Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C27A2_2
(393 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532093|ref|NP_494932.1| ribosomal Protein, Large subunit (1... 152 1e-36
gi|39596802|emb|CAE59029.1| Hypothetical protein CBG02309 [Caeno... 147 5e-35
gi|4506613|ref|NP_000974.1| ribosomal protein L22 proprotein; 60... 86 2e-16
gi|6677775|ref|NP_033105.1| ribosomal protein L22 [Mus musculus]... 86 2e-16
gi|13592059|ref|NP_112366.1| ribosomal protein L22 [Rattus norve... 86 2e-16
gi|33150766|gb|AAP97261.1| heparin-binding protein HBp15 [Homo s... 86 2e-16
gi|15293911|gb|AAK95148.1| ribosomal protein L22 [Ictalurus punc... 86 2e-16
gi|1710518|sp|P50886|RL22_XENLA 60S RIBOSOMAL PROTEIN L22 >gnl|B... 85 3e-16
gi|45383834|ref|NP_989472.1| ribosomal protein L22 [Gallus gallu... 84 5e-16
gi|1710516|sp|P52865|RL22_GADMO 60S RIBOSOMAL PROTEIN L22 >gnl|B... 83 1e-15
gi|24266951|gb|AAN52375.1| ribosomal protein L22 [Branchiostoma ... 81 5e-15
gi|118204|sp|P13732|RL22_TRIGR 60S RIBOSOMAL PROTEIN L22 (DEVELO... 79 3e-14
gi|30149441|ref|XP_114317.3| similar to RIKEN cDNA 3110001N18 [H... 77 1e-13
gi|38571737|gb|AAH62731.1| LOC200916 protein [Homo sapiens] 77 1e-13
gi|13386010|ref|NP_080793.1| RIKEN cDNA 3110001N18 [Mus musculus... 76 2e-13
gi|34859197|ref|XP_345432.1| similar to RIKEN cDNA 3110001N18 [R... 76 2e-13
gi|12851559|dbj|BAB29090.1| unnamed protein product [Mus musculu... 76 2e-13
gi|47209412|emb|CAF89590.1| unnamed protein product [Tetraodon n... 75 3e-13
gi|50752478|ref|XP_422795.1| PREDICTED: similar to RIKEN cDNA 31... 75 3e-13
gi|4378008|gb|AAD19341.1| ribosomal protein L22 [Drosophila mela... 70 1e-11
gi|15213770|gb|AAK92160.1| ribosomal protein L22 [Spodoptera fru... 70 1e-11
gi|17137152|ref|NP_477134.1| CG7434-PA [Drosophila melanogaster]... 69 2e-11
gi|31209901|ref|XP_313917.1| ENSANGP00000021862 [Anopheles gambi... 69 2e-11
gi|15230008|ref|NP_187207.1| 60S ribosomal protein L22-2 (RPL22B... 69 2e-11
gi|15241051|ref|NP_198129.1| 60S ribosomal protein L22 (RPL22C) ... 68 4e-11
gi|15218615|ref|NP_171782.1| 60S ribosomal protein L22 (RPL22A) ... 67 6e-11
gi|41146640|ref|XP_371679.1| similar to ribosomal protein L22 [H... 67 6e-11
gi|37543888|ref|XP_171590.2| similar to ribosomal protein L22 [H... 67 8e-11
gi|34873963|ref|XP_221003.2| similar to RIKEN cDNA 3110001N18 [R... 67 8e-11
gi|42733478|dbj|BAD11336.1| BRI1-KD interacting protein 108 [Ory... 67 1e-10
gi|38089107|ref|XP_146216.2| similar to ribosomal protein L22 [M... 66 1e-10
gi|34393853|dbj|BAC83533.1| putative 60S ribosomal protein L22 [... 66 1e-10
gi|27711246|ref|XP_222468.1| similar to RIKEN cDNA 3110001N18 [R... 66 2e-10
gi|42656410|ref|XP_377760.1| similar to ribosomal protein L22 [H... 62 2e-09
gi|20984063|ref|XP_141816.1| similar to RIKEN cDNA 3110001N18 [M... 62 3e-09
gi|38103670|gb|EAA50345.1| hypothetical protein MG04104.4 [Magna... 60 1e-08
gi|46229445|gb|EAK90263.1| 60S ribosomal protein L22 , transcrip... 59 2e-08
gi|49068024|ref|XP_398301.1| hypothetical protein UM00686.1 [Ust... 59 2e-08
gi|11276888|pir||T43208 ribosomal protein L22-like protein - fis... 58 4e-08
gi|19115852|ref|NP_594940.1| 60s ribosomal protein l22 [Schizosa... 58 4e-08
gi|25777813|gb|AAN75619.1| RPL22 [Cryptococcus neoformans var. n... 58 5e-08
gi|25956312|gb|AAN75726.1| RPL22 [Cryptococcus neoformans var. n... 58 5e-08
gi|25573213|gb|AAN75181.1| RPL22 [Cryptococcus neoformans var. g... 57 6e-08
gi|25573184|gb|AAN75160.1| RPL22 [Cryptococcus neoformans var. g... 57 6e-08
gi|23612799|ref|NP_704338.1| ribosomal protein, putative [Plasmo... 55 4e-07
gi|32412934|ref|XP_326947.1| hypothetical protein [Neurospora cr... 53 2e-06
gi|49095380|ref|XP_409151.1| hypothetical protein AN5014.2 [Aspe... 53 2e-06
gi|24659188|ref|NP_611771.1| CG9871-PA [Drosophila melanogaster]... 50 8e-06
gi|19528157|gb|AAL90193.1| AT26853p [Drosophila melanogaster] 50 8e-06
gi|17532091|ref|NP_494933.1| ribosomal Protein, Large subunit (r... 49 2e-05
gi|46136917|ref|XP_390150.1| hypothetical protein FG09974.1 [Gib... 49 2e-05
gi|627739|pir||JU0179 heparin-binding protein 15 - bovine 49 3e-05
gi|6323090|ref|NP_013162.1| Protein component of the large (60S)... 47 7e-05
gi|50413027|ref|XP_457196.1| unnamed protein product [Debaryomyc... 47 1e-04
gi|47206194|emb|CAF91864.1| unnamed protein product [Tetraodon n... 46 1e-04
gi|50306635|ref|XP_453291.1| unnamed protein product [Kluyveromy... 43 0.001
gi|45185907|ref|NP_983623.1| ACR221Wp [Eremothecium gossypii] >g... 43 0.002
gi|14318484|ref|NP_116619.1| Protein component of the large (60S... 43 0.002
gi|23479175|gb|EAA16077.1| ribosomal protein L22-related [Plasmo... 38 0.053
gi|39585787|emb|CAE59989.1| Hypothetical protein CBG03482 [Caeno... 33 1.00
gi|19074151|ref|NP_584757.1| 60S RIBOSOMAL PROTEIN L22 [Encephal... 33 1.3
>gi|17532093|ref|NP_494932.1| ribosomal Protein, Large subunit (14.9
kD) (rpl-22) [Caenorhabditis elegans]
gi|1710514|sp|P52819|RL22_CAEEL 60S ribosomal protein L22
gi|7441113|pir||T15648 hypothetical protein C27A2.2 -
Caenorhabditis elegans
gi|13592361|gb|AAK31460.1| Ribosomal protein, large subunit protein
22, isoform a [Caenorhabditis elegans]
Length = 130
Score = 152 bits (385), Expect = 1e-36
Identities = 79/130 (60%), Positives = 79/130 (60%)
Frame = +1
Query: 1 MVPKPXXXXXXXXXXXXXXXXXFNVECKNPVEDGILRIEDLEAFLNEKIKVNGKTGHLXX 180
MVPKP FNVECKNPVEDGILRIEDLEAFLNEKIKVNGKTGHL
Sbjct: 1 MVPKPHAKSAKKALRKKKVHLKFNVECKNPVEDGILRIEDLEAFLNEKIKVNGKTGHLAA 60
Query: 181 XXXXXXXXXXXXXXXXXXPFSXXXXXXXXXXXXXXNSLRDWLRVVAVNKNTYEVRYFHIN 360
PFS NSLRDWLRVVAVNKNTYEVRYFHIN
Sbjct: 61 NNVKVEVAKSKVSVVSEVPFSKRYLKYLTKKYLKRNSLRDWLRVVAVNKNTYEVRYFHIN 120
Query: 361 DGEDAGSDHE 390
DGEDAGSDHE
Sbjct: 121 DGEDAGSDHE 130