Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C15A11_6
         (951 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C...   214   2e-54
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [...   212   9e-54
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno...   182   1e-44
gi|84434|pir||PS0036 collagen col-7 - Caenorhabditis elegans (fr...   177   3e-43
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno...   177   4e-43
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ...   172   1e-41
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno...   149   9e-35
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ...   147   4e-34
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno...    87   4e-16
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ...    84   4e-15
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno...    82   1e-14
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ...    80   7e-14
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ...    72   1e-11
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno...    72   2e-11
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno...    71   3e-11
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ...    70   9e-11
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [...    68   3e-10
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ...    68   3e-10
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ...    68   3e-10
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno...    67   6e-10
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno...    67   6e-10
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno...    65   2e-09
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno...    64   5e-09
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno...    64   5e-09
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ...    63   1e-08
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno...    63   1e-08
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno...    62   1e-08
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans]             62   2e-08
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno...    62   2e-08
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ...    62   2e-08
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ...    59   1e-07
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ...    59   1e-07
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [...    58   3e-07
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [...    57   6e-07
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno...    57   6e-07
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ...    57   6e-07
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ...    57   8e-07
gi|687634|gb|AAA62504.1| collagen                                      56   1e-06
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ...    55   2e-06
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno...    55   2e-06
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno...    55   2e-06
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno...    54   4e-06
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ...    54   5e-06
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ...    54   5e-06
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [...    54   5e-06
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno...    52   1e-05
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ...    52   2e-05
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno...    52   2e-05
gi|39579123|emb|CAE56688.1| Hypothetical protein CBG24466 [Caeno...    52   3e-05
gi|39582634|emb|CAE73738.1| Hypothetical protein CBG21264 [Caeno...    51   3e-05
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ...    50   7e-05
gi|17539090|ref|NP_502514.1| COLlagen structural gene (col-132) ...    50   1e-04
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno...    49   1e-04
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno...    49   2e-04
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno...    49   2e-04
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-...    49   2e-04
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ...    49   2e-04
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno...    48   3e-04
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno...    48   3e-04
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [...    48   4e-04
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [...    48   4e-04
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]...    48   4e-04
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno...    47   6e-04
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [...    47   6e-04
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno...    47   6e-04
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [...    47   6e-04
gi|39587723|emb|CAE58661.1| Hypothetical protein CBG01830 [Caeno...    47   6e-04
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ...    47   6e-04
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno...    47   6e-04
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ...    47   8e-04
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno...    47   8e-04
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [...    46   0.001
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [...    46   0.001
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno...    45   0.002
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd...    45   0.002
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno...    44   0.004
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno...    44   0.004
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ...    44   0.005
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp...    44   0.007
gi|17539868|ref|NP_501416.1| predicted CDS, COLlagen structural ...    44   0.007
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno...    43   0.009
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl...    43   0.012
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1                   42   0.016
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C...    42   0.020
gi|39596219|emb|CAE69856.1| Hypothetical protein CBG16184 [Caeno...    42   0.026
gi|15147335|ref|NP_066018.1| nuclear receptor coactivator 5; coa...    42   0.026
gi|11526821|gb|AAG36793.1| nuclear receptor coactivator CIA [Hom...    42   0.026
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate...    42   0.026
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno...    42   0.026
gi|11544574|emb|CAC17668.1| dJ599F21.1 (KIAA1637) [Homo sapiens]       42   0.026
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ...    41   0.035
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para...    41   0.035
gi|23508380|ref|NP_701049.1| hypothetical protein [Plasmodium fa...    41   0.035
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno...    41   0.045
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm...    40   0.059
gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD) ...    40   0.077
gi|3746909|gb|AAC64112.1| M protein [Streptococcus pyogenes]           40   0.077
gi|50732245|ref|XP_418546.1| PREDICTED: similar to PAX transcrip...    40   0.077
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis]            40   0.077
gi|4506117|ref|NP_000304.1| protein S (alpha); Protein S, alpha ...    40   0.10
gi|131086|sp|P07225|PRTS_HUMAN Vitamin K-dependent protein S pre...    40   0.10
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno...    40   0.10
gi|39597388|emb|CAE59617.1| Hypothetical protein CBG03026 [Caeno...    40   0.10
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis]            40   0.10
gi|190442|gb|AAA60180.1| protein S alpha [Homo sapiens]                40   0.10
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis]            40   0.10
gi|3980130|emb|CAA31383.1| unnamed protein product [Homo sapiens]      40   0.10
gi|190449|gb|AAA60181.1| protein S precursor [Homo sapiens]            40   0.10
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (...    39   0.13
gi|46444158|gb|EAL03435.1| hypothetical protein CaO19.4998 [Cand...    39   0.13
gi|37595272|gb|AAQ94521.1| M protein [Streptococcus pyogenes]          39   0.17
gi|37595292|gb|AAQ94531.1| M protein [Streptococcus pyogenes]          39   0.17
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ...    39   0.22
gi|21450271|ref|NP_659141.1| nuclear receptor coactivator 5 [Mus...    39   0.22
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ...    39   0.22
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ...    39   0.22
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo...    38   0.29
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-...    38   0.29
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ...    38   0.29
gi|24649721|ref|NP_651273.1| CG13620-PA [Drosophila melanogaster...    38   0.29
gi|21428706|gb|AAM50013.1| SD03914p [Drosophila melanogaster]          38   0.29
gi|16805007|ref|NP_473036.1| hypothetical protein [Plasmodium fa...    38   0.38
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col...    38   0.38
gi|28828361|gb|AAO51011.1| similar to Homo sapiens (Human). Hypo...    38   0.38
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p...    38   0.38
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det...    38   0.38
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno...    38   0.38
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ...    37   0.50
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL...    37   0.50
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno...    37   0.50
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno...    37   0.50
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA...    37   0.50
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno...    37   0.65
gi|27531285|dbj|BAC54256.1| PS24 [Homo sapiens]                        37   0.65
gi|27531052|dbj|BAC54135.1| Protein S [Homo sapiens]                   37   0.65
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid...    37   0.65
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >...    37   0.65
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc...    37   0.65
gi|11346371|pir||T47235 sex determining protein [imported] - wes...    37   0.65
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ...    37   0.65
gi|3834583|gb|AAC72826.1| M protein [Streptococcus pyogenes]           37   0.65
gi|17557174|ref|NP_505670.1| COLlagen structural gene (col-151) ...    37   0.65
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno...    37   0.85
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ...    37   0.85
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami...    37   0.85
gi|14589866|ref|NP_004309.2| aspartate beta-hydroxylase isoform ...    36   1.1
gi|1911652|gb|AAB50779.1| aspartyl(asparaginyl)beta-hydroxylase;...    36   1.1
gi|2498165|sp|Q12797|ASPH_HUMAN Aspartyl/asparaginyl beta-hydrox...    36   1.1
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno...    36   1.1
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ...    36   1.1
gi|34860705|ref|XP_215931.2| similar to hypothetical protein MGC...    36   1.1
gi|14589860|ref|NP_115855.1| aspartate beta-hydroxylase isoform ...    36   1.1
gi|14589864|ref|NP_115857.1| aspartate beta-hydroxylase isoform ...    36   1.1
gi|34864325|ref|XP_236385.2| similar to KIAA1749 protein [Rattus...    36   1.5
gi|6323816|ref|NP_013887.1| Multicopy Suppressor of STA10 - 11; ...    36   1.5
gi|50752881|ref|XP_413790.1| PREDICTED: similar to hypothetical ...    36   1.5
gi|17506297|ref|NP_492086.1| COLlagen structural gene (col-35) [...    36   1.5
gi|50550967|ref|XP_502957.1| hypothetical protein [Yarrowia lipo...    35   1.9
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi...    35   1.9
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (...    35   1.9
gi|23479536|gb|EAA16336.1| peptide chain release factor 1 [Plasm...    35   1.9
gi|49069208|ref|XP_398893.1| hypothetical protein UM01278.1 [Ust...    35   1.9
gi|45550130|ref|NP_608921.2| CG14023-PA [Drosophila melanogaster...    35   1.9
gi|27531058|dbj|BAC54138.1| Protein S [Homo sapiens]                   35   1.9
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ...    35   1.9
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno...    35   1.9
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (...    35   1.9
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [...    35   1.9
gi|17540078|ref|NP_500607.1| COLlagen structural gene (col-111) ...    35   1.9
gi|33285196|gb|AAF99925.2| Collagen protein 111 [Caenorhabditis ...    35   1.9
gi|28828505|gb|AAO51113.1| similar to Dictyostelium discoideum (...    35   2.5
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ...    35   2.5
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno...    35   2.5
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc...    35   2.5
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu...    35   3.2
gi|24648119|ref|NP_650778.1| CG6026-PA [Drosophila melanogaster]...    35   3.2
gi|34867565|ref|XP_234490.2| similar to thyroid hormone receptor...    35   3.2
gi|283629|pir||S27770 hypothetical protein 1 - African malaria m...    35   3.2
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder...    35   3.2
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida]                35   3.2
gi|41054994|ref|NP_955759.1| nexilin; nF actin binding protein [...    35   3.2
gi|17231480|ref|NP_488028.1| hypothetical protein [Nostoc sp. PC...    35   3.2
gi|9507687|ref|NP_053008.1| unknown [Lactococcus lactis subsp. c...    35   3.2
gi|45201169|ref|NP_986739.1| AGR074Cp [Eremothecium gossypii] >g...    34   4.2
gi|17557828|ref|NP_505635.1| COLlagen structural gene (col-148) ...    34   4.2
gi|34857091|ref|XP_227268.2| similar to golgi phosphoprotein 4; ...    34   4.2
gi|31982906|ref|NP_116255.2| hypothetical protein FLJ14957 [Homo...    34   4.2
gi|23508652|ref|NP_701321.1| dynamin-like protein [Plasmodium fa...    34   4.2
gi|3024638|sp|Q62565|SRY_MUSSI Sex-determining region Y protein ...    34   4.2
gi|29421206|dbj|BAB21840.2| KIAA1749 protein [Homo sapiens]            34   4.2
gi|16552142|dbj|BAB71249.1| unnamed protein product [Homo sapiens]     34   4.2
gi|48094542|ref|XP_392142.1| similar to ENSANGP00000017827 [Apis...    34   4.2
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri...    34   4.2
gi|24652096|ref|NP_610490.1| CG13953-PA [Drosophila melanogaster...    34   5.5
gi|19310546|gb|AAL85006.1| unknown protein [Arabidopsis thaliana]      34   5.5
gi|6472600|dbj|BAA87057.1| unconventional myosin heavy chain [Ch...    34   5.5
gi|19263911|gb|AAH25236.1| ASPH protein [Homo sapiens]                 34   5.5
gi|34485696|gb|AAQ73233.1| M protein [Streptococcus pyogenes]          34   5.5
gi|50545898|ref|XP_500487.1| hypothetical protein [Yarrowia lipo...    34   5.5
gi|27503875|gb|AAH42244.1| MGC53372 protein [Xenopus laevis]           34   5.5
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder...    34   5.5
gi|33667888|gb|AAQ24523.1| putative cuticular collagen-4 [Brugia...    34   5.5
gi|23508909|ref|NP_701577.1| hypothetical protein [Plasmodium fa...    34   5.5
gi|2429350|gb|AAB70921.1| NE-rich protein [Plasmodium chabaudi c...    34   5.5
gi|30687943|ref|NP_851046.1| auxin-responsive factor (ARF7) [Ara...    34   5.5
gi|30687949|ref|NP_851047.1| auxin-responsive factor (ARF7) [Ara...    34   5.5
gi|4103243|gb|AAD04807.1| BIPOSTO [Arabidopsis thaliana]               34   5.5
gi|30687957|ref|NP_568400.2| auxin-responsive factor (ARF7) [Ara...    34   5.5
gi|21483824|gb|AAM52325.1| M protein precursor [Streptococcus py...    34   5.5
gi|9453839|dbj|BAB03273.1| myosin [Chara corallina]                    34   5.5
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ...    34   5.5
gi|33598984|gb|AAQ23117.1| M73 [Streptococcus pyogenes]                33   7.2
gi|34868438|ref|XP_232942.2| similar to RIKEN cDNA 2610207I16 [R...    33   7.2
gi|39595235|emb|CAE60272.1| Hypothetical protein CBG03851 [Caeno...    33   7.2
gi|50053824|ref|NP_001001932.1| early endosome antigen 1 [Mus mu...    33   7.2
gi|24643526|ref|NP_728346.1| CG1695-PB [Drosophila melanogaster]...    33   7.2
gi|50510651|dbj|BAD32311.1| mKIAA0819 protein [Mus musculus]           33   7.2
gi|38090688|ref|XP_125851.4| similar to Early endosome antigen 1...    33   7.2
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano...    33   7.2
gi|38085027|ref|XP_112637.4| similar to KIAA0819 protein [Mus mu...    33   7.2
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc...    33   7.2
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8]                  33   7.2
gi|38085577|ref|XP_359324.1| similar to KIAA0819 protein [Mus mu...    33   7.2
gi|3219786|sp|Q27450|CYP1_BRUMA Peptidylprolyl isomerase 1 (Pept...    33   7.2
gi|34485686|gb|AAQ73228.1| M protein [Streptococcus pyogenes]          33   7.2
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl...    33   7.2
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno...    33   7.2
gi|34222535|sp|Q8BL66|EEA1_MOUSE Early endosome antigen 1 >gnl|B...    33   7.2
gi|22655493|gb|AAN04082.1| M76 [Streptococcus pyogenes]                33   7.2
gi|23468050|ref|ZP_00123621.1| COG5295: Autotransporter adhesin ...    33   7.2
gi|13022054|gb|AAK11620.1| M type PT3875 [Streptococcus pyogenes]      33   7.2
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ...    33   7.2
gi|13445276|emb|CAC35008.1| putative epidermal growth factor rec...    33   7.2
gi|23619313|ref|NP_705275.1| hypothetical protein [Plasmodium fa...    33   7.2
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc...    33   7.2
gi|39587623|emb|CAE58561.1| Hypothetical protein CBG01723 [Caeno...    33   7.2
gi|32172768|gb|AAH53712.1| Fyco1 protein [Mus musculus]                33   9.4
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel...    33   9.4
gi|31418549|gb|AAH53048.1| Cyln2 protein [Mus musculus]                33   9.4
gi|24657655|gb|AAH39162.1| Cyln2 protein [Mus musculus]                33   9.4
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno...    33   9.4
gi|48104261|ref|XP_392929.1| similar to ENSANGP00000017553 [Apis...    33   9.4
gi|40538874|ref|NP_631977.1| nexilin isoform b [Rattus norvegicu...    33   9.4
gi|22779868|ref|NP_683727.1| FYVE and coiled-coil domain contain...    33   9.4
gi|39595517|emb|CAE60555.1| Hypothetical protein CBG04182 [Caeno...    33   9.4
gi|50510441|dbj|BAD32206.1| mKIAA0291 protein [Mus musculus]           33   9.4
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr...    33   9.4
gi|40538878|ref|NP_631976.1| nexilin isoform s [Rattus norvegicu...    33   9.4
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r...    33   9.4
gi|46432188|gb|EAK91684.1| hypothetical protein CaO19.6170 [Cand...    33   9.4
gi|9800516|gb|AAF99333.1| CYLN2 [Mus musculus] >gnl|BL_ORD_ID|15...    33   9.4
gi|29346315|ref|NP_809818.1| BatC, conserved hypothetical protei...    33   9.4
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g...    33   9.4
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n...    33   9.4


>gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7)
           [Caenorhabditis elegans]
 gi|21264392|sp|P18832|CC07_CAEEL Cuticle collagen 7 precursor
 gi|7496030|pir||T19291 hypothetical protein C15A11.5 -
           Caenorhabditis elegans
 gi|3874338|emb|CAB01961.1| Hypothetical protein C15A11.5
           [Caenorhabditis elegans]
          Length = 316

 Score =  214 bits (546), Expect = 2e-54
 Identities = 109/136 (80%), Positives = 109/136 (80%)
 Frame = +1

Query: 1   MSSATFLSVMAGLSGIVVFGALISVFHIYSDINSFVEDSHRELGEFKGFANDAWNSMINQ 180
           MSSATFLSVMAGLSGIVVFGALISVFHIYSDINSFVEDSHRELGEFKGFANDAWNSMINQ
Sbjct: 1   MSSATFLSVMAGLSGIVVFGALISVFHIYSDINSFVEDSHRELGEFKGFANDAWNSMINQ 60

Query: 181 DDSVRMARSVFGRRRQKKQSQCNCGQQASNCXXXXXXXXXXSGDKGHDXXXXXXXXXXXX 360
           DDSVRMARSVFGRRRQKKQSQCNCGQQASNC          SGDKGHD
Sbjct: 61  DDSVRMARSVFGRRRQKKQSQCNCGQQASNCPAGPPGPPGASGDKGHDGQPGQAGKPGQP 120

Query: 361 XXXXXSHHQKQECIKC 408
                SHHQKQECIKC
Sbjct: 121 GVAGPSHHQKQECIKC 136



 Score = 43.5 bits (101), Expect = 0.007
 Identities = 18/18 (100%), Positives = 18/18 (100%)
 Frame = +1

Query: 784 TPGSDAAYCPCPTRSSVL 837
           TPGSDAAYCPCPTRSSVL
Sbjct: 262 TPGSDAAYCPCPTRSSVL 279




[DB home][top]