Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C27B7_1
         (787 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17538616|ref|NP_501542.1| maturing Oocyte Expressed MOE-1, Oo...   494   e-139
gi|39586403|emb|CAE74060.1| Hypothetical protein CBG21712 [Caeno...   323   2e-87
gi|17566742|ref|NP_505069.1| maturing Oocyte Expressed MOE-2, Oo...   313   2e-84
gi|39597211|emb|CAE59438.1| Hypothetical protein CBG02811 [Caeno...   155   9e-37
gi|17533629|ref|NP_496795.1| maturing Oocyte Expressed MOE-3, C-...   137   3e-31
gi|39777543|gb|AAR31111.1| tristetraprolin [Ovis aries]                60   4e-08
gi|6756059|ref|NP_035886.1| zinc finger protein 36; tristetrapro...    55   2e-06
gi|12836625|dbj|BAB23739.1| unnamed protein product [Mus musculus]     55   2e-06
gi|18959224|ref|NP_579824.1| zinc finger protein 36 [Rattus norv...    54   3e-06
gi|4580020|gb|AAD24207.1| CCCH zinc finger protein C3H-1 [Xenopu...    52   2e-05
gi|27819622|ref|NP_776918.1| zinc finger protein homologous to Z...    51   3e-05
gi|4580022|gb|AAD24208.1| CCCH zinc finger protein C3H-2 [Xenopu...    50   5e-05
gi|4507961|ref|NP_003398.1| zinc finger protein 36, C3H type, ho...    50   5e-05
gi|39590310|emb|CAE66049.1| Hypothetical protein CBG11249 [Caeno...    50   7e-05
gi|39591355|emb|CAE73409.1| Hypothetical protein CBG20851 [Caeno...    49   9e-05
gi|49119467|gb|AAH73564.1| Unknown (protein for IMAGE:5511185) [...    49   1e-04
gi|39586280|emb|CAE66691.1| Hypothetical protein CBG12031 [Caeno...    48   2e-04
gi|17544434|ref|NP_503017.1| butyrate response factor 2 family m...    48   2e-04
gi|17541622|ref|NP_502566.1| C-x8-C-x5-C-x3-H type zinc finger c...    48   2e-04
gi|39579953|emb|CAE56140.1| Hypothetical protein CBG23753 [Caeno...    48   3e-04
gi|7508878|pir||T26124 hypothetical protein W03C9.7 - Caenorhabd...    47   4e-04
gi|17535269|ref|NP_496551.1| embryonic cell fate determinant, co...    47   4e-04
gi|17544440|ref|NP_503020.1| butyrate response factor 2 family m...    47   4e-04
gi|17535271|ref|NP_496043.1| C-x8-C-x5-C-x3-H type zinc finger c...    47   5e-04
gi|7494685|pir||T18624 hypothetical protein AH6.5 - Caenorhabdit...    47   5e-04
gi|34881683|ref|XP_228661.2| similar to butyrate response factor...    47   5e-04
gi|91828|pir||S04743 TPA-induced protein 11 - mouse >gnl|BL_ORD_...    47   6e-04
gi|17543792|ref|NP_502805.1| tis11 family member (22.7 kD) (4P68...    47   6e-04
gi|17544438|ref|NP_503019.1| butyrate response factor 2 (4R982) ...    47   6e-04
gi|111159|pir||B39590 TPA-induced protein 11B - mouse                  46   0.001
gi|5869806|emb|CAA76889.2| zinc finger protein [Danio rerio]           46   0.001
gi|5731751|emb|CAA71245.2| CTH1 protein [Cyprinus carpio]              46   0.001
gi|34862023|ref|XP_238444.2| similar to butyrate response factor...    46   0.001
gi|18858483|ref|NP_571014.1| cth1 [Danio rerio] >gnl|BL_ORD_ID|6...    46   0.001
gi|2353340|gb|AAB69448.1| Tis11 family protein [Crassostrea virg...    46   0.001
gi|4580026|gb|AAD24210.1| CCCH zinc finger protein C3H-4 [Xenopu...    45   0.002
gi|17562800|ref|NP_505172.1| cytoplasmic zinc-finger protein ess...    45   0.002
gi|47204423|emb|CAG14799.1| unnamed protein product [Tetraodon n...    45   0.002
gi|15812180|ref|NP_004917.2| butyrate response factor 1; EGF-res...    44   0.003
gi|1480243|emb|CAA67781.1| Berg36 [Homo sapiens]                       44   0.003
gi|984509|gb|AAA91778.1| Tis11d                                        44   0.004
gi|15812178|ref|NP_008818.3| butyrate response factor 2; EGF-res...    44   0.004
gi|13477111|gb|AAH05010.1| ZFP36L2 protein [Homo sapiens]              44   0.004
gi|31615566|pdb|1M9O|A Chain A, Nmr Structure Of The First Zinc ...    44   0.004
gi|20178341|sp|P47974|TISD_HUMAN Butyrate response factor 2 (TIS...    44   0.004
gi|1082358|pir||S49147 ERF-2 protein - human >gnl|BL_ORD_ID|1077...    44   0.004
gi|28278580|gb|AAH44086.1| Zfp36l2-prov protein [Xenopus laevis]       44   0.005
gi|6680808|ref|NP_031590.1| zinc finger protein 36, C3H type-lik...    44   0.005
gi|12017773|gb|AAG45251.1| TIS11D insertion variant [Mus musculus]     44   0.005
gi|8392999|ref|NP_058868.1| zinc finger protein 36, C3H type-lik...    44   0.005
gi|16741639|gb|AAH16621.1| Zfp36l1 protein [Mus musculus]              44   0.005
gi|135865|sp|P23949|TISD_MOUSE Butyrate response factor 2 (TIS11...    44   0.005
gi|48121295|ref|XP_393235.1| similar to Tis11 family protein [Ap...    44   0.005
gi|50748988|ref|XP_426433.1| PREDICTED: similar to Butyrate resp...    44   0.005
gi|46015500|pdb|1RGO|A Chain A, Structural Basis For Recognition...    44   0.005
gi|49249968|ref|NP_031591.2| zinc finger protein 36, C3H type-li...    44   0.005
gi|49249965|ref|NP_001001806.1| zinc finger protein 36, C3H type...    44   0.005
gi|27544283|dbj|BAC54909.1| hypothetical protein [Xenopus laevis]      44   0.005
gi|4580024|gb|AAD24209.1| CCCH zinc finger protein C3H-3 [Xenopu...    44   0.005
gi|12017771|gb|AAG45250.1| TIS11D deletion variant [Mus musculus]      44   0.005
gi|17570419|ref|NP_510397.1| butyrate response factor 2 family m...    43   0.007
gi|1706180|sp|P47976|CTH1_YEAST Zinc finger protein CTH1 >gnl|BL...    42   0.011
gi|6320355|ref|NP_010435.1| Putative transcription factor, membe...    42   0.011
gi|25408379|pir||E84768 hypothetical protein At2g35430 [imported...    42   0.011
gi|17570417|ref|NP_510396.1| C-x8-C-x5-C-x3-H type zinc finger c...    42   0.011
gi|31201609|ref|XP_309752.1| ENSANGP00000012577 [Anopheles gambi...    42   0.015
gi|19075093|ref|NP_586694.1| ZINC FINGER PROTEIN [Encephalitozoo...    42   0.015
gi|17540280|ref|NP_502930.1| butyrate response factor 2 family m...    42   0.015
gi|17540276|ref|NP_502931.1| butyrate response factor 2 family m...    42   0.015
gi|42569638|ref|NP_181086.2| zinc finger (CCCH-type) family prot...    42   0.019
gi|24641593|ref|NP_511141.2| CG4070-PA [Drosophila melanogaster]...    42   0.019
gi|663198|emb|CAA57066.1| TIScc1 [Drosophila melanogaster] >gnl|...    42   0.019
gi|24641595|ref|NP_727633.1| CG4070-PB [Drosophila melanogaster]...    42   0.019
gi|1729972|sp|P47980|TIS1_DROME TIS11 protein (dTIS11) >gnl|BL_O...    42   0.019
gi|41054479|ref|NP_955943.1| Unknown (protein for MGC:77882); wu...    42   0.019
gi|32563991|ref|NP_492238.2| C-x8-C-x5-C-x3-H type zinc finger c...    42   0.019
gi|6323165|ref|NP_013237.1| Zinc finger containing homolog of ma...    41   0.025
gi|46309479|ref|NP_996938.1| Unknown (protein for MGC:76924); wu...    41   0.025
gi|39592050|emb|CAE75270.1| Hypothetical protein CBG23235 [Caeno...    41   0.025
gi|45201139|ref|NP_986709.1| AGR044Cp [Eremothecium gossypii] >g...    41   0.025
gi|17539068|ref|NP_502949.1| butyrate response factor 2 family m...    41   0.025
gi|7500780|pir||T21954 hypothetical protein F38B7.1a - Caenorhab...    41   0.033
gi|32566849|ref|NP_505927.2| C-x8-C-x5-C-x3-H type zinc finger c...    41   0.033
gi|50286627|ref|XP_445742.1| unnamed protein product [Candida gl...    41   0.033
gi|19113245|ref|NP_596453.1| mating pheromone recognition pathwa...    41   0.033
gi|7500781|pir||T21955 hypothetical protein F38B7.1b - Caenorhab...    41   0.033
gi|32566847|ref|NP_505926.2| C-x8-C-x5-C-x3-H type zinc finger c...    41   0.033
gi|50423859|ref|XP_460514.1| unnamed protein product [Debaryomyc...    41   0.033
gi|7506946|pir||T24366 hypothetical protein T02E1.3a - Caenorhab...    41   0.033
gi|47221719|emb|CAG10191.1| unnamed protein product [Tetraodon n...    41   0.033
gi|47900276|gb|AAT39144.1| 'unknown protein, contains zinc finge...    40   0.043
gi|47212350|emb|CAF93268.1| unnamed protein product [Tetraodon n...    40   0.056
gi|17508791|ref|NP_492239.1| C-x8-C-x5-C-x3-H type zinc finger c...    40   0.056
gi|38086346|ref|XP_285657.2| similar to ERF-2 [Mus musculus]           40   0.056
gi|50555936|ref|XP_505376.1| hypothetical protein [Yarrowia lipo...    40   0.056
gi|50307627|ref|XP_453793.1| unnamed protein product [Kluyveromy...    40   0.056
gi|15912259|gb|AAL08263.1| At1g32359/F27G20.10 [Arabidopsis thal...    40   0.056
gi|18398397|ref|NP_564396.1| zinc finger (CCCH-type) family prot...    40   0.056
gi|15824518|gb|AAL09382.1| putative protein hc60.2 [Haemonchus c...    40   0.056
gi|39584070|emb|CAE66476.1| Hypothetical protein CBG11755 [Caeno...    40   0.056
gi|5360265|dbj|BAA81905.1| HrZF-1 [Halocynthia roretzi]                40   0.056
gi|15221301|ref|NP_176987.1| zinc finger (CCCH-type) family prot...    40   0.073
gi|34905220|ref|NP_913957.1| P0672D01.12 [Oryza sativa (japonica...    40   0.073
gi|34911700|ref|NP_917197.1| P0707D10.14 [Oryza sativa (japonica...    40   0.073
gi|15240145|ref|NP_196295.1| KH domain-containing protein / zinc...    39   0.16
gi|21555233|gb|AAM63810.1| unknown [Arabidopsis thaliana]              39   0.16
gi|46438755|gb|EAK98081.1| hypothetical protein CaO19.12794 [Can...    39   0.16
gi|50751512|ref|XP_422434.1| PREDICTED: similar to TOE1 homolog ...    39   0.16
gi|14018368|emb|CAC38358.1| zinc finger protein [Pisum sativum]        38   0.21
gi|47228275|emb|CAG07670.1| unnamed protein product [Tetraodon n...    38   0.21
gi|24899214|dbj|BAC23121.1| KIAA2025 protein [Homo sapiens]            38   0.28
gi|20521980|dbj|BAB21832.2| KIAA1741 protein [Homo sapiens]            38   0.28
gi|20270212|ref|NP_203754.1| tankyrase 1-binding protein of 182 ...    38   0.28
gi|21542263|sp|Q9C0C2|TABP_HUMAN 182 kDa tankyrase 1-binding pro...    38   0.28
gi|37547504|ref|XP_086409.5| KIAA2025 protein [Homo sapiens]           38   0.28
gi|29248141|gb|EAA39683.1| GLP_217_52342_52923 [Giardia lamblia ...    38   0.28
gi|9837125|gb|AAG00432.1| membrane-associated nucleic acid bindi...    37   0.36
gi|9256537|ref|NP_061323.1| membrane associated DNA binding prot...    37   0.36
gi|7510034|pir||T27052 hypothetical protein Y49E10.14 - Caenorha...    37   0.36
gi|38074631|ref|XP_130233.3| membrane-associated nucleic acid bi...    37   0.36
gi|50757133|ref|XP_415394.1| PREDICTED: similar to membrane-asso...    37   0.36
gi|21740156|emb|CAD39091.1| hypothetical protein [Homo sapiens]        37   0.36
gi|17556058|ref|NP_499619.1| germline associated transcriptional...    37   0.36
gi|7494548|pir||S71796 centrosome-binding protein PIE-1, germlin...    37   0.36
gi|50259000|gb|EAL21681.1| hypothetical protein CNBC7160 [Crypto...    37   0.36
gi|50756757|ref|XP_415307.1| PREDICTED: similar to RIKEN cDNA 26...    37   0.47
gi|46123775|ref|XP_386441.1| hypothetical protein FG06265.1 [Gib...    37   0.47
gi|38103684|gb|EAA50357.1| hypothetical protein MG04116.4 [Magna...    37   0.47
gi|18402211|ref|NP_566631.1| zinc finger (CCCH-type) family prot...    37   0.47
gi|27260933|dbj|BAC45051.1| hypothetical protein [Oryza sativa (...    37   0.47
gi|39587059|emb|CAE62994.1| Hypothetical protein CBG07225 [Caeno...    37   0.47
gi|39587060|emb|CAE62995.1| Hypothetical protein CBG07226 [Caeno...    37   0.47
gi|46434225|gb|EAK93641.1| hypothetical protein CaO19.6881 [Cand...    37   0.47
gi|15219751|ref|NP_176853.1| zinc finger (CCCH-type) family prot...    37   0.62
gi|48835635|ref|ZP_00292634.1| hypothetical protein Tfus02001912...    37   0.62
gi|49069950|ref|XP_399264.1| hypothetical protein UM01649.1 [Ust...    37   0.62
gi|20379994|gb|AAH27766.1| Col16a1 protein [Mus musculus]              37   0.62
gi|34877800|ref|XP_344495.1| similar to RIKEN cDNA 1210002E11 [R...    37   0.62
gi|47199556|emb|CAF88681.1| unnamed protein product [Tetraodon n...    37   0.62
gi|39587057|emb|CAE62992.1| Hypothetical protein CBG07223 [Caeno...    37   0.62
gi|34856504|ref|XP_342459.1| similar to tankyrase 1-binding prot...    36   0.81
gi|38565531|gb|AAR24088.1| atherin [Oryctolagus cuniculus]             36   0.81
gi|34534555|dbj|BAC87042.1| unnamed protein product [Homo sapiens]     36   0.81
gi|20521149|dbj|BAA34474.2| KIAA0754 protein [Homo sapiens]            36   0.81
gi|39588206|emb|CAE68131.1| Hypothetical protein CBG13776 [Caeno...    36   0.81
gi|46581379|ref|YP_012187.1| conserved hypothetical protein [Des...    36   0.81
gi|34871687|ref|XP_345585.1| similar to alpha 1 type XVI collage...    36   0.81
gi|30410760|ref|NP_082542.2| procollagen, type XVI, alpha 1; [a]...    36   1.1
gi|50756355|ref|XP_415127.1| PREDICTED: similar to Huntingtin in...    36   1.1
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga...    36   1.1
gi|27881691|gb|AAH44642.1| Unknown (protein for MGC:52176) [Homo...    36   1.1
gi|48832380|ref|ZP_00289416.1| COG0642: Signal transduction hist...    36   1.1
gi|46128285|ref|XP_388696.1| hypothetical protein FG08520.1 [Gib...    36   1.1
gi|46250192|gb|AAH68669.1| MGC81061 protein [Xenopus laevis]           35   1.4
gi|38073535|ref|XP_355250.1| similar to KIAA2025 protein [Mus mu...    35   1.4
gi|15805962|ref|NP_294662.1| hypothetical protein [Deinococcus r...    35   1.4
gi|50511255|dbj|BAD32613.1| mKIAA2025 protein [Mus musculus]           35   1.4
gi|32417630|ref|XP_329293.1| hypothetical protein [Neurospora cr...    35   1.4
gi|39585603|emb|CAE65363.1| Hypothetical protein CBG10308 [Caeno...    35   1.4
gi|50751154|ref|XP_422281.1| PREDICTED: similar to KIAA2025 prot...    35   1.4
gi|38074924|ref|XP_130286.2| similar to mKIAA1741 protein [Mus m...    35   1.4
gi|11602810|dbj|BAB18909.1| avenaII [Gallus gallus]                    35   1.8
gi|45383540|ref|NP_989631.1| enabled homolog [Gallus gallus] >gn...    35   1.8
gi|33863795|ref|NP_895355.1| Translation initiation factor IF-2 ...    35   1.8
gi|50257749|gb|EAL20450.1| hypothetical protein CNBE3710 [Crypto...    35   1.8
gi|34853881|ref|XP_231249.2| similar to CG16807-PA [Rattus norve...    35   1.8
gi|9506863|ref|NP_061976.1| U11/U12 snRNP 20K [Homo sapiens] >gn...    35   2.4
gi|37360596|dbj|BAC98276.1| mKIAA1940 protein [Mus musculus]           35   2.4
gi|47564092|ref|NP_001001160.1| DNA segment, Chr 6, ERATO Doi 53...    35   2.4
gi|39580955|emb|CAE72925.1| Hypothetical protein CBG20245 [Caeno...    35   2.4
gi|15238861|ref|NP_197356.1| zinc finger (CCCH-type) family prot...    35   2.4
gi|50254918|gb|EAL17658.1| hypothetical protein CNBL1730 [Crypto...    35   2.4
gi|34880785|ref|XP_222801.2| similar to KIAA2025 protein [Rattus...    35   2.4
gi|31199395|ref|XP_308645.1| ENSANGP00000011168 [Anopheles gambi...    35   2.4
gi|728997|sp|Q07092|CA1F_HUMAN Collagen alpha 1(XVI) chain precu...    35   2.4
gi|18641352|ref|NP_001847.2| alpha 1 type XVI collagen precursor...    35   2.4
gi|34910262|ref|NP_916478.1| OSJNBa0089K24.18 [Oryza sativa (jap...    35   2.4
gi|38603838|gb|AAR24664.1| At5g18550 [Arabidopsis thaliana]            35   2.4
gi|46389843|dbj|BAD15406.1| KH domain-containing protein-like [O...    34   3.1
gi|45199017|ref|NP_986046.1| AFR499Cp [Eremothecium gossypii] >g...    34   3.1
gi|21224107|ref|NP_629886.1| putative ATP-dependent DNA helicase...    34   3.1
gi|25363260|pir||F86183 hypothetical protein [imported] - Arabid...    34   3.1
gi|18390466|ref|NP_563725.1| zinc finger (CCCH-type) family prot...    34   3.1
gi|46520145|gb|AAR02855.1| CCCH zinc-finger protein [Trypanosoma...    34   3.1
gi|298642|gb|AAB25797.1| type XVI collagen alpha 1 chain; alpha ...    34   3.1
gi|30128|emb|CAA33142.1| collagen-like protein [Homo sapiens] >g...    34   3.1
gi|47211345|emb|CAF93817.1| unnamed protein product [Tetraodon n...    34   4.0
gi|38110489|gb|EAA56198.1| hypothetical protein MG01849.4 [Magna...    34   4.0
gi|30016924|gb|AAP04009.1| unknown [Cloning vector pDXM32]             34   4.0
gi|46806323|dbj|BAD17515.1| putative ZF-HD homeobox protein [Ory...    33   5.2
gi|6634473|emb|CAB64345.1| adenylate cyclase, ACY [Metarhizium a...    33   5.2
gi|12311810|emb|CAC22628.1| hypothetical protein L5683.01 [Leish...    33   5.2
gi|21064719|gb|AAM29589.1| RH35718p [Drosophila melanogaster]          33   5.2
gi|24640344|ref|NP_572387.1| CG1677-PA [Drosophila melanogaster]...    33   5.2
gi|31239741|ref|XP_320284.1| ENSANGP00000016663 [Anopheles gambi...    33   5.2
gi|27379973|ref|NP_771502.1| bll4862 [Bradyrhizobium japonicum U...    33   5.2
gi|32488659|emb|CAE03586.1| OSJNBa0087O24.9 [Oryza sativa (japon...    33   5.2
gi|50256580|gb|EAL19305.1| hypothetical protein CNBH4040 [Crypto...    33   5.2
gi|39581996|emb|CAE64427.1| Hypothetical protein CBG09123 [Caeno...    33   5.2
gi|46114672|ref|XP_383354.1| hypothetical protein FG03178.1 [Gib...    33   5.2
gi|32041832|ref|ZP_00139415.1| COG2909: ATP-dependent transcript...    33   6.8
gi|27377109|ref|NP_768638.1| blr1998 [Bradyrhizobium japonicum U...    33   6.8
gi|25406720|pir||G86143 probable zinc finger protein [imported] ...    33   6.8
gi|22331028|ref|NP_187874.2| floral homeotic protein (HUA1) [Ara...    33   6.8
gi|12620694|gb|AAG60970.1| ID651 [Bradyrhizobium japonicum]            33   6.8
gi|50549337|ref|XP_502139.1| hypothetical protein [Yarrowia lipo...    33   6.8
gi|15223384|ref|NP_171642.1| zinc finger (CCCH-type/C3HC4-type R...    33   6.8
gi|32041830|ref|ZP_00139413.1| COG2909: ATP-dependent transcript...    33   6.8
gi|12321969|gb|AAG51026.1| zinc finger protein, putative, 5' par...    33   6.8
gi|42657831|ref|XP_376571.1| ubiquitin specific protease 42 [Hom...    33   6.8
gi|50726200|dbj|BAD33719.1| CwfJ / zinc finger(CCCH-type)-like p...    33   8.9
gi|22538497|ref|NP_115693.2| Williams Beuren syndrome chromosome...    33   8.9
gi|13477189|gb|AAH05056.1| Williams Beuren syndrome chromosome r...    33   8.9
gi|32406136|ref|XP_323681.1| hypothetical protein [Neurospora cr...    33   8.9
gi|37360214|dbj|BAC98085.1| mKIAA1064 protein [Mus musculus]           33   8.9
gi|15807928|ref|NP_285589.1| hypothetical protein [Deinococcus r...    33   8.9
gi|48763441|ref|ZP_00267996.1| COG2214: DnaJ-class molecular cha...    33   8.9
gi|38234058|ref|NP_939825.1| translation initiation factor IF-2 ...    33   8.9
gi|22001985|sp|Q9WV48|SHK1_RAT SH3 and multiple ankyrin repeat d...    33   8.9
gi|49087258|ref|XP_405585.1| hypothetical protein AN1448.2 [Aspe...    33   8.9
gi|50510623|dbj|BAD32297.1| mKIAA0754 protein [Mus musculus]           33   8.9
gi|13929054|ref|NP_113939.1| Shank1; GKAP/SAPAP interacting prot...    33   8.9
gi|46432590|gb|EAK92065.1| hypothetical protein CaO19.6598 [Cand...    33   8.9
gi|47220482|emb|CAG03262.1| unnamed protein product [Tetraodon n...    33   8.9
gi|50755769|ref|XP_414893.1| PREDICTED: similar to zinc finger C...    33   8.9
gi|38110623|gb|EAA56314.1| hypothetical protein MG06285.4 [Magna...    33   8.9
gi|4850168|gb|AAD04569.2| synaptic SAPAP-interacting protein Syn...    33   8.9
gi|49073790|ref|XP_401078.1| hypothetical protein UM03463.1 [Ust...    33   8.9
gi|47212248|emb|CAF93161.1| unnamed protein product [Tetraodon n...    33   8.9
gi|11994409|dbj|BAB02411.1| zinc finger protein-like [Arabidopsi...    33   8.9
gi|25989124|gb|AAK53454.1| unknown [Streptomyces aureofaciens]         33   8.9


>gi|17538616|ref|NP_501542.1| maturing Oocyte Expressed MOE-1,
           Oocyte MAturation defective OMA-1, C-x8-C-x5-C-x3-H type
           zinc finger containing protein family member (44.5 kD)
           (moe-1) [Caenorhabditis elegans]
 gi|7495781|pir||T19155 hypothetical protein C09G9.6 -
           Caenorhabditis elegans
 gi|3874120|emb|CAA90977.1| Hypothetical protein C09G9.6
           [Caenorhabditis elegans]
 gi|3874527|emb|CAA90986.1| Hypothetical protein C09G9.6
           [Caenorhabditis elegans]
          Length = 407

 Score =  494 bits (1272), Expect = e-139
 Identities = 236/261 (90%), Positives = 236/261 (90%)
 Frame = +2

Query: 2   VEPLQNNKYKTKLCDKYTTTGLCPYGKRCLFIHPDHGPNAYIRADKLLEVSQRHALADIR 181
           VEPLQNNKYKTKLCDKYTTTGLCPYGKRCLFIHPDHGPNAYIRADKLLEVSQRHALADIR
Sbjct: 147 VEPLQNNKYKTKLCDKYTTTGLCPYGKRCLFIHPDHGPNAYIRADKLLEVSQRHALADIR 206

Query: 182 DQMEQHIMTNGRIAAPPLSAIQHPLEMFARPSTPDEPAAKLPLGPTPVSTRGPRYELPTK 361
           DQMEQHIMTNGRIAAPPLSAIQHPLEMFARPSTPDEPAAKLPLGPTPVSTRGPRYELPTK
Sbjct: 207 DQMEQHIMTNGRIAAPPLSAIQHPLEMFARPSTPDEPAAKLPLGPTPVSTRGPRYELPTK 266

Query: 362 ELHDAEGAMTYPPSRWPLDPSMFALDAWNMAHRPASPLDSMVLGSAPNAGSFGMLGKQNT 541
           ELHDAEGAMTYPPSRWPLDPSMFALDAWNMAHRPASPLDSMVLGSAPNAGSFGMLGKQNT
Sbjct: 267 ELHDAEGAMTYPPSRWPLDPSMFALDAWNMAHRPASPLDSMVLGSAPNAGSFGMLGKQNT 326

Query: 542 PGGVSGYSSAGSTPSQDLXXXXXXXXXXXXXXXXXXXXXXXXXLLMKSVATDPMMSCNGP 721
           PGGVSGYSSAGSTPSQDL                         LLMKSVATDPMMSCNGP
Sbjct: 327 PGGVSGYSSAGSTPSQDLSSSSLNAASAAAAAAYFANSAVAQSLLMKSVATDPMMSCNGP 386

Query: 722 FSPMPGFDQLAENMTKHLNLW 784
           FSPMPGFDQLAENMTKHLNLW
Sbjct: 387 FSPMPGFDQLAENMTKHLNLW 407




[DB home][top]