Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C25D7_3
(861 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17558194|ref|NP_506702.1| MSP-domain protein like family memb... 361 1e-98
gi|17560040|ref|NP_507098.1| MSP-domain protein like family memb... 296 5e-79
gi|17558208|ref|NP_506700.1| MSP-domain protein like family memb... 291 1e-77
gi|17560600|ref|NP_507182.1| MSP-domain protein like family memb... 265 1e-69
gi|39586114|emb|CAE69190.1| Hypothetical protein CBG15225 [Caeno... 212 7e-54
gi|17507523|ref|NP_492407.1| MSP-domain protein like family memb... 103 4e-21
gi|39589763|emb|CAE66998.1| Hypothetical protein CBG12397 [Caeno... 100 7e-20
gi|23169009|gb|AAN08883.1| MSP-domain protein 5 [Ascaris suum] >... 93 9e-18
gi|23169006|gb|AAN08882.1| MSP-domain protein 4 [Ascaris suum] >... 85 2e-15
gi|17540380|ref|NP_501472.1| MSP-domain protein like family memb... 68 3e-10
gi|33114622|gb|AAP94884.1| MFP1-alpha [Ascaris suum] 67 7e-10
gi|39591164|emb|CAE73217.1| Hypothetical protein CBG20623 [Caeno... 66 9e-10
gi|39596794|emb|CAE59021.1| Hypothetical protein CBG02298 [Caeno... 65 1e-09
gi|39592311|emb|CAE63388.1| Hypothetical protein CBG07809 [Caeno... 65 1e-09
gi|39582951|emb|CAE73016.1| Hypothetical protein CBG20377 [Caeno... 65 2e-09
gi|39591169|emb|CAE73222.1| Hypothetical protein CBG20628 [Caeno... 65 2e-09
gi|39581884|emb|CAE60778.1| Hypothetical protein CBG04467 [Caeno... 64 3e-09
gi|33114624|gb|AAP94885.1| MFP1-beta [Ascaris suum] 64 4e-09
gi|17542418|ref|NP_501739.1| MSP-domain protein like family memb... 64 6e-09
gi|17542092|ref|NP_501782.1| Sperm-Specific family, class P SSP-... 64 6e-09
gi|17540424|ref|NP_501808.1| MSP-domain protein like family memb... 63 9e-09
gi|23169000|gb|AAN08881.1| MSP-domain protein 3 [Ascaris suum] >... 62 2e-08
gi|50511753|gb|AAT77426.1| MSP-domain protein 1 variant [Ascaris... 62 2e-08
gi|50511751|gb|AAT77425.1| MSP-domain protein 1 variant [Ascaris... 62 2e-08
gi|50511755|gb|AAT77427.1| MSP-domain protein 1 variant [Ascaris... 62 2e-08
gi|50511745|gb|AAT77422.1| MSP-domain protein 1 variant [Ascaris... 62 2e-08
gi|49121580|gb|AAN08879.2| MSP-domain protein 1 [Ascaris suum] 62 2e-08
gi|34810947|pdb|1M1S|A Chain A, Structure Of Wr4, A C.Elegans Ms... 62 2e-08
gi|17562962|ref|NP_506630.1| MSP-domain protein like family memb... 61 3e-08
gi|39592211|emb|CAE75432.1| Hypothetical protein CBG23425 [Caeno... 61 4e-08
gi|17508749|ref|NP_491762.1| Sperm-Specific family, class P SSP-... 60 5e-08
gi|17544490|ref|NP_501989.1| MSP-domain protein like family memb... 60 6e-08
gi|17542088|ref|NP_501767.1| MSP-domain protein like family memb... 60 6e-08
gi|17542086|ref|NP_500697.1| Sperm-Specific family, class P SSP-... 60 6e-08
gi|17508753|ref|NP_493318.1| Sperm-Specific family, class P SSP-... 60 6e-08
gi|39594899|emb|CAE70767.1| Hypothetical protein CBG17518 [Caeno... 60 6e-08
gi|17561434|ref|NP_506076.1| major sperm protein, member of a la... 60 8e-08
gi|50511749|gb|AAT77424.1| MSP-domain protein 1 variant [Ascaris... 59 1e-07
gi|39593130|emb|CAE64599.1| Hypothetical protein CBG09354 [Caeno... 59 1e-07
gi|39589662|emb|CAE66897.1| Hypothetical protein CBG12279 [Caeno... 59 1e-07
gi|17562648|ref|NP_504485.1| MSP-domain protein like family memb... 58 2e-07
gi|17508751|ref|NP_491000.1| Sperm-Specific family, class P SSP-... 58 2e-07
gi|39594026|emb|CAE70136.1| Hypothetical protein CBG16598 [Caeno... 57 4e-07
gi|17568285|ref|NP_509840.1| predicted CDS, MSP-domain protein l... 56 1e-06
gi|17539024|ref|NP_501124.1| major sperm protein with N myristoy... 52 2e-05
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 52 2e-05
gi|39582088|emb|CAE63731.1| Hypothetical protein CBG08258 [Caeno... 52 2e-05
gi|39594090|emb|CAE70200.1| Hypothetical protein CBG16675 [Caeno... 51 3e-05
gi|17505881|ref|NP_492824.1| vamp-associated protein like family... 51 3e-05
gi|17552806|ref|NP_498780.1| MSP-domain protein like family memb... 51 4e-05
gi|39591787|emb|CAE71365.1| Hypothetical protein CBG18269 [Caeno... 50 5e-05
gi|17509511|ref|NP_491051.1| MSP-domain protein like family memb... 50 8e-05
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno... 50 8e-05
gi|39591509|emb|CAE73563.1| Hypothetical protein CBG21033 [Caeno... 49 1e-04
gi|39595447|emb|CAE60485.1| Hypothetical protein CBG04099 [Caeno... 49 1e-04
gi|39595357|emb|CAE60394.1| Hypothetical protein CBG03996 [Caeno... 47 7e-04
gi|17538127|ref|NP_496078.1| predicted CDS, MSP-domain protein l... 46 0.001
gi|39583643|emb|CAE65747.1| Hypothetical protein CBG10833 [Caeno... 45 0.003
gi|17538125|ref|NP_496079.1| predicted CDS, MSP-domain protein l... 44 0.005
gi|39583249|emb|CAE60041.1| Hypothetical protein CBG03552 [Caeno... 44 0.005
gi|17505564|ref|NP_491434.1| MSP-domain protein like (19.5 kD) (... 44 0.006
gi|7496307|pir||T15562 hypothetical protein C18F10.2 - Caenorhab... 42 0.013
gi|25152845|ref|NP_741183.1| predicted CDS, major sperm protein ... 42 0.013
gi|39582189|emb|CAE71521.1| Hypothetical protein CBG18456 [Caeno... 42 0.023
gi|45200815|ref|NP_986385.1| AGL282Wp [Eremothecium gossypii] >g... 42 0.023
gi|23168994|gb|AAN08880.1| MSP-domain protein 2 [Ascaris suum] >... 41 0.038
gi|17534907|ref|NP_495146.1| MSP-domain protein 2 like family me... 40 0.086
gi|50730245|ref|XP_416825.1| PREDICTED: similar to motile sperm ... 40 0.086
gi|39579370|emb|CAE56171.1| Hypothetical protein CBG23791 [Caeno... 39 0.11
gi|27364224|ref|NP_759752.1| Predicted nucleoside-diphosphate su... 39 0.11
gi|37678548|ref|NP_933157.1| predicted nucleoside-diphosphate su... 39 0.11
gi|12845958|dbj|BAB26972.1| unnamed protein product [Mus musculus] 38 0.25
gi|46431794|gb|EAK91321.1| hypothetical protein CaO19.8800 [Cand... 38 0.25
gi|20071715|gb|AAH26425.1| Mospd2 protein [Mus musculus] 38 0.25
gi|46431781|gb|EAK91309.1| hypothetical protein CaO19.1212 [Cand... 38 0.25
gi|17542484|ref|NP_502216.1| MSP-domain protein 2 like family me... 38 0.25
gi|38086967|ref|XP_136156.2| RIKEN cDNA 2410013I23 [Mus musculus... 38 0.25
gi|49069870|ref|XP_399224.1| hypothetical protein UM01609.1 [Ust... 38 0.25
gi|22749197|ref|NP_689794.1| motile sperm domain containing 2 [H... 38 0.33
gi|39595208|emb|CAE60245.1| Hypothetical protein CBG03818 [Caeno... 38 0.33
gi|21751825|dbj|BAC04043.1| unnamed protein product [Homo sapiens] 38 0.33
gi|21739984|emb|CAD39011.1| hypothetical protein [Homo sapiens] 38 0.33
gi|47226997|emb|CAG05889.1| unnamed protein product [Tetraodon n... 37 0.42
gi|47086745|ref|NP_997812.1| vesicle-associated membrane protein... 37 0.42
gi|39589663|emb|CAE66898.1| Hypothetical protein CBG12280 [Caeno... 37 0.42
gi|39595110|emb|CAE60147.1| Hypothetical protein CBG03696 [Caeno... 37 0.42
gi|17563008|ref|NP_506815.1| predicted CDS, major sperm protein ... 37 0.42
gi|50428123|ref|XP_457850.1| unnamed protein product [Debaryomyc... 37 0.55
gi|6320966|ref|NP_011046.1| Protein likely to be involved in reg... 37 0.55
gi|33328907|gb|AAQ09860.1| CG7919 [Drosophila yakuba] 37 0.72
gi|17560900|ref|NP_506264.1| predicted CDS, MSP-domain protein 1... 36 0.95
gi|50549925|ref|XP_502434.1| hypothetical protein [Yarrowia lipo... 36 1.2
gi|33300172|emb|CAE17819.1| Hypothetical protein F52F12.8 [Caeno... 36 1.2
gi|17554100|ref|NP_499837.1| predicted CDS, major sperm protein ... 36 1.2
gi|39593527|emb|CAE61819.1| Hypothetical protein CBG05789 [Caeno... 36 1.2
gi|24660611|ref|NP_524657.2| CG7919-PA [Drosophila melanogaster]... 35 1.6
gi|17557470|ref|NP_506723.1| MSP-domain protein like family memb... 35 1.6
gi|17557067|ref|NP_498721.1| MSP-domain protein 2 like family me... 35 2.1
gi|39591543|emb|CAE71119.1| Hypothetical protein CBG17972 [Caeno... 35 2.8
gi|50540158|ref|NP_001002546.1| zgc:92788 [Danio rerio] >gnl|BL_... 35 2.8
gi|17558192|ref|NP_506701.1| MSP-domain protein like family memb... 35 2.8
gi|41016785|sp|O13340|CARP_PODAN Podosporapepsin precursor >gnl|... 34 3.6
gi|7435831|pir||JC6557 podosporapepsin (EC 3.4.23.-) - Podospora... 34 3.6
gi|49068816|ref|XP_398697.1| hypothetical protein UM01082.1 [Ust... 34 3.6
gi|17541248|ref|NP_501765.1| predicted CDS, MSP-domain protein l... 34 3.6
gi|7499047|pir||T16062 hypothetical protein F13H8.3 - Caenorhabd... 34 4.7
gi|49094164|ref|XP_408543.1| hypothetical protein AN4406.2 [Aspe... 34 4.7
gi|32565857|ref|NP_872064.1| predicted CDS, major sperm protein ... 34 4.7
gi|39591703|emb|CAE71281.1| Hypothetical protein CBG18166 [Caeno... 34 4.7
gi|17558002|ref|NP_506565.1| predicted CDS, MSP-domain protein 2... 34 4.7
gi|29841172|gb|AAP06185.1| similar to GenBank Accession Number U... 34 4.7
gi|46228452|gb|EAK89322.1| VPS13 like protein involved in vacuol... 34 4.7
gi|32421809|ref|XP_331348.1| hypothetical protein [Neurospora cr... 34 4.7
gi|32418290|ref|XP_329623.1| hypothetical protein [Neurospora cr... 34 4.7
gi|17534407|ref|NP_495345.1| vamp-associated protein like (2G913... 34 4.7
gi|38303797|gb|AAH61951.1| Zgc:77382 protein [Danio rerio] 33 6.1
gi|85049|pir||A40580 lodestar maternal-effect protein - fruit fl... 33 6.1
gi|37588848|ref|NP_003565.3| vesicle-associated membrane protein... 33 6.1
gi|42734418|ref|NP_956212.2| Unknown (protein for MGC:65776); wu... 33 6.1
gi|21392184|gb|AAM48446.1| RE70645p [Drosophila melanogaster] 33 6.1
gi|24644932|ref|NP_524850.2| CG2684-PA [Drosophila melanogaster]... 33 6.1
gi|15238034|ref|NP_199529.1| vesicle-associated membrane family ... 33 6.1
gi|8099350|gb|AAF72105.1| 33 kDa Vamp-associated protein [Homo s... 33 6.1
gi|3320446|gb|AAC26508.1| VAMP-associated protein of 33 kDa [Hom... 33 6.1
gi|37588850|ref|NP_919415.1| vesicle-associated membrane protein... 33 6.1
gi|50288189|ref|XP_446523.1| unnamed protein product [Candida gl... 33 8.0
>gi|17558194|ref|NP_506702.1| MSP-domain protein like family member
(5P518) [Caenorhabditis elegans]
gi|7496473|pir||T19449 hypothetical protein C25D7.2 -
Caenorhabditis elegans
gi|3874448|emb|CAB02773.1| Hypothetical protein C25D7.2
[Caenorhabditis elegans]
Length = 286
Score = 361 bits (926), Expect = 1e-98
Identities = 199/286 (69%), Positives = 199/286 (69%)
Frame = -1
Query: 861 MISLVSLIATASATSTVLAMGSSKDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGHLSR 682
MISLVSLIATASATSTVLAMGSSKDR SGHLSR
Sbjct: 1 MISLVSLIATASATSTVLAMGSSKDRQAASATKSSRASKSQKSAKSTRSGKSSKSGHLSR 60
Query: 681 GKPXXXXXXXXXSVRPLAVPGARGAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 502
GKP SVRPLAVPGARGAP
Sbjct: 61 GKPSKSKKSKSKSVRPLAVPGARGAPKSESKKLRRDKDKSSKSERSRRSSKSKKCDKSAK 120
Query: 501 XXXLNKAKNLCPPVSVVSDAXXXXXXXXXXXXXKALKLVPNQSNYTFPEGQGTASVKTST 322
LNKAKNLCPPVSVVSDA KALKLVPNQSNYTFPEGQGTASVKTST
Sbjct: 121 KCDLNKAKNLCPPVSVVSDASIKSNSGEKSEKSKALKLVPNQSNYTFPEGQGTASVKTST 180
Query: 321 LRASPNKLPFATTGGVQTVSIANNTKSRKAFKVKTSDNLLYRVNPVFGFVEPGDKLSIDV 142
LRASPNKLPFATTGGVQTVSIANNTKSRKAFKVKTSDNLLYRVNPVFGFVEPGDKLSIDV
Sbjct: 181 LRASPNKLPFATTGGVQTVSIANNTKSRKAFKVKTSDNLLYRVNPVFGFVEPGDKLSIDV 240
Query: 141 LRHNGVEKTDHMIVLTSNASSEQNCAKGVFESDQPRELTVIPLVVN 4
LRHNGVEKTDHMIVLTSNASSEQNCAKGVFESDQPRELTVIPLVVN
Sbjct: 241 LRHNGVEKTDHMIVLTSNASSEQNCAKGVFESDQPRELTVIPLVVN 286