Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C27B7_1
(787 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17538616|ref|NP_501542.1| maturing Oocyte Expressed MOE-1, Oo... 494 e-139
gi|39586403|emb|CAE74060.1| Hypothetical protein CBG21712 [Caeno... 323 2e-87
gi|17566742|ref|NP_505069.1| maturing Oocyte Expressed MOE-2, Oo... 313 2e-84
gi|39597211|emb|CAE59438.1| Hypothetical protein CBG02811 [Caeno... 155 9e-37
gi|17533629|ref|NP_496795.1| maturing Oocyte Expressed MOE-3, C-... 137 3e-31
gi|39777543|gb|AAR31111.1| tristetraprolin [Ovis aries] 60 4e-08
gi|6756059|ref|NP_035886.1| zinc finger protein 36; tristetrapro... 55 2e-06
gi|12836625|dbj|BAB23739.1| unnamed protein product [Mus musculus] 55 2e-06
gi|18959224|ref|NP_579824.1| zinc finger protein 36 [Rattus norv... 54 3e-06
gi|4580020|gb|AAD24207.1| CCCH zinc finger protein C3H-1 [Xenopu... 52 2e-05
gi|27819622|ref|NP_776918.1| zinc finger protein homologous to Z... 51 3e-05
gi|4580022|gb|AAD24208.1| CCCH zinc finger protein C3H-2 [Xenopu... 50 5e-05
gi|4507961|ref|NP_003398.1| zinc finger protein 36, C3H type, ho... 50 5e-05
gi|39590310|emb|CAE66049.1| Hypothetical protein CBG11249 [Caeno... 50 7e-05
gi|39591355|emb|CAE73409.1| Hypothetical protein CBG20851 [Caeno... 49 9e-05
gi|49119467|gb|AAH73564.1| Unknown (protein for IMAGE:5511185) [... 49 1e-04
gi|39586280|emb|CAE66691.1| Hypothetical protein CBG12031 [Caeno... 48 2e-04
gi|17544434|ref|NP_503017.1| butyrate response factor 2 family m... 48 2e-04
gi|17541622|ref|NP_502566.1| C-x8-C-x5-C-x3-H type zinc finger c... 48 2e-04
gi|39579953|emb|CAE56140.1| Hypothetical protein CBG23753 [Caeno... 48 3e-04
gi|7508878|pir||T26124 hypothetical protein W03C9.7 - Caenorhabd... 47 4e-04
gi|17535269|ref|NP_496551.1| embryonic cell fate determinant, co... 47 4e-04
gi|17544440|ref|NP_503020.1| butyrate response factor 2 family m... 47 4e-04
gi|17535271|ref|NP_496043.1| C-x8-C-x5-C-x3-H type zinc finger c... 47 5e-04
gi|7494685|pir||T18624 hypothetical protein AH6.5 - Caenorhabdit... 47 5e-04
gi|34881683|ref|XP_228661.2| similar to butyrate response factor... 47 5e-04
gi|91828|pir||S04743 TPA-induced protein 11 - mouse >gnl|BL_ORD_... 47 6e-04
gi|17543792|ref|NP_502805.1| tis11 family member (22.7 kD) (4P68... 47 6e-04
gi|17544438|ref|NP_503019.1| butyrate response factor 2 (4R982) ... 47 6e-04
gi|111159|pir||B39590 TPA-induced protein 11B - mouse 46 0.001
gi|5869806|emb|CAA76889.2| zinc finger protein [Danio rerio] 46 0.001
gi|5731751|emb|CAA71245.2| CTH1 protein [Cyprinus carpio] 46 0.001
gi|34862023|ref|XP_238444.2| similar to butyrate response factor... 46 0.001
gi|18858483|ref|NP_571014.1| cth1 [Danio rerio] >gnl|BL_ORD_ID|6... 46 0.001
gi|2353340|gb|AAB69448.1| Tis11 family protein [Crassostrea virg... 46 0.001
gi|4580026|gb|AAD24210.1| CCCH zinc finger protein C3H-4 [Xenopu... 45 0.002
gi|17562800|ref|NP_505172.1| cytoplasmic zinc-finger protein ess... 45 0.002
gi|47204423|emb|CAG14799.1| unnamed protein product [Tetraodon n... 45 0.002
gi|15812180|ref|NP_004917.2| butyrate response factor 1; EGF-res... 44 0.003
gi|1480243|emb|CAA67781.1| Berg36 [Homo sapiens] 44 0.003
gi|984509|gb|AAA91778.1| Tis11d 44 0.004
gi|15812178|ref|NP_008818.3| butyrate response factor 2; EGF-res... 44 0.004
gi|13477111|gb|AAH05010.1| ZFP36L2 protein [Homo sapiens] 44 0.004
gi|31615566|pdb|1M9O|A Chain A, Nmr Structure Of The First Zinc ... 44 0.004
gi|20178341|sp|P47974|TISD_HUMAN Butyrate response factor 2 (TIS... 44 0.004
gi|1082358|pir||S49147 ERF-2 protein - human >gnl|BL_ORD_ID|1077... 44 0.004
gi|28278580|gb|AAH44086.1| Zfp36l2-prov protein [Xenopus laevis] 44 0.005
gi|6680808|ref|NP_031590.1| zinc finger protein 36, C3H type-lik... 44 0.005
gi|12017773|gb|AAG45251.1| TIS11D insertion variant [Mus musculus] 44 0.005
gi|8392999|ref|NP_058868.1| zinc finger protein 36, C3H type-lik... 44 0.005
gi|16741639|gb|AAH16621.1| Zfp36l1 protein [Mus musculus] 44 0.005
gi|135865|sp|P23949|TISD_MOUSE Butyrate response factor 2 (TIS11... 44 0.005
gi|48121295|ref|XP_393235.1| similar to Tis11 family protein [Ap... 44 0.005
gi|50748988|ref|XP_426433.1| PREDICTED: similar to Butyrate resp... 44 0.005
gi|46015500|pdb|1RGO|A Chain A, Structural Basis For Recognition... 44 0.005
gi|49249968|ref|NP_031591.2| zinc finger protein 36, C3H type-li... 44 0.005
gi|49249965|ref|NP_001001806.1| zinc finger protein 36, C3H type... 44 0.005
gi|27544283|dbj|BAC54909.1| hypothetical protein [Xenopus laevis] 44 0.005
gi|4580024|gb|AAD24209.1| CCCH zinc finger protein C3H-3 [Xenopu... 44 0.005
gi|12017771|gb|AAG45250.1| TIS11D deletion variant [Mus musculus] 44 0.005
gi|17570419|ref|NP_510397.1| butyrate response factor 2 family m... 43 0.007
gi|1706180|sp|P47976|CTH1_YEAST Zinc finger protein CTH1 >gnl|BL... 42 0.011
gi|6320355|ref|NP_010435.1| Putative transcription factor, membe... 42 0.011
gi|25408379|pir||E84768 hypothetical protein At2g35430 [imported... 42 0.011
gi|17570417|ref|NP_510396.1| C-x8-C-x5-C-x3-H type zinc finger c... 42 0.011
gi|31201609|ref|XP_309752.1| ENSANGP00000012577 [Anopheles gambi... 42 0.015
gi|19075093|ref|NP_586694.1| ZINC FINGER PROTEIN [Encephalitozoo... 42 0.015
gi|17540280|ref|NP_502930.1| butyrate response factor 2 family m... 42 0.015
gi|17540276|ref|NP_502931.1| butyrate response factor 2 family m... 42 0.015
gi|42569638|ref|NP_181086.2| zinc finger (CCCH-type) family prot... 42 0.019
gi|24641593|ref|NP_511141.2| CG4070-PA [Drosophila melanogaster]... 42 0.019
gi|663198|emb|CAA57066.1| TIScc1 [Drosophila melanogaster] >gnl|... 42 0.019
gi|24641595|ref|NP_727633.1| CG4070-PB [Drosophila melanogaster]... 42 0.019
gi|1729972|sp|P47980|TIS1_DROME TIS11 protein (dTIS11) >gnl|BL_O... 42 0.019
gi|41054479|ref|NP_955943.1| Unknown (protein for MGC:77882); wu... 42 0.019
gi|32563991|ref|NP_492238.2| C-x8-C-x5-C-x3-H type zinc finger c... 42 0.019
gi|6323165|ref|NP_013237.1| Zinc finger containing homolog of ma... 41 0.025
gi|46309479|ref|NP_996938.1| Unknown (protein for MGC:76924); wu... 41 0.025
gi|39592050|emb|CAE75270.1| Hypothetical protein CBG23235 [Caeno... 41 0.025
gi|45201139|ref|NP_986709.1| AGR044Cp [Eremothecium gossypii] >g... 41 0.025
gi|17539068|ref|NP_502949.1| butyrate response factor 2 family m... 41 0.025
gi|7500780|pir||T21954 hypothetical protein F38B7.1a - Caenorhab... 41 0.033
gi|32566849|ref|NP_505927.2| C-x8-C-x5-C-x3-H type zinc finger c... 41 0.033
gi|50286627|ref|XP_445742.1| unnamed protein product [Candida gl... 41 0.033
gi|19113245|ref|NP_596453.1| mating pheromone recognition pathwa... 41 0.033
gi|7500781|pir||T21955 hypothetical protein F38B7.1b - Caenorhab... 41 0.033
gi|32566847|ref|NP_505926.2| C-x8-C-x5-C-x3-H type zinc finger c... 41 0.033
gi|50423859|ref|XP_460514.1| unnamed protein product [Debaryomyc... 41 0.033
gi|7506946|pir||T24366 hypothetical protein T02E1.3a - Caenorhab... 41 0.033
gi|47221719|emb|CAG10191.1| unnamed protein product [Tetraodon n... 41 0.033
gi|47900276|gb|AAT39144.1| 'unknown protein, contains zinc finge... 40 0.043
gi|47212350|emb|CAF93268.1| unnamed protein product [Tetraodon n... 40 0.056
gi|17508791|ref|NP_492239.1| C-x8-C-x5-C-x3-H type zinc finger c... 40 0.056
gi|38086346|ref|XP_285657.2| similar to ERF-2 [Mus musculus] 40 0.056
gi|50555936|ref|XP_505376.1| hypothetical protein [Yarrowia lipo... 40 0.056
gi|50307627|ref|XP_453793.1| unnamed protein product [Kluyveromy... 40 0.056
gi|15912259|gb|AAL08263.1| At1g32359/F27G20.10 [Arabidopsis thal... 40 0.056
gi|18398397|ref|NP_564396.1| zinc finger (CCCH-type) family prot... 40 0.056
gi|15824518|gb|AAL09382.1| putative protein hc60.2 [Haemonchus c... 40 0.056
gi|39584070|emb|CAE66476.1| Hypothetical protein CBG11755 [Caeno... 40 0.056
gi|5360265|dbj|BAA81905.1| HrZF-1 [Halocynthia roretzi] 40 0.056
gi|15221301|ref|NP_176987.1| zinc finger (CCCH-type) family prot... 40 0.073
gi|34905220|ref|NP_913957.1| P0672D01.12 [Oryza sativa (japonica... 40 0.073
gi|34911700|ref|NP_917197.1| P0707D10.14 [Oryza sativa (japonica... 40 0.073
gi|15240145|ref|NP_196295.1| KH domain-containing protein / zinc... 39 0.16
gi|21555233|gb|AAM63810.1| unknown [Arabidopsis thaliana] 39 0.16
gi|46438755|gb|EAK98081.1| hypothetical protein CaO19.12794 [Can... 39 0.16
gi|50751512|ref|XP_422434.1| PREDICTED: similar to TOE1 homolog ... 39 0.16
gi|14018368|emb|CAC38358.1| zinc finger protein [Pisum sativum] 38 0.21
gi|47228275|emb|CAG07670.1| unnamed protein product [Tetraodon n... 38 0.21
gi|24899214|dbj|BAC23121.1| KIAA2025 protein [Homo sapiens] 38 0.28
gi|20521980|dbj|BAB21832.2| KIAA1741 protein [Homo sapiens] 38 0.28
gi|20270212|ref|NP_203754.1| tankyrase 1-binding protein of 182 ... 38 0.28
gi|21542263|sp|Q9C0C2|TABP_HUMAN 182 kDa tankyrase 1-binding pro... 38 0.28
gi|37547504|ref|XP_086409.5| KIAA2025 protein [Homo sapiens] 38 0.28
gi|29248141|gb|EAA39683.1| GLP_217_52342_52923 [Giardia lamblia ... 38 0.28
gi|9837125|gb|AAG00432.1| membrane-associated nucleic acid bindi... 37 0.36
gi|9256537|ref|NP_061323.1| membrane associated DNA binding prot... 37 0.36
gi|7510034|pir||T27052 hypothetical protein Y49E10.14 - Caenorha... 37 0.36
gi|38074631|ref|XP_130233.3| membrane-associated nucleic acid bi... 37 0.36
gi|50757133|ref|XP_415394.1| PREDICTED: similar to membrane-asso... 37 0.36
gi|21740156|emb|CAD39091.1| hypothetical protein [Homo sapiens] 37 0.36
gi|17556058|ref|NP_499619.1| germline associated transcriptional... 37 0.36
gi|7494548|pir||S71796 centrosome-binding protein PIE-1, germlin... 37 0.36
gi|50259000|gb|EAL21681.1| hypothetical protein CNBC7160 [Crypto... 37 0.36
gi|50756757|ref|XP_415307.1| PREDICTED: similar to RIKEN cDNA 26... 37 0.47
gi|46123775|ref|XP_386441.1| hypothetical protein FG06265.1 [Gib... 37 0.47
gi|38103684|gb|EAA50357.1| hypothetical protein MG04116.4 [Magna... 37 0.47
gi|18402211|ref|NP_566631.1| zinc finger (CCCH-type) family prot... 37 0.47
gi|27260933|dbj|BAC45051.1| hypothetical protein [Oryza sativa (... 37 0.47
gi|39587059|emb|CAE62994.1| Hypothetical protein CBG07225 [Caeno... 37 0.47
gi|39587060|emb|CAE62995.1| Hypothetical protein CBG07226 [Caeno... 37 0.47
gi|46434225|gb|EAK93641.1| hypothetical protein CaO19.6881 [Cand... 37 0.47
gi|15219751|ref|NP_176853.1| zinc finger (CCCH-type) family prot... 37 0.62
gi|48835635|ref|ZP_00292634.1| hypothetical protein Tfus02001912... 37 0.62
gi|49069950|ref|XP_399264.1| hypothetical protein UM01649.1 [Ust... 37 0.62
gi|20379994|gb|AAH27766.1| Col16a1 protein [Mus musculus] 37 0.62
gi|34877800|ref|XP_344495.1| similar to RIKEN cDNA 1210002E11 [R... 37 0.62
gi|47199556|emb|CAF88681.1| unnamed protein product [Tetraodon n... 37 0.62
gi|39587057|emb|CAE62992.1| Hypothetical protein CBG07223 [Caeno... 37 0.62
gi|34856504|ref|XP_342459.1| similar to tankyrase 1-binding prot... 36 0.81
gi|38565531|gb|AAR24088.1| atherin [Oryctolagus cuniculus] 36 0.81
gi|34534555|dbj|BAC87042.1| unnamed protein product [Homo sapiens] 36 0.81
gi|20521149|dbj|BAA34474.2| KIAA0754 protein [Homo sapiens] 36 0.81
gi|39588206|emb|CAE68131.1| Hypothetical protein CBG13776 [Caeno... 36 0.81
gi|46581379|ref|YP_012187.1| conserved hypothetical protein [Des... 36 0.81
gi|34871687|ref|XP_345585.1| similar to alpha 1 type XVI collage... 36 0.81
gi|30410760|ref|NP_082542.2| procollagen, type XVI, alpha 1; [a]... 36 1.1
gi|50756355|ref|XP_415127.1| PREDICTED: similar to Huntingtin in... 36 1.1
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga... 36 1.1
gi|27881691|gb|AAH44642.1| Unknown (protein for MGC:52176) [Homo... 36 1.1
gi|48832380|ref|ZP_00289416.1| COG0642: Signal transduction hist... 36 1.1
gi|46128285|ref|XP_388696.1| hypothetical protein FG08520.1 [Gib... 36 1.1
gi|46250192|gb|AAH68669.1| MGC81061 protein [Xenopus laevis] 35 1.4
gi|38073535|ref|XP_355250.1| similar to KIAA2025 protein [Mus mu... 35 1.4
gi|15805962|ref|NP_294662.1| hypothetical protein [Deinococcus r... 35 1.4
gi|50511255|dbj|BAD32613.1| mKIAA2025 protein [Mus musculus] 35 1.4
gi|32417630|ref|XP_329293.1| hypothetical protein [Neurospora cr... 35 1.4
gi|39585603|emb|CAE65363.1| Hypothetical protein CBG10308 [Caeno... 35 1.4
gi|50751154|ref|XP_422281.1| PREDICTED: similar to KIAA2025 prot... 35 1.4
gi|38074924|ref|XP_130286.2| similar to mKIAA1741 protein [Mus m... 35 1.4
gi|11602810|dbj|BAB18909.1| avenaII [Gallus gallus] 35 1.8
gi|45383540|ref|NP_989631.1| enabled homolog [Gallus gallus] >gn... 35 1.8
gi|33863795|ref|NP_895355.1| Translation initiation factor IF-2 ... 35 1.8
gi|50257749|gb|EAL20450.1| hypothetical protein CNBE3710 [Crypto... 35 1.8
gi|34853881|ref|XP_231249.2| similar to CG16807-PA [Rattus norve... 35 1.8
gi|9506863|ref|NP_061976.1| U11/U12 snRNP 20K [Homo sapiens] >gn... 35 2.4
gi|37360596|dbj|BAC98276.1| mKIAA1940 protein [Mus musculus] 35 2.4
gi|47564092|ref|NP_001001160.1| DNA segment, Chr 6, ERATO Doi 53... 35 2.4
gi|39580955|emb|CAE72925.1| Hypothetical protein CBG20245 [Caeno... 35 2.4
gi|15238861|ref|NP_197356.1| zinc finger (CCCH-type) family prot... 35 2.4
gi|50254918|gb|EAL17658.1| hypothetical protein CNBL1730 [Crypto... 35 2.4
gi|34880785|ref|XP_222801.2| similar to KIAA2025 protein [Rattus... 35 2.4
gi|31199395|ref|XP_308645.1| ENSANGP00000011168 [Anopheles gambi... 35 2.4
gi|728997|sp|Q07092|CA1F_HUMAN Collagen alpha 1(XVI) chain precu... 35 2.4
gi|18641352|ref|NP_001847.2| alpha 1 type XVI collagen precursor... 35 2.4
gi|34910262|ref|NP_916478.1| OSJNBa0089K24.18 [Oryza sativa (jap... 35 2.4
gi|38603838|gb|AAR24664.1| At5g18550 [Arabidopsis thaliana] 35 2.4
gi|46389843|dbj|BAD15406.1| KH domain-containing protein-like [O... 34 3.1
gi|45199017|ref|NP_986046.1| AFR499Cp [Eremothecium gossypii] >g... 34 3.1
gi|21224107|ref|NP_629886.1| putative ATP-dependent DNA helicase... 34 3.1
gi|25363260|pir||F86183 hypothetical protein [imported] - Arabid... 34 3.1
gi|18390466|ref|NP_563725.1| zinc finger (CCCH-type) family prot... 34 3.1
gi|46520145|gb|AAR02855.1| CCCH zinc-finger protein [Trypanosoma... 34 3.1
gi|298642|gb|AAB25797.1| type XVI collagen alpha 1 chain; alpha ... 34 3.1
gi|30128|emb|CAA33142.1| collagen-like protein [Homo sapiens] >g... 34 3.1
gi|47211345|emb|CAF93817.1| unnamed protein product [Tetraodon n... 34 4.0
gi|38110489|gb|EAA56198.1| hypothetical protein MG01849.4 [Magna... 34 4.0
gi|30016924|gb|AAP04009.1| unknown [Cloning vector pDXM32] 34 4.0
gi|46806323|dbj|BAD17515.1| putative ZF-HD homeobox protein [Ory... 33 5.2
gi|6634473|emb|CAB64345.1| adenylate cyclase, ACY [Metarhizium a... 33 5.2
gi|12311810|emb|CAC22628.1| hypothetical protein L5683.01 [Leish... 33 5.2
gi|21064719|gb|AAM29589.1| RH35718p [Drosophila melanogaster] 33 5.2
gi|24640344|ref|NP_572387.1| CG1677-PA [Drosophila melanogaster]... 33 5.2
gi|31239741|ref|XP_320284.1| ENSANGP00000016663 [Anopheles gambi... 33 5.2
gi|27379973|ref|NP_771502.1| bll4862 [Bradyrhizobium japonicum U... 33 5.2
gi|32488659|emb|CAE03586.1| OSJNBa0087O24.9 [Oryza sativa (japon... 33 5.2
gi|50256580|gb|EAL19305.1| hypothetical protein CNBH4040 [Crypto... 33 5.2
gi|39581996|emb|CAE64427.1| Hypothetical protein CBG09123 [Caeno... 33 5.2
gi|46114672|ref|XP_383354.1| hypothetical protein FG03178.1 [Gib... 33 5.2
gi|32041832|ref|ZP_00139415.1| COG2909: ATP-dependent transcript... 33 6.8
gi|27377109|ref|NP_768638.1| blr1998 [Bradyrhizobium japonicum U... 33 6.8
gi|25406720|pir||G86143 probable zinc finger protein [imported] ... 33 6.8
gi|22331028|ref|NP_187874.2| floral homeotic protein (HUA1) [Ara... 33 6.8
gi|12620694|gb|AAG60970.1| ID651 [Bradyrhizobium japonicum] 33 6.8
gi|50549337|ref|XP_502139.1| hypothetical protein [Yarrowia lipo... 33 6.8
gi|15223384|ref|NP_171642.1| zinc finger (CCCH-type/C3HC4-type R... 33 6.8
gi|32041830|ref|ZP_00139413.1| COG2909: ATP-dependent transcript... 33 6.8
gi|12321969|gb|AAG51026.1| zinc finger protein, putative, 5' par... 33 6.8
gi|42657831|ref|XP_376571.1| ubiquitin specific protease 42 [Hom... 33 6.8
gi|50726200|dbj|BAD33719.1| CwfJ / zinc finger(CCCH-type)-like p... 33 8.9
gi|22538497|ref|NP_115693.2| Williams Beuren syndrome chromosome... 33 8.9
gi|13477189|gb|AAH05056.1| Williams Beuren syndrome chromosome r... 33 8.9
gi|32406136|ref|XP_323681.1| hypothetical protein [Neurospora cr... 33 8.9
gi|37360214|dbj|BAC98085.1| mKIAA1064 protein [Mus musculus] 33 8.9
gi|15807928|ref|NP_285589.1| hypothetical protein [Deinococcus r... 33 8.9
gi|48763441|ref|ZP_00267996.1| COG2214: DnaJ-class molecular cha... 33 8.9
gi|38234058|ref|NP_939825.1| translation initiation factor IF-2 ... 33 8.9
gi|22001985|sp|Q9WV48|SHK1_RAT SH3 and multiple ankyrin repeat d... 33 8.9
gi|49087258|ref|XP_405585.1| hypothetical protein AN1448.2 [Aspe... 33 8.9
gi|50510623|dbj|BAD32297.1| mKIAA0754 protein [Mus musculus] 33 8.9
gi|13929054|ref|NP_113939.1| Shank1; GKAP/SAPAP interacting prot... 33 8.9
gi|46432590|gb|EAK92065.1| hypothetical protein CaO19.6598 [Cand... 33 8.9
gi|47220482|emb|CAG03262.1| unnamed protein product [Tetraodon n... 33 8.9
gi|50755769|ref|XP_414893.1| PREDICTED: similar to zinc finger C... 33 8.9
gi|38110623|gb|EAA56314.1| hypothetical protein MG06285.4 [Magna... 33 8.9
gi|4850168|gb|AAD04569.2| synaptic SAPAP-interacting protein Syn... 33 8.9
gi|49073790|ref|XP_401078.1| hypothetical protein UM03463.1 [Ust... 33 8.9
gi|47212248|emb|CAF93161.1| unnamed protein product [Tetraodon n... 33 8.9
gi|11994409|dbj|BAB02411.1| zinc finger protein-like [Arabidopsi... 33 8.9
gi|25989124|gb|AAK53454.1| unknown [Streptomyces aureofaciens] 33 8.9
>gi|17538616|ref|NP_501542.1| maturing Oocyte Expressed MOE-1,
Oocyte MAturation defective OMA-1, C-x8-C-x5-C-x3-H type
zinc finger containing protein family member (44.5 kD)
(moe-1) [Caenorhabditis elegans]
gi|7495781|pir||T19155 hypothetical protein C09G9.6 -
Caenorhabditis elegans
gi|3874120|emb|CAA90977.1| Hypothetical protein C09G9.6
[Caenorhabditis elegans]
gi|3874527|emb|CAA90986.1| Hypothetical protein C09G9.6
[Caenorhabditis elegans]
Length = 407
Score = 494 bits (1272), Expect = e-139
Identities = 236/261 (90%), Positives = 236/261 (90%)
Frame = +2
Query: 2 VEPLQNNKYKTKLCDKYTTTGLCPYGKRCLFIHPDHGPNAYIRADKLLEVSQRHALADIR 181
VEPLQNNKYKTKLCDKYTTTGLCPYGKRCLFIHPDHGPNAYIRADKLLEVSQRHALADIR
Sbjct: 147 VEPLQNNKYKTKLCDKYTTTGLCPYGKRCLFIHPDHGPNAYIRADKLLEVSQRHALADIR 206
Query: 182 DQMEQHIMTNGRIAAPPLSAIQHPLEMFARPSTPDEPAAKLPLGPTPVSTRGPRYELPTK 361
DQMEQHIMTNGRIAAPPLSAIQHPLEMFARPSTPDEPAAKLPLGPTPVSTRGPRYELPTK
Sbjct: 207 DQMEQHIMTNGRIAAPPLSAIQHPLEMFARPSTPDEPAAKLPLGPTPVSTRGPRYELPTK 266
Query: 362 ELHDAEGAMTYPPSRWPLDPSMFALDAWNMAHRPASPLDSMVLGSAPNAGSFGMLGKQNT 541
ELHDAEGAMTYPPSRWPLDPSMFALDAWNMAHRPASPLDSMVLGSAPNAGSFGMLGKQNT
Sbjct: 267 ELHDAEGAMTYPPSRWPLDPSMFALDAWNMAHRPASPLDSMVLGSAPNAGSFGMLGKQNT 326
Query: 542 PGGVSGYSSAGSTPSQDLXXXXXXXXXXXXXXXXXXXXXXXXXLLMKSVATDPMMSCNGP 721
PGGVSGYSSAGSTPSQDL LLMKSVATDPMMSCNGP
Sbjct: 327 PGGVSGYSSAGSTPSQDLSSSSLNAASAAAAAAYFANSAVAQSLLMKSVATDPMMSCNGP 386
Query: 722 FSPMPGFDQLAENMTKHLNLW 784
FSPMPGFDQLAENMTKHLNLW
Sbjct: 387 FSPMPGFDQLAENMTKHLNLW 407