Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C14A4_1
(897 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531753|ref|NP_496279.1| gene producing two messages overlap... 595 e-169
gi|41054657|ref|NP_955857.1| Similar to hypothetical protein MGC... 336 4e-91
gi|31240985|ref|XP_320906.1| ENSANGP00000017698 [Anopheles gambi... 335 1e-90
gi|13775228|ref|NP_112594.1| hypothetical protein MGC4293 [Homo ... 328 1e-88
gi|19527182|ref|NP_598725.1| RIKEN cDNA 1110033C18 [Mus musculus... 323 2e-87
gi|24651728|ref|NP_651887.1| CG2245-PA [Drosophila melanogaster]... 323 2e-87
gi|47209388|emb|CAF90691.1| unnamed protein product [Tetraodon n... 319 5e-86
gi|28828695|gb|AAO51293.1| hypothetical protein [Dictyostelium d... 272 6e-72
gi|46436408|gb|EAK95771.1| hypothetical protein CaO19.9826 [Cand... 248 2e-64
gi|6322531|ref|NP_012604.1| Protein that binds to the C-terminal... 246 4e-64
gi|15080688|dbj|BAB62528.1| MFBC [Lentinula edodes] 238 2e-61
gi|50543396|ref|XP_499864.1| hypothetical protein [Yarrowia lipo... 238 2e-61
gi|50304417|ref|XP_452158.1| unnamed protein product [Kluyveromy... 237 2e-61
gi|50256159|gb|EAL18886.1| hypothetical protein CNBI1470 [Crypto... 235 1e-60
gi|19115566|ref|NP_594654.1| hypothetical protein simialr to YJR... 234 1e-60
gi|50287123|ref|XP_445991.1| unnamed protein product [Candida gl... 234 2e-60
gi|50425539|ref|XP_461365.1| unnamed protein product [Debaryomyc... 233 4e-60
gi|32408255|ref|XP_324609.1| hypothetical protein [Neurospora cr... 226 7e-58
gi|48094677|ref|XP_394239.1| similar to CG2245-PA [Apis mellifera] 224 2e-57
gi|38110338|gb|EAA56074.1| hypothetical protein MG01725.4 [Magna... 219 5e-56
gi|46136515|ref|XP_389949.1| hypothetical protein FG09773.1 [Gib... 219 6e-56
gi|45198944|ref|NP_985973.1| AFR426Cp [Eremothecium gossypii] >g... 218 2e-55
gi|18410896|ref|NP_567062.1| PBS lyase HEAT-like repeat-containi... 216 4e-55
gi|49108778|ref|XP_411635.1| hypothetical protein AN7498.2 [Aspe... 215 9e-55
gi|26348665|dbj|BAC37972.1| unnamed protein product [Mus musculus] 213 4e-54
gi|11281934|pir||T45978 hypothetical protein F9D24.90 - Arabidop... 202 8e-51
gi|3482908|gb|AAC33193.1| R26529_2, partial CDS [Homo sapiens] 197 3e-49
gi|49067288|ref|XP_397934.1| hypothetical protein UM00319.1 [Ust... 189 9e-47
gi|19074400|ref|NP_585906.1| similarity to HYPOTHETICAL PROTEIN ... 188 1e-46
gi|34862253|ref|XP_234926.2| similar to RIKEN cDNA 1110033C18 [R... 182 9e-45
gi|26327755|dbj|BAC25064.1| unnamed protein product [Mus musculus] 182 1e-44
gi|46226703|gb|EAK87682.1| protein with 4xEZ_heat domains, trans... 149 8e-35
gi|2731573|gb|AAC27388.1| similar to ORF YJR070C from S. cerevis... 147 2e-34
gi|50810238|ref|XP_424662.1| PREDICTED: similar to RIKEN cDNA 11... 139 7e-32
gi|23482006|gb|EAA18119.1| PBS lyase HEAT-like repeat, putative ... 139 1e-31
gi|2623132|gb|AAC27391.1| unknown [Babesia bovis] 136 6e-31
gi|50776434|ref|XP_427319.1| PREDICTED: similar to hypothetical ... 113 7e-24
gi|48839818|ref|ZP_00296747.1| COG1413: FOG: HEAT repeat [Methan... 91 5e-17
gi|23618963|ref|NP_704925.1| PBS lyase HEAT-like repeat domain p... 88 3e-16
gi|17229395|ref|NP_485943.1| unknown protein [Nostoc sp. PCC 712... 84 4e-15
gi|18412406|ref|NP_567129.1| PBS lyase HEAT-like repeat-containi... 81 4e-14
gi|11357981|pir||T48045 hypothetical protein T12C14.230 - Arabid... 81 4e-14
gi|46142308|ref|ZP_00148380.2| COG1413: FOG: HEAT repeat [Methan... 80 6e-14
gi|48892052|ref|ZP_00325485.1| COG1413: FOG: HEAT repeat [Tricho... 79 1e-13
gi|46141900|ref|ZP_00204077.1| COG1413: FOG: HEAT repeat [Methan... 72 1e-11
gi|23123970|ref|ZP_00105992.1| COG1413: FOG: HEAT repeat [Nostoc... 69 1e-10
gi|20093106|ref|NP_619181.1| phycocyanin alpha phycocyanobilin l... 67 4e-10
gi|48840743|ref|ZP_00297669.1| COG1413: FOG: HEAT repeat [Methan... 65 3e-09
gi|2583053|gb|AAB82597.1| YJR070c-like protein [Babesia bigemina] 65 3e-09
gi|20090689|ref|NP_616764.1| hypothetical protein (multi-domain)... 64 3e-09
gi|48841048|ref|ZP_00297974.1| COG1413: FOG: HEAT repeat [Methan... 63 1e-08
gi|46135508|ref|ZP_00162995.2| COG1413: FOG: HEAT repeat [Anabae... 62 2e-08
gi|17230957|ref|NP_487505.1| unknown protein [Nostoc sp. PCC 712... 59 1e-07
gi|20093380|ref|NP_619455.1| hypothetical protein (multi-domain)... 58 2e-07
gi|46142472|ref|ZP_00149178.2| COG1413: FOG: HEAT repeat [Methan... 57 7e-07
gi|20092090|ref|NP_618165.1| hypothetical protein (multi-domain)... 55 2e-06
gi|21226592|ref|NP_632514.1| Phycocyanin alpha-subunit phycocyan... 54 4e-06
gi|21226606|ref|NP_632528.1| Phycocyanin alpha-subunit phycocyan... 53 8e-06
gi|48839816|ref|ZP_00296745.1| COG1413: FOG: HEAT repeat [Methan... 52 1e-05
gi|20092412|ref|NP_618487.1| hypothetical protein (multi-domain)... 52 1e-05
gi|20091367|ref|NP_617442.1| phycocyanin alpha phycocyanobilin l... 51 4e-05
gi|45510227|ref|ZP_00162559.1| COG1413: FOG: HEAT repeat [Anabae... 50 5e-05
gi|17228112|ref|NP_484660.1| hypothetical protein [Nostoc sp. PC... 50 5e-05
gi|45508113|ref|ZP_00160453.1| COG1413: FOG: HEAT repeat [Anabae... 50 7e-05
gi|22972998|ref|ZP_00019846.1| hypothetical protein [Chloroflexu... 50 9e-05
gi|9622258|gb|AAF89697.1| phycoerythrobilin lyase subunit CpeF [... 49 1e-04
gi|16329414|ref|NP_440142.1| unknown protein [Synechocystis sp. ... 49 1e-04
gi|48839513|ref|ZP_00296444.1| COG1413: FOG: HEAT repeat [Methan... 49 2e-04
gi|21229192|ref|NP_635114.1| Phycocyanin alpha-subunit phycocyan... 48 3e-04
gi|16079247|ref|NP_390071.1| ypgR [Bacillus subtilis subsp. subt... 47 6e-04
gi|48839376|ref|ZP_00296308.1| COG1413: FOG: HEAT repeat [Methan... 47 6e-04
gi|20092400|ref|NP_618475.1| phycocyanin alpha phycocyanobilin l... 47 6e-04
gi|46130056|ref|ZP_00164764.2| COG1413: FOG: HEAT repeat [Synech... 47 8e-04
gi|48733393|ref|ZP_00267136.1| COG1413: FOG: HEAT repeat [Pseudo... 47 8e-04
gi|48839809|ref|ZP_00296738.1| COG1413: FOG: HEAT repeat [Methan... 47 8e-04
gi|48894326|ref|ZP_00327435.1| COG1413: FOG: HEAT repeat [Tricho... 45 0.002
gi|13488235|ref|NP_085742.1| hypothetical protein mlr9194 [Mesor... 45 0.002
gi|23127557|ref|ZP_00109424.1| COG1413: FOG: HEAT repeat [Nostoc... 45 0.002
gi|48840735|ref|ZP_00297661.1| COG1413: FOG: HEAT repeat [Methan... 45 0.002
gi|26986954|ref|NP_742379.1| phycobiliprotein, putative [Pseudom... 44 0.004
gi|37520550|ref|NP_923927.1| phycocyanin alpha phycocyanobilin l... 44 0.005
gi|37521144|ref|NP_924521.1| phycocyanin alpha phycocyanobilin l... 43 0.008
gi|21227378|ref|NP_633300.1| hypothetical protein MM1276 [Methan... 43 0.011
gi|15679709|ref|NP_276827.1| phycocyanin alpha phycocyanobilin l... 43 0.011
gi|23474891|ref|ZP_00130182.1| COG1413: FOG: HEAT repeat [Desulf... 42 0.014
gi|23125103|ref|ZP_00107051.1| COG1413: FOG: HEAT repeat [Nostoc... 42 0.024
gi|15679377|ref|NP_276494.1| phycocyanin alpha phycocyanobilin l... 41 0.032
gi|19553346|ref|NP_601348.1| predicted transcriptional regulator... 40 0.092
gi|15597489|ref|NP_250983.1| hypothetical protein [Pseudomonas a... 39 0.12
gi|24213166|ref|NP_710647.1| PBS lyase HEAT-like protein [Leptos... 39 0.12
gi|45656306|ref|YP_000392.1| conserved hypothetical protein [Lep... 39 0.12
gi|46134329|ref|ZP_00157727.2| COG1413: FOG: HEAT repeat [Anabae... 39 0.12
gi|37520824|ref|NP_924201.1| bilin biosynthesis protein MpeU hom... 39 0.12
gi|45525604|ref|ZP_00176832.1| COG1413: FOG: HEAT repeat [Crocos... 39 0.12
gi|46130112|ref|ZP_00202237.1| COG1413: FOG: HEAT repeat [Synech... 39 0.16
gi|27378309|ref|NP_769838.1| blr3198 [Bradyrhizobium japonicum U... 39 0.16
gi|3769517|gb|AAD09864.1| phycocyanin alpha phycocyanobilin lyas... 39 0.16
gi|49483620|ref|YP_040844.1| conserved hypothetical protein [Sta... 39 0.20
gi|15927010|ref|NP_374543.1| conserved hypothetical protein [Sta... 39 0.20
gi|15924419|ref|NP_371953.1| conserved hypothetical protein [Sta... 39 0.20
gi|24213171|ref|NP_710652.1| PBS lyase HEAT-like protein [Leptos... 39 0.20
gi|41204884|ref|XP_031744.3| START domain containing 9 [Homo sap... 38 0.27
gi|25009281|sp|Q9P2P6|STR9_HUMAN StAR-related lipid transfer pro... 38 0.27
gi|48891090|ref|ZP_00324664.1| COG1413: FOG: HEAT repeat [Tricho... 38 0.27
gi|22972915|ref|ZP_00019767.1| hypothetical protein [Chloroflexu... 38 0.35
gi|15679794|ref|NP_276912.1| phycocyanin alpha phycocyanobilin l... 38 0.35
gi|15790082|ref|NP_279906.1| phycocyanin alpha phycocyanobilin l... 38 0.35
gi|37521803|ref|NP_925180.1| phycocyanin alpha phycocyanobilin l... 37 0.46
gi|30262187|ref|NP_844564.1| PBS lyase HEAT-like repeat domain p... 37 0.46
gi|21400041|ref|NP_656026.1| EZ_HEAT, E-Z type HEAT repeats [Bac... 37 0.46
gi|23125489|ref|ZP_00107420.1| COG1413: FOG: HEAT repeat [Nostoc... 37 0.60
gi|42781296|ref|NP_978543.1| PBS lyase HEAT-like repeat domain p... 37 0.60
gi|22972997|ref|ZP_00019845.1| hypothetical protein [Chloroflexu... 37 0.60
gi|50728025|ref|XP_415956.1| PREDICTED: similar to myeloid/lymph... 37 0.60
gi|30020290|ref|NP_831921.1| PBS lyase HEAT-like repeat [Bacillu... 37 0.60
gi|47570784|ref|ZP_00241351.1| PBS lyase HEAT-like repeat [Bacil... 37 0.78
gi|46311900|ref|ZP_00212501.1| COG1413: FOG: HEAT repeat [Burkho... 37 0.78
gi|45527306|ref|ZP_00178506.1| COG1413: FOG: HEAT repeat [Crocos... 36 1.0
gi|48891860|ref|ZP_00325309.1| COG1413: FOG: HEAT repeat [Tricho... 36 1.0
gi|37522576|ref|NP_925953.1| hypothetical protein gll3007 [Gloeo... 36 1.0
gi|32475833|ref|NP_868827.1| similar to phycocyanin alpha phycoc... 35 1.7
gi|29376141|ref|NP_815295.1| iron-sulfur cluster-binding protein... 35 1.7
gi|50877778|emb|CAG37618.1| related to two-component system resp... 35 1.7
gi|22298378|ref|NP_681625.1| ORF_ID:tll0835~phycocyanin alpha ph... 35 1.7
gi|37522122|ref|NP_925499.1| hypothetical protein glr2553 [Gloeo... 35 2.3
gi|16330970|ref|NP_441698.1| unknown protein [Synechocystis sp. ... 35 2.3
gi|9802548|gb|AAF99750.1| F17L21.1 [Arabidopsis thaliana] 35 3.0
gi|29828450|ref|NP_823084.1| hypothetical protein SAV1908 [Strep... 35 3.0
gi|46118080|ref|ZP_00201185.1| COG1413: FOG: HEAT repeat [Crocos... 35 3.0
gi|18396241|ref|NP_564273.1| expressed protein [Arabidopsis thal... 35 3.0
gi|8778871|gb|AAF79870.1| T7N9.27 [Arabidopsis thaliana] 35 3.0
gi|46362651|ref|ZP_00225503.1| COG1530: Ribonucleases G and E [K... 34 3.9
gi|23124214|ref|ZP_00106218.1| COG1413: FOG: HEAT repeat [Nostoc... 34 3.9
gi|15835244|ref|NP_297003.1| conserved hypothetical protein [Chl... 34 3.9
gi|22298308|ref|NP_681555.1| phycocyanin alpha phycocyanobilin l... 34 3.9
gi|50757733|ref|XP_415624.1| PREDICTED: similar to acyl-CoA oxid... 34 5.0
gi|45509870|ref|ZP_00162203.1| COG1413: FOG: HEAT repeat [Anabae... 34 5.0
gi|17231306|ref|NP_487854.1| phycocyanin alpha phycocyanobilin l... 34 5.0
gi|23124659|ref|ZP_00106635.1| COG1413: FOG: HEAT repeat [Nostoc... 33 6.6
gi|29169163|gb|AAO66333.1| unknown [Myxococcus xanthus] 33 6.6
gi|48894517|ref|ZP_00327626.1| COG1413: FOG: HEAT repeat [Tricho... 33 6.6
gi|50288227|ref|XP_446542.1| unnamed protein product [Candida gl... 33 6.6
gi|9622212|gb|AAF89675.1| phycoerythrin lyase [Synechocystis sp.... 33 6.6
gi|33863768|ref|NP_895328.1| conserved hypothetical protein [Pro... 33 6.6
gi|17228029|ref|NP_484577.1| phycocyanobilin lyase beta subunit ... 33 8.6
gi|23821048|ref|NP_705699.1| RNA-dependent RNA polymerase [Beet ... 33 8.6
gi|15801937|ref|NP_287958.1| orf, hypothetical protein [Escheric... 33 8.6
gi|13357212|ref|NP_076262.1| RIKEN cDNA 4930548G07 [Mus musculus... 33 8.6
gi|19919962|ref|NP_612601.1| polyprotein [Beet soil-borne mosaic... 33 8.6
>gi|17531753|ref|NP_496279.1| gene producing two messages overlaping
3' 5', encoding DNA-directed RNA polymerase subunit
K/omega and a phycobilisome related protein (33.2 kD)
(2K871Co) [Caenorhabditis elegans]
gi|7495951|pir||T19243 hypothetical protein C14A4.1 -
Caenorhabditis elegans
gi|3874228|emb|CAA90105.1| Hypothetical protein C14A4.1
[Caenorhabditis elegans]
Length = 298
Score = 595 bits (1533), Expect = e-169
Identities = 298/298 (100%), Positives = 298/298 (100%)
Frame = +1
Query: 1 MVASQKFSDAEIDSFGEALNDTKKPLKARFRALFILRNIGCDRSVDWIGKCLNDESALLK 180
MVASQKFSDAEIDSFGEALNDTKKPLKARFRALFILRNIGCDRSVDWIGKCLNDESALLK
Sbjct: 1 MVASQKFSDAEIDSFGEALNDTKKPLKARFRALFILRNIGCDRSVDWIGKCLNDESALLK 60
Query: 181 HELAYCLGQMQNKHAIPTLVSVLEDEKQEPMVRHEAGEALGAIADPSVKDVLRKYAQDPC 360
HELAYCLGQMQNKHAIPTLVSVLEDEKQEPMVRHEAGEALGAIADPSVKDVLRKYAQDPC
Sbjct: 61 HELAYCLGQMQNKHAIPTLVSVLEDEKQEPMVRHEAGEALGAIADPSVKDVLRKYAQDPC 120
Query: 361 PEVSETCQIALGRVEWVEKSGKDTNSPYDSVDPTPSASTSDVEELAATLIDASLPLFDRY 540
PEVSETCQIALGRVEWVEKSGKDTNSPYDSVDPTPSASTSDVEELAATLIDASLPLFDRY
Sbjct: 121 PEVSETCQIALGRVEWVEKSGKDTNSPYDSVDPTPSASTSDVEELAATLIDASLPLFDRY 180
Query: 541 RAMFSLRNIKTDKSIKALAQGLYCEDSALFRHEVAYVLGQLQSPVATQELKDRLLLSTEN 720
RAMFSLRNIKTDKSIKALAQGLYCEDSALFRHEVAYVLGQLQSPVATQELKDRLLLSTEN
Sbjct: 181 RAMFSLRNIKTDKSIKALAQGLYCEDSALFRHEVAYVLGQLQSPVATQELKDRLLLSTEN 240
Query: 721 CMVRHECAEALGAIANEECTEILKQYVNDEERVVRESCEVALDMAEYENSDDLQYAHV 894
CMVRHECAEALGAIANEECTEILKQYVNDEERVVRESCEVALDMAEYENSDDLQYAHV
Sbjct: 241 CMVRHECAEALGAIANEECTEILKQYVNDEERVVRESCEVALDMAEYENSDDLQYAHV 298