
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [... 38 0.38
gi|27370980|gb|AAH41492.1| FLJ10006 protein [Xenopus laevis] 38 0.38
gi|32419038|ref|XP_329997.1| hypothetical protein [Neurospora cr... 38 0.38
gi|23613080|ref|NP_703402.1| hypothetical protein [Plasmodium fa... 38 0.38
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 38 0.38
gi|23509044|ref|NP_701712.1| hypothetical protein [Plasmodium fa... 38 0.38
gi|32415081|ref|XP_328020.1| hypothetical protein [Neurospora cr... 38 0.38
gi|22094614|gb|AAM91941.1| Ure2p [Kluyveromyces marxianus] 38 0.38
gi|47221067|emb|CAG12761.1| unnamed protein product [Tetraodon n... 38 0.38
gi|45201188|ref|NP_986758.1| AGR093Wp [Eremothecium gossypii] >g... 38 0.38
gi|39580381|emb|CAE71741.1| Hypothetical protein CBG18725 [Caeno... 38 0.38
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy... 38 0.38
gi|23613218|ref|NP_703540.1| hypothetical protein [Plasmodium fa... 38 0.38
gi|50416378|gb|AAH77238.1| FLJ10006 protein [Xenopus laevis] 38 0.38
gi|11359653|pir||T49333 related to mitotic apparatus protein p62... 38 0.38
gi|28850391|gb|AAO53165.1| similar to midasin, a large protein w... 38 0.38
gi|45185072|ref|NP_982789.1| ABL158Cp [Eremothecium gossypii] >g... 38 0.38
gi|46123749|ref|XP_386428.1| hypothetical protein FG06252.1 [Gib... 38 0.38
gi|50752873|ref|XP_413786.1| PREDICTED: similar to hypothetical ... 38 0.38
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo... 38 0.38
gi|50290531|ref|XP_447697.1| unnamed protein product [Candida gl... 38 0.38
gi|46438500|gb|EAK97830.1| hypothetical protein CaO19.978 [Candi... 38 0.38
gi|11467826|ref|NP_050877.1| hypothetical chloroplast RF2 [Nephr... 38 0.38
gi|113005|sp|P22620|ABRA_PLAFC 101 kDa malaria antigen (P101) (A... 37 0.50
gi|23508971|ref|NP_701639.1| 101 kd malaria antigen [Plasmodium ... 37 0.50
gi|13537216|dbj|BAB40784.1| HrDoublecortin [Halocynthia roretzi] 37 0.50
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ... 37 0.50
gi|7494885|pir||T15348 hypothetical protein B0350.1 - Caenorhabd... 37 0.50
gi|46431969|gb|EAK91483.1| hypothetical protein CaO19.4062 [Cand... 37 0.50
gi|7158835|gb|AAF37556.1| p101/acidic basic repeat antigen [Plas... 37 0.50
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib... 37 0.50
gi|33563116|dbj|BAC81701.1| serine-rich protein [Entamoeba histo... 37 0.50
gi|34485686|gb|AAQ73228.1| M protein [Streptococcus pyogenes] 37 0.50
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ... 37 0.50
gi|113007|sp|P23745|ABRA_PLAFG 101 kDa malaria antigen (P101) (A... 37 0.50
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi... 37 0.50
gi|33563130|dbj|BAC81708.1| serine-rich protein [Entamoeba histo... 37 0.50
gi|50732091|ref|XP_418474.1| PREDICTED: similar to nestin [Gallu... 37 0.50
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno... 37 0.50
gi|28850410|gb|AAL92314.2| hypothetical protein [Dictyostelium d... 37 0.50
gi|33563132|dbj|BAC81709.1| serine-rich protein [Entamoeba histo... 37 0.50
gi|33563128|dbj|BAC81707.1| serine-rich protein [Entamoeba histo... 37 0.50
gi|22655493|gb|AAN04082.1| M76 [Streptococcus pyogenes] 37 0.50
gi|108693|pir||A40437 glutamic acid-rich protein, retinal - bovi... 37 0.50
gi|23507939|ref|NP_700609.1| hypothetical protein [Plasmodium fa... 37 0.50
gi|462434|sp|P34099|KAPC_DICDI cAMP-dependent protein kinase cat... 37 0.50
gi|241277|gb|AAB20716.1| serine/threonine protein kinase [Dictyo... 37 0.50
gi|34881305|ref|XP_228502.2| similar to hypothetical protein FLJ... 37 0.50
gi|33563124|dbj|BAC81705.1| serine-rich protein [Entamoeba histo... 37 0.50
gi|33563140|dbj|BAC81713.1| serine-rich protein [Entamoeba histo... 37 0.50
gi|24641056|ref|NP_572641.1| CG15295-PA [Drosophila melanogaster... 37 0.50
gi|4503469|ref|NP_003557.1| early endosome antigen 1, 162kD; ear... 37 0.50
gi|33598984|gb|AAQ23117.1| M73 [Streptococcus pyogenes] 37 0.50
gi|37676035|ref|NP_936431.1| TPR repeat containing protein [Vibr... 37 0.50
gi|24762707|ref|NP_611955.2| CG4806-PA [Drosophila melanogaster]... 37 0.50
gi|32565935|ref|NP_500902.2| UNCoordinated locomotion UNC-44, an... 37 0.50
gi|23820861|gb|AAA93447.2| Uncoordinated protein 44, isoform f [... 37 0.50
gi|33563142|dbj|BAC81714.1| serine-rich protein [Entamoeba histo... 37 0.50
gi|48137091|ref|XP_396786.1| similar to ENSANGP00000017802 [Apis... 37 0.50
gi|28828697|gb|AAO51294.1| similar to Dictyostelium discoideum (... 37 0.50
gi|6688939|emb|CAB65345.1| PR7 protein [Plasmodium falciparum] 37 0.50
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 37 0.50
gi|46228472|gb|EAK89342.1| DNA polymerase epsilon catalytic subu... 37 0.50
gi|33563126|dbj|BAC81706.1| serine-rich protein [Entamoeba histo... 37 0.50
gi|24659555|ref|NP_729188.1| CG32394-PA [Drosophila melanogaster... 37 0.65
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis] 37 0.65
gi|27924183|gb|AAH44970.1| Canx-prov protein [Xenopus laevis] 37 0.65
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 37 0.65
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno... 37 0.65
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can... 37 0.65
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno... 37 0.65
gi|16768066|gb|AAL28252.1| GH14591p [Drosophila melanogaster] 37 0.65
gi|24654024|ref|NP_725525.1| CG8421-PA [Drosophila melanogaster]... 37 0.65
gi|15225709|ref|NP_180818.1| barren family protein [Arabidopsis ... 37 0.65
gi|50288457|ref|XP_446658.1| unnamed protein product [Candida gl... 37 0.65
gi|134435|sp|P21138|SERA_ENTHI Serine-rich 25 kDa antigen protei... 37 0.65
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 37 0.65
gi|17647175|ref|NP_523757.1| CG8421-PB [Drosophila melanogaster]... 37 0.65
gi|23509322|ref|NP_701989.1| hypothetical protein [Plasmodium fa... 37 0.65
gi|24659430|ref|NP_729175.1| CG32397-PA [Drosophila melanogaster... 37 0.65
gi|28829868|gb|AAO52365.1| similar to T10C6.5.p [Caenorhabditis ... 37 0.65
gi|23510025|ref|NP_702691.1| CGI-201 protein, short form [Plasmo... 37 0.65
gi|19481961|gb|AAL89237.1| WSSV369 [shrimp white spot syndrome v... 37 0.65
gi|24475470|dbj|BAC22730.1| serine-rich protein [Entamoeba histo... 37 0.65
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 37 0.65
gi|11346371|pir||T47235 sex determining protein [imported] - wes... 37 0.65
gi|18495759|emb|CAC87577.1| surface protein [Theileria annulata] 37 0.65
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno... 37 0.65
gi|23613415|ref|NP_703259.1| asparagine-rich antigen Pfa35-2 [Pl... 37 0.65
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 37 0.65
gi|33303458|gb|AAQ02305.1| dentin matrix protein 1 [Oryzomys pal... 37 0.65
gi|34903276|ref|NP_912985.1| unnamed protein product [Oryza sati... 37 0.65
gi|19882261|gb|AAC00208.2| paranemin [Gallus gallus] 37 0.65
gi|39586591|emb|CAE73718.1| Hypothetical protein CBG21232 [Caeno... 37 0.65
gi|45190780|ref|NP_985034.1| AER177Wp [Eremothecium gossypii] >g... 37 0.86
gi|23508148|ref|NP_700818.1| merozoite surface protein 3 [Plasmo... 37 0.86
gi|30794328|ref|NP_851362.1| cyclic nucleotide gated channel bet... 37 0.86
gi|2981225|gb|AAC38597.1| lipase precursor [Staphylococcus epide... 37 0.86
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 37 0.86
gi|13182946|gb|AAK14999.1| centromere binding protein 1 [Candida... 37 0.86
gi|8489017|gb|AAF75561.1| HDCGC21P [Homo sapiens] 37 0.86
gi|10720184|sp|Q9XSY9|OSTP_SHEEP Osteopontin precursor (Bone sia... 37 0.86
gi|24475490|dbj|BAC22740.1| serine-rich protein [Entamoeba histo... 37 0.86
gi|45550130|ref|NP_608921.2| CG14023-PA [Drosophila melanogaster... 37 0.86
gi|23509816|ref|NP_702483.1| hypothetical protein [Plasmodium fa... 37 0.86
gi|6746588|gb|AAF27637.1| ecdysone-inducible gene E1 [Drosophila... 37 0.86
gi|24660872|ref|NP_524849.2| CG32356-PA [Drosophila melanogaster... 37 0.86
gi|39587052|emb|CAE62987.1| Hypothetical protein CBG07214 [Caeno... 37 0.86
gi|13751875|gb|AAK38607.1| unknown protein [Arabidopsis thaliana] 37 0.86
gi|18466682|ref|NP_569489.1| hypothetical protein HCM2.0017c [Sa... 37 0.86
gi|50258980|gb|EAL21661.1| hypothetical protein CNBC6970 [Crypto... 37 0.86
gi|400685|sp|P31097|OSTP_RABIT Osteopontin precursor (Bone sialo... 37 0.86
gi|49077200|ref|XP_402493.1| hypothetical protein UM04878.1 [Ust... 37 0.86
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ... 37 0.86
gi|50288897|ref|XP_446878.1| unnamed protein product [Candida gl... 37 0.86
gi|39590157|emb|CAE61155.1| Hypothetical protein CBG04921 [Caeno... 37 0.86
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA... 37 0.86
gi|49069416|ref|XP_398997.1| hypothetical protein UM01382.1 [Ust... 37 0.86
gi|6648932|gb|AAF21294.1| lipase [Staphylococcus haemolyticus] 37 0.86
gi|50838816|ref|NP_001002871.1| transcriptional intermediary fac... 37 0.86
gi|33329250|gb|AAQ10025.1| putative esophageal gland cell secret... 37 0.86
gi|50259073|gb|EAL21750.1| hypothetical protein CNBC4520 [Crypto... 37 0.86
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [... 37 0.86
gi|34222508|sp|Q15075|EEA1_HUMAN Early endosome antigen 1 (Endos... 37 0.86
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col... 37 0.86
gi|24648119|ref|NP_650778.1| CG6026-PA [Drosophila melanogaster]... 37 0.86
gi|50555908|ref|XP_505362.1| YlXPR6 [Yarrowia lipolytica] >gnl|B... 36 1.1
gi|49085954|ref|XP_405060.1| hypothetical protein AN0923.2 [Aspe... 36 1.1
gi|46442947|gb|EAL02232.1| hypothetical protein CaO19.8420 [Cand... 36 1.1
gi|30039726|ref|NP_780385.1| RIKEN cDNA 1700013E18 [Mus musculus... 36 1.1
gi|50794060|ref|XP_423656.1| PREDICTED: transitin [Gallus gallus] 36 1.1
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno... 36 1.1
gi|45384402|ref|NP_990272.1| chromo-helicase-DNA-binding on the ... 36 1.1
gi|6579193|ref|NP_011944.2| Component of the nonsense-mediated m... 36 1.1
gi|17543780|ref|NP_502799.1| putative nuclear protein, with 2 co... 36 1.1
gi|50758913|ref|XP_417476.1| PREDICTED: similar to Hypothetical ... 36 1.1
gi|46121735|ref|XP_385422.1| hypothetical protein FG05246.1 [Gib... 36 1.1
gi|37595272|gb|AAQ94521.1| M protein [Streptococcus pyogenes] 36 1.1
gi|24664026|ref|NP_729947.1| CG32133-PA [Drosophila melanogaster... 36 1.1
gi|7494158|pir||T28156 DNA-directed RNA polymerase homolog - mal... 36 1.1
gi|23509024|ref|NP_701692.1| hypothetical protein [Plasmodium fa... 36 1.1
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 36 1.1
gi|7510771|pir||T29919 hypothetical protein ZC449.5 - Caenorhabd... 36 1.1
gi|129260|sp|P10451|OSTP_HUMAN Osteopontin precursor (Bone sialo... 36 1.1
gi|992948|dbj|BAA05949.1| OPN-a [Homo sapiens] 36 1.1
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno... 36 1.1
gi|31414258|emb|CAD58827.1| putative oral-facial-digital syndrom... 36 1.1
gi|17570615|ref|NP_508857.1| putative protein (XF654) [Caenorhab... 36 1.1
gi|500836|gb|AAB68893.1| Nmd2p: Protein involved in decay of mRN... 36 1.1
gi|37595292|gb|AAQ94531.1| M protein [Streptococcus pyogenes] 36 1.1
gi|45384298|ref|NP_990364.1| transitin [Gallus gallus] >gnl|BL_O... 36 1.1
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis] 36 1.1
gi|46308658|ref|ZP_00210850.1| COG3704: Type IV secretory pathwa... 36 1.1
gi|1513317|gb|AAB16803.1| serine rich protein 36 1.1
gi|30684623|ref|NP_173046.2| expressed protein [Arabidopsis thal... 36 1.1
gi|24656688|ref|NP_647799.1| CG12009-PA [Drosophila melanogaster... 36 1.1
gi|6322911|ref|NP_012984.1| Self-glucosylating initiator of glyc... 36 1.1
gi|1169907|sp|P36143|GLG1_YEAST Glycogen synthesis initiator pro... 36 1.1
gi|47209275|emb|CAF89705.1| unnamed protein product [Tetraodon n... 36 1.5
gi|42560573|ref|NP_975024.1| Prolipoprotein [Mycoplasma mycoides... 36 1.5
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays] 36 1.5
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 36 1.5
gi|17550398|ref|NP_509337.1| troponin T (tnt-3) [Caenorhabditis ... 36 1.5
gi|47847440|dbj|BAD21392.1| mFLJ00158 protein [Mus musculus] 36 1.5
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [... 36 1.5
gi|24475478|dbj|BAC22734.1| serine-rich protein [Entamoeba histo... 36 1.5
gi|25153279|ref|NP_741853.1| troponin T (tnt-3) [Caenorhabditis ... 36 1.5
gi|24654914|ref|NP_728554.1| CG32479-PA [Drosophila melanogaster... 36 1.5
gi|33469121|ref|NP_058059.1| dentin matrix protein 1; serine ric... 36 1.5
gi|34865574|ref|XP_345672.1| similar to kinetoplast-associated p... 36 1.5
gi|23509515|ref|NP_702182.1| hypothetical protein [Plasmodium fa... 36 1.5
gi|6137020|emb|CAB59629.1| dentin matrix protein-1 [Mus musculus] 36 1.5
gi|42734053|gb|AAS38925.1| hypothetical protein [Dictyostelium d... 36 1.5
gi|30686836|ref|NP_564114.2| dehydrin (ERD10) [Arabidopsis thali... 36 1.5
gi|22024201|ref|NP_611354.2| CG30122-PB [Drosophila melanogaster... 36 1.5
gi|7521903|pir||T30290 AAS surface protein - Staphylococcus sapr... 36 1.5
gi|39596043|emb|CAE69679.1| Hypothetical protein CBG15931 [Caeno... 36 1.5
gi|45190616|ref|NP_984870.1| AER010Cp [Eremothecium gossypii] >g... 36 1.5
gi|30686832|ref|NP_850947.1| dehydrin (ERD10) [Arabidopsis thali... 36 1.5
gi|538245|dbj|BAA03980.1| secreted phosphoprotein-1 precursor [O... 36 1.5
gi|38099407|gb|EAA46758.1| predicted protein [Magnaporthe grisea... 36 1.5
gi|39588812|emb|CAE69442.1| Hypothetical protein CBG15630 [Caeno... 36 1.5
gi|32407697|ref|XP_324355.1| hypothetical protein [Neurospora cr... 36 1.5
gi|28573674|ref|NP_788423.1| CG18375-PB [Drosophila melanogaster... 36 1.5
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec... 36 1.5
gi|23508608|ref|NP_701277.1| hypothetical protein [Plasmodium fa... 36 1.5
gi|50551493|ref|XP_503220.1| hypothetical protein [Yarrowia lipo... 36 1.5
gi|24475468|dbj|BAC22729.1| serine-rich protein [Entamoeba histo... 36 1.5
gi|28422180|gb|AAH46866.1| B230399n07-prov protein [Xenopus laevis] 36 1.5
gi|23509995|ref|NP_702661.1| erythrocyte membrane protein 1 (PfE... 36 1.5
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno... 36 1.5
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand... 36 1.5
gi|7496020|pir||T15496 hypothetical protein C14F5.3 - Caenorhabd... 36 1.5
gi|45550477|ref|NP_611565.2| CG18375-PA [Drosophila melanogaster... 36 1.5
gi|27819843|gb|AAO24970.1| RE13301p [Drosophila melanogaster] 36 1.5
gi|50545133|ref|XP_500104.1| hypothetical protein [Yarrowia lipo... 36 1.5
gi|50303257|ref|XP_451570.1| unnamed protein product [Kluyveromy... 36 1.5
gi|4768711|gb|AAD29625.1| developmental-specific protein conZA8 ... 35 1.9
gi|33563120|dbj|BAC81703.1| serine-rich protein [Entamoeba histo... 35 1.9
gi|25403160|pir||A86453 CDS protein F9L11.3 [imported] - Arabido... 35 1.9
gi|23613722|ref|NP_704743.1| hypothetical protein [Plasmodium fa... 35 1.9
gi|2623357|gb|AAC53436.1| sex determining protein [Mus musculus ... 35 1.9
gi|120558|sp|P13709|FSH_DROME FEMALE STERILE HOMEOTIC PROTEIN (F... 35 1.9
gi|16768468|gb|AAL28453.1| GM05229p [Drosophila melanogaster] 35 1.9
gi|13878207|ref|NP_113559.1| testis expressed gene 16 [Mus muscu... 35 1.9
gi|23481717|gb|EAA17910.1| dentin sialoprotein-phosphophoryn [Pl... 35 1.9
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g... 35 1.9
gi|17542492|ref|NP_500613.1| putative membrane protein, with a c... 35 1.9
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det... 35 1.9
gi|28301672|emb|CAD36957.1| retinitis pigmentosa 1-like protein ... 35 1.9
gi|49121568|ref|XP_412424.1| hypothetical protein AN8287.2 [Aspe... 35 1.9
gi|49092454|ref|XP_407688.1| hypothetical protein AN3551.2 [Aspe... 35 1.9
gi|25369267|pir||T52182 probable transcription factor TCP3 [impo... 35 1.9
gi|47221630|emb|CAF97895.1| unnamed protein product [Tetraodon n... 35 1.9
gi|49481396|ref|YP_038778.1| spore germination protein [Bacillus... 35 1.9
gi|23478985|gb|EAA15932.1| KED, putative [Plasmodium yoelii yoelii] 35 1.9
gi|39586363|emb|CAE74020.1| Hypothetical protein CBG21668 [Caeno... 35 1.9
gi|44889999|emb|CAF32117.1| hypothetical protein [Aspergillus fu... 35 1.9
gi|45185342|ref|NP_983059.1| ABR112Cp [Eremothecium gossypii] >g... 35 1.9
gi|28975391|gb|AAO61781.1| chromo-helicase DNA-binding protein [... 35 1.9
gi|46438643|gb|EAK97970.1| hypothetical protein CaO19.5128 [Cand... 35 1.9
gi|30695456|ref|NP_564624.2| TCP family transcription factor 3 (... 35 1.9
gi|15829205|ref|NP_326565.1| VLPE-LIKE (Mycoplasma hyorhinis) LI... 35 1.9
gi|26000386|gb|AAN75482.1| dentin matrix protein 1 [Thyroptera d... 35 1.9
gi|29570388|gb|AAO91670.1| Hypothetical protein T22B11.4b [Caeno... 35 1.9
gi|11345238|gb|AAG34657.1| involucrin [Mus musculus] 35 1.9
gi|23486915|gb|EAA20924.1| casein kinase ii beta chain [Plasmodi... 35 1.9
gi|4884544|gb|AAD31724.1| conZA8 [Euplotes crassus] 35 1.9
gi|24649873|ref|NP_651318.1| CG13648-PA [Drosophila melanogaster... 35 2.5
gi|30685716|ref|NP_851007.1| PHD finger family protein [Arabidop... 35 2.5
gi|27368080|gb|AAN86961.1| retinitis pigmentosa 1-like 1 protein... 35 2.5
gi|11493973|gb|AAG35726.1| lipase precursor GehM [Staphylococcus... 35 2.5
gi|24661759|ref|NP_648337.1| CG3335-PA [Drosophila melanogaster]... 35 2.5
gi|9294545|dbj|BAB02808.1| unnamed protein product [Arabidopsis ... 35 2.5
gi|20270337|ref|NP_620147.1| senescence downregulated leo1-like ... 35 2.5
gi|16550571|dbj|BAB71006.1| unnamed protein product [Homo sapiens] 35 2.5
gi|6746586|gb|AAF27636.1| Sec12 [Pichia pastoris] 35 2.5
gi|20151583|gb|AAM11151.1| LD24056p [Drosophila melanogaster] 35 2.5
gi|19774215|gb|AAL99081.1| osteopontin [Bos taurus] 35 2.5
gi|23508651|ref|NP_701320.1| hypothetical protein [Plasmodium fa... 35 2.5
gi|33563118|dbj|BAC81702.1| serine-rich protein [Entamoeba histo... 35 2.5
gi|15230788|ref|NP_189665.1| hypothetical protein [Arabidopsis t... 35 2.5
>gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD)
(col-80) [Caenorhabditis elegans]
gi|2493778|sp|Q09456|YQ35_CAEEL PUTATIVE CUTICLE COLLAGEN C09G5.5
gi|7495772|pir||T19143 hypothetical protein C09G5.5 -
Caenorhabditis elegans
gi|3874102|emb|CAA86758.1| Hypothetical protein C09G5.5
[Caenorhabditis elegans]
Length = 317
Score = 184 bits (467), Expect = 3e-45
Identities = 94/134 (70%), Positives = 94/134 (70%)
Frame = +1
Query: 1 MSTTFLSVMAGLSGIVVFGALISVFHIYTDINSFVDEAHRELGAFRGVANDAWNSMVNHD 180
MSTTFLSVMAGLSGIVVFGALISVFHIYTDINSFVDEAHRELGAFRGVANDAWNSMVNHD
Sbjct: 1 MSTTFLSVMAGLSGIVVFGALISVFHIYTDINSFVDEAHRELGAFRGVANDAWNSMVNHD 60
Query: 181 DXXXXXXXXXXXXQKKQSQCNCGPQASNCXXXXXXXXXXSGDRGLDXXXXXXXXXXXXXX 360
D QKKQSQCNCGPQASNC SGDRGLD
Sbjct: 61 DSARVARSVFVRRQKKQSQCNCGPQASNCPAGPPGPPGASGDRGLDGQPGPAGKPGQPGV 120
Query: 361 XXXXHHQQQECIKC 402
HHQQQECIKC
Sbjct: 121 AGPAHHQQQECIKC 134