Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C15F1_5
(927 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531783|ref|NP_495430.1| steroid Alpha ReducTase family, 3-o... 597 e-169
gi|39590267|emb|CAE66005.1| Hypothetical protein CBG11196 [Caeno... 570 e-161
gi|31204955|ref|XP_311426.1| ENSANGP00000018490 [Anopheles gambi... 328 8e-89
gi|30585427|gb|AAP36986.1| Homo sapiens glycoprotein, synaptic 2... 319 6e-86
gi|24475816|ref|NP_612510.1| glycoprotein, synaptic 2; synaptic ... 319 6e-86
gi|13111809|gb|AAH00174.2| Unknown (protein for IMAGE:2901253) [... 319 6e-86
gi|19924091|ref|NP_612558.1| synaptic glycoprotein SC2 [Rattus n... 318 1e-85
gi|19923070|ref|NP_598879.1| synaptic glycoprotein SC2 [Mus musc... 317 2e-85
gi|33585860|gb|AAH56018.1| Gpsn2-prov protein [Xenopus laevis] 315 9e-85
gi|11281610|pir||T50639 synaptic glycoprotein SC2, spliced varia... 315 1e-84
gi|34853800|ref|XP_344812.1| similar to synaptic glycoprotein SC... 310 4e-83
gi|49118255|gb|AAH73263.1| Unknown (protein for MGC:80625) [Xeno... 308 9e-83
gi|41152024|ref|NP_958456.1| glycoprotein, synaptic 2 [Danio rer... 307 2e-82
gi|47223895|emb|CAG06072.1| unnamed protein product [Tetraodon n... 306 3e-82
gi|12846015|dbj|BAB26996.1| unnamed protein product [Mus musculus] 302 6e-81
gi|24657023|ref|NP_647836.2| CG10849-PA [Drosophila melanogaster... 301 2e-80
gi|27819746|gb|AAL29169.2| SD09294p [Drosophila melanogaster] 298 1e-79
gi|50751296|ref|XP_422331.1| PREDICTED: similar to synaptic glyc... 287 3e-76
gi|47225165|emb|CAF98792.1| unnamed protein product [Tetraodon n... 277 3e-73
gi|48095895|ref|XP_394548.1| similar to ENSANGP00000018490 [Apis... 275 8e-73
gi|38083258|ref|XP_140155.2| similar to synaptic glycoprotein SC... 259 8e-68
gi|27479817|ref|XP_171068.2| similar to steroid 5 alpha-reductas... 235 1e-60
gi|26342543|dbj|BAC34928.1| unnamed protein product [Mus musculus] 228 1e-58
gi|26342502|dbj|BAC34913.1| unnamed protein product [Mus musculu... 228 1e-58
gi|26342615|dbj|BAC34964.1| unnamed protein product [Mus musculus] 228 1e-58
gi|24418917|ref|NP_722496.1| steroid 5 alpha-reductase 2-like 2;... 226 4e-58
gi|50746611|ref|XP_420576.1| PREDICTED: similar to steroid 5 alp... 223 4e-57
gi|46227923|gb|EAK88843.1| steroid reductase like intregral memb... 211 2e-53
gi|49074168|ref|XP_401237.1| hypothetical protein UM03622.1 [Ust... 206 8e-52
gi|41195100|ref|XP_373029.1| similar to Synaptic glycoprotein SC... 201 2e-50
gi|47215423|emb|CAG01120.1| unnamed protein product [Tetraodon n... 197 4e-49
gi|34895848|ref|NP_909268.1| putative glycoprotein [Oryza sativa... 196 6e-49
gi|15233250|ref|NP_191096.1| 3-oxo-5-alpha-steroid 4-dehydrogena... 192 7e-48
gi|25004880|emb|CAD56504.1| steroid 5-alpha reductase [Cicer ari... 191 2e-47
gi|19112157|ref|NP_595365.1| 3-oxo-5-alpha-steroid 4-dehydrogena... 187 3e-46
gi|50543208|ref|XP_499770.1| hypothetical protein [Yarrowia lipo... 180 5e-44
gi|4759062|ref|NP_004859.1| glycoprotein, synaptic 2; synaptic g... 179 8e-44
gi|46439872|gb|EAK99184.1| hypothetical protein CaO19.3293 [Cand... 167 3e-40
gi|50411010|ref|XP_457010.1| unnamed protein product [Debaryomyc... 166 7e-40
gi|46440150|gb|EAK99459.1| hypothetical protein CaO19.10803 [Can... 165 1e-39
gi|49088598|ref|XP_406105.1| hypothetical protein AN1968.2 [Aspe... 158 2e-37
gi|46107492|ref|XP_380805.1| hypothetical protein FG00629.1 [Gib... 153 6e-36
gi|6320189|ref|NP_010269.1| ER protein involved in very long cha... 148 1e-34
gi|1078828|pir||S50086 SC2 protein - Caenorhabditis briggsae (fr... 147 3e-34
gi|32404014|ref|XP_322620.1| hypothetical protein [Neurospora cr... 139 1e-31
gi|50291745|ref|XP_448305.1| unnamed protein product [Candida gl... 135 1e-30
gi|47937269|gb|AAH72463.1| Unknown (protein for MGC:62104) [Homo... 133 6e-30
gi|45190818|ref|NP_985072.1| AER215Wp [Eremothecium gossypii] >g... 124 2e-27
gi|50304873|ref|XP_452392.1| unnamed protein product [Kluyveromy... 121 3e-26
gi|38105199|gb|EAA51655.1| hypothetical protein MG03250.4 [Magna... 119 1e-25
gi|50258120|gb|EAL20814.1| hypothetical protein CNBE1760 [Crypto... 113 5e-24
gi|29245293|gb|EAA36940.1| GLP_333_5770_6450 [Giardia lamblia AT... 94 3e-18
gi|23508561|ref|NP_701230.1| hypothetical protein [Plasmodium fa... 88 2e-16
gi|49900198|gb|AAH76920.1| Unknown (protein for MGC:89116) [Xeno... 87 7e-16
gi|29245294|gb|EAA36941.1| GLP_333_6491_6808 [Giardia lamblia AT... 84 6e-15
gi|15237245|ref|NP_197105.1| 3-oxo-5-alpha-steroid 4-dehydrogena... 81 4e-14
gi|39812447|ref|NP_000339.2| 3-oxo-5 alpha-steroid 4-dehydrogena... 80 5e-14
gi|401056|sp|P31213|S5A2_HUMAN 3-oxo-5-alpha-steroid 4-dehydroge... 80 5e-14
gi|34899914|ref|NP_911303.1| steroid 5alpha-reductase-like prote... 80 6e-14
gi|2498888|sp|Q28892|S5A2_MACFA 3-oxo-5-alpha-steroid 4-dehydrog... 80 8e-14
gi|17567167|ref|NP_510077.1| steroid 5 alpha-reductase family me... 80 8e-14
gi|25742565|ref|NP_058766.1| steroid 5 alpha-reductase 1; steroi... 79 1e-13
gi|206838|gb|AAA42102.1| steroid 5 alpha-reductase (EC 1.3.99.5) 79 1e-13
gi|39588030|emb|CAE57261.1| Hypothetical protein CBG00143 [Caeno... 78 2e-13
gi|12083683|ref|NP_073202.1| steroid 5-alpha-reductase 2 [Rattus... 77 4e-13
gi|47522802|ref|NP_999153.1| steroid 5-alpha-reductase 2 [Sus sc... 75 2e-12
gi|16716485|ref|NP_444418.1| steroid 5 alpha-reductase 2 [Mus mu... 74 4e-12
gi|228295|prf||1802385A steroid 5alpha reductase 2 74 6e-12
gi|23490860|gb|EAA22535.1| hypothetical protein [Plasmodium yoel... 68 3e-10
gi|17567677|ref|NP_510071.1| steroid 5 alpha-reductase (XM969) [... 68 3e-10
gi|2498887|sp|Q28891|S5A1_MACFA 3-oxo-5-alpha-steroid 4-dehydrog... 62 1e-08
gi|17544706|ref|NP_501719.1| steroid 5 alpha-reductase family me... 62 2e-08
gi|6523819|gb|AAF14869.1| steroid-5-alpha-reductase isoform [Hom... 60 5e-08
gi|39589767|emb|CAE67002.1| Hypothetical protein CBG12401 [Caeno... 60 7e-08
gi|34876805|ref|XP_344228.1| similar to synaptic glycoprotein SC... 59 2e-07
gi|4507201|ref|NP_001038.1| steroid-5-alpha-reductase 1; 3-oxo-5... 58 3e-07
gi|30583847|gb|AAP36172.1| Homo sapiens steroid-5-alpha-reductas... 58 3e-07
gi|11493760|gb|AAG35638.1| putative steroid reductase [Glycine max] 58 3e-07
gi|23476464|gb|AAN28012.1| steroid 5-alpha-reductase [Gossypium ... 58 3e-07
gi|34850849|dbj|BAC87862.1| steroid 5alpha-reductase [Ipomoea nil] 56 1e-06
gi|9651158|gb|AAF91079.1| prostatic steroid 5-alpha-reductase ty... 55 2e-06
gi|19114263|ref|NP_593351.1| putative steroid reductase [Schizos... 54 5e-06
gi|47229503|emb|CAF99491.1| unnamed protein product [Tetraodon n... 54 6e-06
gi|27881427|ref|NP_065636.2| steroid 5 alpha-reductase 2-like; H... 53 1e-05
gi|39593321|emb|CAE64791.1| Hypothetical protein CBG09584 [Caeno... 53 1e-05
gi|15224430|ref|NP_181340.1| 3-oxo-5-alpha-steroid 4-dehydrogena... 52 2e-05
gi|13375785|ref|NP_078868.1| hypothetical protein FLJ13352 [Homo... 52 2e-05
gi|4836808|gb|AAD30567.1| SRD5A2L [Mus musculus] 52 2e-05
gi|29840908|gb|AAP05909.1| similar to NC_001141 protein required... 51 3e-05
gi|34555842|emb|CAA94885.2| Hypothetical protein B0024.13a [Caen... 51 3e-05
gi|38345532|emb|CAD41302.2| OSJNBa0020J04.7 [Oryza sativa (japon... 51 4e-05
gi|34877236|ref|XP_223346.2| similar to SRD5A2L [Rattus norvegicus] 51 4e-05
gi|9651160|gb|AAF91080.1| prostatic steroid 5-alpha-reductase ty... 50 5e-05
gi|49075080|ref|XP_401630.1| hypothetical protein UM04015.1 [Ust... 50 7e-05
gi|17557236|ref|NP_505655.1| 3-oxo-5-alpha-steroid 4-dehydrogena... 50 9e-05
gi|34908346|ref|NP_915520.1| putative steroid reductase DET2 [Or... 50 9e-05
gi|34393360|dbj|BAC83358.1| putative 3-oxo-5-alpha-steroid 4-deh... 48 4e-04
gi|1280611|gb|AAC49264.1| steroid reductase DET2 [Arabidopsis th... 47 5e-04
gi|47219339|emb|CAG10968.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|42570801|ref|NP_973474.1| 3-oxo-5-alpha-steroid 4-dehydrogena... 47 8e-04
gi|25411720|pir||D84541 hypothetical protein At2g16530 [imported... 47 8e-04
gi|18398148|ref|NP_565389.1| 3-oxo-5-alpha-steroid 4-dehydrogena... 47 8e-04
gi|15450391|gb|AAK96489.1| At2g16530/F1P15.9 [Arabidopsis thalia... 47 8e-04
gi|15218532|ref|NP_177403.1| 3-oxo-5-alpha-steroid 4-dehydrogena... 46 0.001
gi|42528197|ref|NP_973295.1| 3-oxo-5-alpha-steroid 4-dehydrogena... 46 0.001
gi|50740692|ref|XP_419532.1| PREDICTED: similar to transcription... 45 0.002
gi|29347478|ref|NP_810981.1| 3-oxo-5-alpha-steroid 4-dehydrogena... 45 0.003
gi|27503918|gb|AAH42255.1| MGC53983 protein [Xenopus laevis] 45 0.003
gi|50261040|gb|EAL23690.1| hypothetical protein CNBA3370 [Crypto... 45 0.003
gi|31198869|ref|XP_308382.1| ENSANGP00000019177 [Anopheles gambi... 44 0.007
gi|21483424|gb|AAM52687.1| LD35060p [Drosophila melanogaster] 43 0.009
gi|50746979|ref|XP_420703.1| PREDICTED: similar to hypothetical ... 43 0.009
gi|20129365|ref|NP_609203.1| CG7840-PA [Drosophila melanogaster]... 43 0.009
gi|2136504|pir||I47141 gastric mucin (clone PGM-2A) - pig (fragm... 39 0.13
gi|46445626|gb|EAL04894.1| hypothetical protein CaO19.4906 [Cand... 38 0.28
gi|6324002|ref|NP_014072.1| Glycosylphosphatidylinositol (GPI)-a... 38 0.37
gi|46445432|gb|EAL04701.1| hypothetical protein CaO19.12372 [Can... 37 0.81
gi|19113482|ref|NP_596690.1| hypothetical serine-rich secreted p... 37 0.81
gi|34809538|gb|AAQ82691.1| Epa1p [Candida glabrata] 36 1.1
gi|19072710|gb|AAL84600.1| HA-tagged epithelial adhesion 1 [Clon... 36 1.1
gi|19115835|ref|NP_594923.1| hypothetical fungal binuclear clust... 36 1.1
gi|50288227|ref|XP_446542.1| unnamed protein product [Candida gl... 36 1.1
gi|50736023|ref|XP_419022.1| PREDICTED: similar to 3-oxo-5-alpha... 36 1.1
gi|6322140|ref|NP_012215.1| Protein of unknown function, involve... 36 1.4
gi|47199615|emb|CAF88134.1| unnamed protein product [Tetraodon n... 36 1.4
gi|42734036|gb|AAS38911.1| similar to Leishmania major. Ppg3 [Di... 35 1.8
gi|39935085|ref|NP_947361.1| possible methyltransferase related ... 35 1.8
gi|47229017|emb|CAG09532.1| unnamed protein product [Tetraodon n... 35 2.4
gi|50423891|ref|XP_460530.1| unnamed protein product [Debaryomyc... 35 3.1
gi|15222756|ref|NP_175962.1| F-box family protein [Arabidopsis t... 35 3.1
gi|8778488|gb|AAF79496.1| F20N2.9 [Arabidopsis thaliana] 35 3.1
gi|32403720|ref|XP_322473.1| hypothetical protein [Neurospora cr... 35 3.1
gi|24646737|ref|NP_650326.1| CG12537-PA [Drosophila melanogaster... 34 4.0
gi|46136797|ref|XP_390090.1| hypothetical protein FG09914.1 [Gib... 34 4.0
gi|6715597|ref|NP_031364.1| deleted in lung and esophageal cance... 34 5.3
gi|6715593|ref|NP_031362.1| deleted in lung and esophageal cance... 34 5.3
gi|6715591|ref|NP_031361.1| deleted in lung and esophageal cance... 34 5.3
gi|6715595|ref|NP_031363.1| deleted in lung and esophageal cance... 34 5.3
gi|138595|sp|P02845|VIT2_CHICK Vitellogenin II precursor (Major ... 34 5.3
gi|33598863|ref|NP_886506.1| alcohol dehydrogenase [Bordetella p... 34 5.3
gi|21756339|dbj|BAC04860.1| unnamed protein product [Homo sapiens] 34 5.3
gi|11385308|pir||VJCH2 vitellogenin II precursor [validated] - c... 34 5.3
gi|4826696|ref|NP_005097.1| deleted in lung and esophageal cance... 34 5.3
gi|212879|gb|AAA98791.1| Gallus gallus vitellogenin 34 5.3
gi|23104247|ref|ZP_00090715.1| COG1989: Type II secretory pathwa... 34 5.3
gi|46226402|gb|EAK87402.1| signal peptide containing cysteine ri... 33 6.9
gi|34896552|ref|NP_909620.1| putative polyprotein [Oryza sativa ... 33 6.9
gi|19112069|ref|NP_595277.1| hypothetical protein; sequence orph... 33 6.9
gi|32471923|ref|NP_864917.1| multidrug resistance protein MexA [... 33 9.0
gi|23486939|gb|EAA20926.1| dfg10 protein [Plasmodium yoelii yoelii] 33 9.0
gi|41146797|ref|XP_374368.1| hypothetical protein XP_379755 [Hom... 33 9.0
>gi|17531783|ref|NP_495430.1| steroid Alpha ReducTase family,
3-oxo-5-alpha-steroid 4-dehydrogenase similar to
vertebrate synaptic glycoprotein SC2 (35.1 kD) (art-1)
[Caenorhabditis elegans]
gi|7206593|gb|AAF39753.1| Steroid alpha reductase family protein 1
[Caenorhabditis elegans]
Length = 308
Score = 597 bits (1539), Expect = e-169
Identities = 294/308 (95%), Positives = 294/308 (95%)
Frame = -1
Query: 927 MSGILEVYDAKRTDNLIITLEGISGSETXXXXXXXXXXXXXXLTEERQALRVEPKGKPLA 748
MSGILEVYDAKRTDNLIITLEGISGSET LTEERQALRVEPKGKPLA
Sbjct: 1 MSGILEVYDAKRTDNLIITLEGISGSETIKAIKKRIAQKKLKLTEERQALRVEPKGKPLA 60
Query: 747 DDQKLSDLGLSSQKAVLYVRDLGPQIAWKTVFMAEYAGPLFVYPLFYLRPTFIYGQAAVN 568
DDQKLSDLGLSSQKAVLYVRDLGPQIAWKTVFMAEYAGPLFVYPLFYLRPTFIYGQAAVN
Sbjct: 61 DDQKLSDLGLSSQKAVLYVRDLGPQIAWKTVFMAEYAGPLFVYPLFYLRPTFIYGQAAVN 120
Query: 567 ATMHPAVQIAFFAWSFHYAKRLFETQFIHRFGNSTMPQFNLVKNCSYYWGFAAFVAYFVN 388
ATMHPAVQIAFFAWSFHYAKRLFETQFIHRFGNSTMPQFNLVKNCSYYWGFAAFVAYFVN
Sbjct: 121 ATMHPAVQIAFFAWSFHYAKRLFETQFIHRFGNSTMPQFNLVKNCSYYWGFAAFVAYFVN 180
Query: 387 HPLFTPPAFGDLQVYFGLAGFVISEFGNLSIHILLRNLRPAGTRERRIPKPDGNPLSLLF 208
HPLFTPPAFGDLQVYFGLAGFVISEFGNLSIHILLRNLRPAGTRERRIPKPDGNPLSLLF
Sbjct: 181 HPLFTPPAFGDLQVYFGLAGFVISEFGNLSIHILLRNLRPAGTRERRIPKPDGNPLSLLF 240
Query: 207 NYVSCPNYTYEVASWIFFSIMVQSLPAIIFTTAGFAQMAIWAQGKHRNYLKEFPDYPKNR 28
NYVSCPNYTYEVASWIFFSIMVQSLPAIIFTTAGFAQMAIWAQGKHRNYLKEFPDYPKNR
Sbjct: 241 NYVSCPNYTYEVASWIFFSIMVQSLPAIIFTTAGFAQMAIWAQGKHRNYLKEFPDYPKNR 300
Query: 27 KAIVPFVL 4
KAIVPFVL
Sbjct: 301 KAIVPFVL 308