Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C15A11_7
         (951 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [...   214   2e-54
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C...   212   9e-54
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno...   180   5e-44
gi|84434|pir||PS0036 collagen col-7 - Caenorhabditis elegans (fr...   175   2e-42
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno...   174   2e-42
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ...   170   5e-41
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno...   147   4e-34
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ...   144   2e-33
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno...    85   2e-15
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ...    82   2e-14
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno...    80   7e-14
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ...    78   3e-13
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ...    73   1e-11
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno...    72   1e-11
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [...    69   2e-10
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno...    69   2e-10
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ...    67   4e-10
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno...    67   6e-10
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ...    66   1e-09
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ...    66   1e-09
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno...    65   2e-09
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno...    65   3e-09
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno...    64   5e-09
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno...    62   2e-08
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno...    62   2e-08
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ...    60   6e-08
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno...    60   7e-08
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno...    59   1e-07
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ...    59   1e-07
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ...    59   2e-07
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ...    59   2e-07
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [...    57   5e-07
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno...    57   5e-07
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ...    57   6e-07
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ...    57   8e-07
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ...    56   1e-06
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno...    55   2e-06
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno...    55   3e-06
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno...    54   5e-06
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ...    54   7e-06
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ...    54   7e-06
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [...    53   9e-06
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno...    52   1e-05
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans]             52   2e-05
gi|39579123|emb|CAE56688.1| Hypothetical protein CBG24466 [Caeno...    52   3e-05
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno...    51   3e-05
gi|39582634|emb|CAE73738.1| Hypothetical protein CBG21264 [Caeno...    50   6e-05
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ...    50   7e-05
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno...    49   2e-04
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno...    49   2e-04
gi|17539090|ref|NP_502514.1| COLlagen structural gene (col-132) ...    49   2e-04
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-...    49   2e-04
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ...    49   2e-04
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno...    48   3e-04
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno...    48   3e-04
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [...    47   5e-04
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno...    47   6e-04
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [...    47   6e-04
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ...    47   6e-04
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno...    47   6e-04
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno...    47   6e-04
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [...    47   8e-04
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno...    47   8e-04
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ...    46   0.001
gi|39587723|emb|CAE58661.1| Hypothetical protein CBG01830 [Caeno...    46   0.001
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ...    45   0.002
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [...    45   0.003
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno...    45   0.003
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno...    44   0.004
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd...    44   0.004
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ...    44   0.005
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno...    44   0.005
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [...    44   0.007
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno...    43   0.009
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl...    43   0.012
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [...    42   0.016
gi|687634|gb|AAA62504.1| collagen                                      42   0.020
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C...    42   0.020
gi|39596219|emb|CAE69856.1| Hypothetical protein CBG16184 [Caeno...    42   0.026
gi|17539868|ref|NP_501416.1| predicted CDS, COLlagen structural ...    42   0.026
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno...    42   0.026
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno...    41   0.045
gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD) ...    40   0.077
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno...    40   0.10
gi|39597388|emb|CAE59617.1| Hypothetical protein CBG03026 [Caeno...    40   0.10
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [...    39   0.13
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ...    38   0.29
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col...    38   0.38
gi|24649721|ref|NP_651273.1| CG13620-PA [Drosophila melanogaster...    38   0.38
gi|21428706|gb|AAM50013.1| SD03914p [Drosophila melanogaster]          38   0.38
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno...    37   0.50
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno...    37   0.65
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno...    37   0.65
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >...    37   0.65
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno...    37   0.85
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ...    37   0.85
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ...    36   1.1
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno...    36   1.1
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ...    36   1.1
gi|17557174|ref|NP_505670.1| COLlagen structural gene (col-151) ...    36   1.1
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1                   36   1.1
gi|17506297|ref|NP_492086.1| COLlagen structural gene (col-35) [...    36   1.5
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ...    35   1.9
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno...    35   1.9
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [...    35   1.9
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno...    35   1.9
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno...    35   2.5
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para...    35   3.2
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder...    35   3.2
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida]                35   3.2
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate...    35   3.2
gi|17557828|ref|NP_505635.1| COLlagen structural gene (col-148) ...    34   4.2
gi|17540078|ref|NP_500607.1| COLlagen structural gene (col-111) ...    34   4.2
gi|33285196|gb|AAF99925.2| Collagen protein 111 [Caenorhabditis ...    34   4.2
gi|39595517|emb|CAE60555.1| Hypothetical protein CBG04182 [Caeno...    34   5.5
gi|37595272|gb|AAQ94521.1| M protein [Streptococcus pyogenes]          34   5.5
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder...    34   5.5
gi|33667888|gb|AAQ24523.1| putative cuticular collagen-4 [Brugia...    34   5.5
gi|37595292|gb|AAQ94531.1| M protein [Streptococcus pyogenes]          34   5.5
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ...    34   5.5
gi|15147335|ref|NP_066018.1| nuclear receptor coactivator 5; coa...    33   7.2
gi|11526821|gb|AAG36793.1| nuclear receptor coactivator CIA [Hom...    33   7.2
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami...    33   7.2
gi|13445276|emb|CAC35008.1| putative epidermal growth factor rec...    33   7.2
gi|11544574|emb|CAC17668.1| dJ599F21.1 (KIAA1637) [Homo sapiens]       33   7.2
gi|39587623|emb|CAE58561.1| Hypothetical protein CBG01723 [Caeno...    33   9.4
gi|39595235|emb|CAE60272.1| Hypothetical protein CBG03851 [Caeno...    33   9.4
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno...    33   9.4
gi|50732245|ref|XP_418546.1| PREDICTED: similar to PAX transcrip...    33   9.4


>gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62)
           [Caenorhabditis elegans]
 gi|7496031|pir||T19288 hypothetical protein C15A11.6 -
           Caenorhabditis elegans
 gi|3874335|emb|CAB01958.1| Hypothetical protein C15A11.6
           [Caenorhabditis elegans]
          Length = 316

 Score =  214 bits (546), Expect = 2e-54
 Identities = 111/136 (81%), Positives = 111/136 (81%)
 Frame = -1

Query: 951 MSSAMFLSVMAGLSGIVVFGALISVFHIYSDINSFVEDSHRELGEFKGFANDAWNSMINQ 772
           MSSAMFLSVMAGLSGIVVFGALISVFHIYSDINSFVEDSHRELGEFKGFANDAWNSMINQ
Sbjct: 1   MSSAMFLSVMAGLSGIVVFGALISVFHIYSDINSFVEDSHRELGEFKGFANDAWNSMINQ 60

Query: 771 DDSVRMARSVFGRRRQKKQSQCNCGQQASNCXXXXXXXXXASGDKGHDXXXXXXXXXXXX 592
           DDSVRMARSVFGRRRQKKQSQCNCGQQASNC         ASGDKGHD
Sbjct: 61  DDSVRMARSVFGRRRQKKQSQCNCGQQASNCPAGPPGPPGASGDKGHDGQPGQAGKPGQP 120

Query: 591 XXXXPSHHQKQECIKC 544
               PSHHQKQECIKC
Sbjct: 121 GVAGPSHHQKQECIKC 136



 Score = 43.5 bits (101), Expect = 0.007
 Identities = 18/18 (100%), Positives = 18/18 (100%)
 Frame = -1

Query: 168 TPGSDAAYCPCPTRSSVL 115
           TPGSDAAYCPCPTRSSVL
Sbjct: 262 TPGSDAAYCPCPTRSSVL 279




[DB home][top]