Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C29H12_1
         (1092 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17533385|ref|NP_495223.1| regulator of G protein (41.4 kD) (2...   609   e-173
gi|32563697|ref|NP_871896.1| regulator of G protein (2G399) [Cae...   529   e-149
gi|7496709|pir||T15700 hypothetical protein C29H12.3 - Caenorhab...   516   e-145
gi|39597021|emb|CAE59248.1| Hypothetical protein CBG02574 [Caeno...   506   e-142
gi|16117777|ref|NP_203131.1| regulator of G-protein signalling 8...    80   1e-13
gi|40789289|ref|NP_080656.2| RIKEN cDNA 6530413N01 [Mus musculus...    80   1e-13
gi|13124465|sp|P57771|RGS8_HUMAN Regulator of G-protein signalin...    80   1e-13
gi|15021837|dbj|BAB62198.1| hypothetical protein [Macaca fascicu...    79   1e-13
gi|9507049|ref|NP_062217.1| regulator of G-protein signaling 8 [...    79   2e-13
gi|26347049|dbj|BAC37173.1| unnamed protein product [Mus musculu...    78   4e-13
gi|10946708|ref|NP_067349.1| regulator of G-protein signaling 20...    78   4e-13
gi|15214235|sp|Q9QZB1|RGSK_MOUSE Regulator of G-protein signalin...    78   4e-13
gi|47215929|emb|CAF96331.1| unnamed protein product [Tetraodon n...    78   4e-13
gi|34866068|ref|XP_342799.1| similar to regulator of G-protein s...    77   5e-13
gi|14133758|gb|AAK54122.1| RGS20 ret splice variant 1 [Homo sapi...    77   7e-13
gi|40225651|gb|AAH15614.2| RGS20 protein [Homo sapiens]                77   7e-13
gi|14133764|gb|AAK54124.1| RGS20 ret splice variant 3 [Homo sapi...    77   7e-13
gi|3523160|gb|AAC62013.1| regulator of G protein signaling [Homo...    77   7e-13
gi|14133767|gb|AAK54125.1| RGS20 ret splice variant 4 [Homo sapi...    77   7e-13
gi|13654235|ref|NP_003693.2| regulator of G-protein signalling 2...    77   7e-13
gi|14133761|gb|AAK54123.1| RGS20 ret splice variant 2 [Homo sapi...    77   7e-13
gi|41281805|ref|NP_733466.1| regulator of G-protein signalling 2...    77   7e-13
gi|3914634|sp|P79348|RGSK_BOVIN Regulator of G-protein signaling...    76   1e-12
gi|45383670|ref|NP_989560.1| regulator of G-protein signalling 1...    74   5e-12
gi|18920370|gb|AAL82190.1| regulator of G-protein signaling prot...    74   8e-12
gi|33417144|gb|AAH56085.1| Rgs19-prov protein [Xenopus laevis]         74   8e-12
gi|7499604|pir||T16130 hypothetical protein F21H12.1 - Caenorhab...    73   1e-11
gi|30584351|gb|AAP36424.1| Homo sapiens regulator of G-protein s...    72   2e-11
gi|47215863|emb|CAG02326.1| unnamed protein product [Tetraodon n...    72   2e-11
gi|5032039|ref|NP_005604.1| regulator of G-protein signaling 4 [...    72   2e-11
gi|45382309|ref|NP_990173.1| RGS protein Gz-GAP [Gallus gallus] ...    72   3e-11
gi|50750956|ref|XP_422203.1| PREDICTED: similar to regulator of ...    72   3e-11
gi|34880515|ref|XP_344151.1| regulator of G-protein signaling 1 ...    72   3e-11
gi|18640750|ref|NP_570138.1| regulator of G-protein signalling 1...    71   4e-11
gi|13096650|pdb|1EZT|A Chain A, High-Resolution Solution Structu...    71   4e-11
gi|7657512|ref|NP_056626.1| regulator of G-protein signaling 1 [...    71   4e-11
gi|50539930|ref|NP_001002431.1| zgc:92650 [Danio rerio] >gnl|BL_...    71   4e-11
gi|2500167|sp|O08899|RGS4_MOUSE Regulator of G-protein signaling...    71   4e-11
gi|31543588|ref|NP_033088.2| regulator of G-protein signaling 4;...    71   4e-11
gi|8394183|ref|NP_058910.1| regulator of G-protein signaling 4 [...    71   4e-11
gi|40548310|ref|NP_954968.1| regulator of G-protein signalling 4...    70   7e-11
gi|13277942|gb|AAH03838.1| Regulator of G-protein signaling 19 [...    70   7e-11
gi|13385944|ref|NP_080722.1| regulator of G-protein signaling 19...    70   7e-11
gi|27461941|gb|AAN78096.1| GAIP/RGS19 short isoform [Mus musculu...    70   7e-11
gi|50750958|ref|XP_422204.1| PREDICTED: similar to Regulator of ...    70   9e-11
gi|47215886|emb|CAG12278.1| unnamed protein product [Tetraodon n...    70   9e-11
gi|11067379|ref|NP_067693.1| G alpha interacting protein; regula...    70   9e-11
gi|45383247|ref|NP_989790.1| regulator of G protein signaling 3 ...    70   1e-10
gi|32263635|gb|AAM94021.1| regulator of G protein signaling 3 RG...    70   1e-10
gi|32263637|gb|AAM94022.1| regulator of G protein signaling 3 [G...    70   1e-10
gi|6573613|pdb|1CMZ|A Chain A, Solution Structure Of Gaip (Galph...    70   1e-10
gi|5031705|ref|NP_005864.1| G protein signalling regulator 19; G...    70   1e-10
gi|32263633|gb|AAM94020.1| regulator of G protein signaling 3 RG...    70   1e-10
gi|32263631|gb|AAM94019.1| regulator of G protein signaling 3 RG...    70   1e-10
gi|50417571|gb|AAH77598.1| Unknown (protein for MGC:84504) [Xeno...    69   1e-10
gi|20147771|gb|AAM12653.1| regulator of G protein signalling 19 ...    69   1e-10
gi|23451869|gb|AAN32893.1| RGS2 [Ovis aries]                           69   1e-10
gi|27461943|gb|AAN78097.1| GAIP/RGS19, short isoform [Mus musculus]    69   1e-10
gi|12738845|ref|NP_075019.1| regulator of G-protein signaling 18...    69   2e-10
gi|40804986|gb|AAR91750.1| regulator of G-protein signaling 1 [E...    69   2e-10
gi|19913390|ref|NP_060260.2| regulator of G-protein signalling 3...    69   2e-10
gi|31543586|ref|NP_033087.2| regulator of G-protein signaling 2 ...    69   2e-10
gi|16755852|gb|AAL28114.1| implantation-related RGS2-like protei...    69   2e-10
gi|20147747|gb|AAM12641.1| regulator of G protein signalling 3 [...    68   3e-10
gi|10864075|ref|NP_066929.1| regulator of G-protein signalling 3...    68   3e-10
gi|33879047|gb|AAH19039.2| RGS3 protein [Homo sapiens]                 68   3e-10
gi|20147775|gb|AAM12655.1| regulator of G protein signalling 3 t...    68   3e-10
gi|48146977|emb|CAG33711.1| RGS19 [Homo sapiens]                       68   3e-10
gi|34535344|dbj|BAC87285.1| unnamed protein product [Homo sapiens]     68   3e-10
gi|19913392|ref|NP_602299.1| regulator of G-protein signalling 3...    68   3e-10
gi|21464134|ref|NP_652759.1| regulator of G-protein signalling 3...    68   3e-10
gi|27503517|gb|AAH42555.1| Regulator of G-protein signalling 3, ...    68   3e-10
gi|18644736|ref|NP_570613.1| regulator of G-protein signalling 3...    68   3e-10
gi|20977056|gb|AAM33255.1| RGS3 isoform PDZ-RGS3 [Homo sapiens]        68   3e-10
gi|17390156|gb|AAH18072.1| RGS3 protein [Homo sapiens]                 68   3e-10
gi|1911237|gb|AAB50617.1| G protein signaling regulator RGS2 [Mu...    68   4e-10
gi|45383370|ref|NP_989726.1| regulator of G-protein signalling 2...    68   4e-10
gi|49115389|gb|AAH73348.1| Unknown (protein for MGC:80762) [Xeno...    68   4e-10
gi|30315156|gb|AAP30802.1| regulator of G-protein signaling prot...    68   4e-10
gi|4506517|ref|NP_002914.1| regulator of G-protein signalling 2,...    67   7e-10
gi|41281665|ref|NP_599018.1| regulator of G-protein signaling 3;...    67   7e-10
gi|7804981|gb|AAF70201.1| RGS4 protein [Xenopus laevis] >gnl|BL_...    67   7e-10
gi|21361447|ref|NP_002913.2| regulator of G-protein signalling 1...    67   7e-10
gi|30585001|gb|AAP36773.1| Homo sapiens regulator of G-protein s...    67   7e-10
gi|21464136|ref|NP_652760.1| regulator of G-protein signalling 3...    67   7e-10
gi|30583977|gb|AAP36237.1| Homo sapiens regulator of G-protein s...    67   7e-10
gi|15214217|sp|Q9DC04|RGS3_MOUSE Regulator of G-protein signalin...    67   7e-10
gi|6979748|gb|AAF34627.1| regulator of G-protein signaling 3 [Mu...    67   7e-10
gi|18644718|ref|NP_062213.1| regulator of G-protein signaling 3 ...    67   7e-10
gi|50418138|gb|AAH78194.1| Unknown (protein for MGC:100933) [Dan...    67   7e-10
gi|20977052|gb|AAM33253.1| RGS3 isoform RGS3S [Homo sapiens]           67   7e-10
gi|6979746|gb|AAF34626.1| regulator of G-protein signaling 3s [M...    67   7e-10
gi|12313896|emb|CAC19805.1| dJ1011O1.2 (regulator of G-protein s...    67   7e-10
gi|16758194|ref|NP_445905.1| regulator of G-protein signaling pr...    67   9e-10
gi|38074133|ref|XP_357155.1| similar to Regulator of G-protein s...    67   9e-10
gi|631051|pir||S43436 B cell activation protein BL34 - human >gn...    67   9e-10
gi|40352853|gb|AAH64782.1| Regulator of G-protein signaling 17 [...    67   9e-10
gi|47217453|emb|CAG10222.1| unnamed protein product [Tetraodon n...    67   9e-10
gi|41053925|ref|NP_956256.1| regulator of G-protein signaling 5;...    66   1e-09
gi|45383390|ref|NP_989716.1| regulator of G-protein signaling 4 ...    66   1e-09
gi|45382307|ref|NP_990172.1| RGS protein RGS-17 [Gallus gallus] ...    66   1e-09
gi|45361437|ref|NP_989295.1| hypothetical protein MGC76188 [Xeno...    66   1e-09
gi|50540116|ref|NP_001002523.1| zgc:92802 [Danio rerio] >gnl|BL_...    66   1e-09
gi|34880519|ref|XP_222692.2| similar to regulator of G-protein s...    66   2e-09
gi|25153588|ref|NP_510124.2| regulator of G protein Signaling RG...    66   2e-09
gi|7499280|pir||T21035 hypothetical protein F16H9.1b - Caenorhab...    66   2e-09
gi|19908832|gb|AAM03005.1| regulator of G protein signaling 6 ga...    65   2e-09
gi|19908837|gb|AAM03010.1| regulator of G protein signaling 6 ga...    65   2e-09
gi|32250984|gb|AAP74386.1| RGS6 protein n isoform [Homo sapiens]       65   2e-09
gi|19908839|gb|AAM03012.1| regulator of G protein signaling 6 ga...    65   2e-09
gi|3309254|gb|AAC26050.1| regulator of G-protein signaling 6 var...    65   2e-09
gi|19908834|gb|AAM03007.1| regulator of G protein signaling 6 al...    65   2e-09
gi|18057198|gb|AAC26049.2| regulator of G-protein signaling 6 [H...    65   2e-09
gi|31742476|ref|NP_004287.3| regulator of G-protein signalling 6...    65   2e-09
gi|19908838|gb|AAM03011.1| regulator of G protein signaling 6 al...    65   2e-09
gi|19908833|gb|AAM03006.1| regulator of G protein signaling 6 be...    65   2e-09
gi|19908840|gb|AAM03013.1| regulator of G protein signaling 6 be...    65   2e-09
gi|19908831|gb|AAM03004.1| regulator of G protein signaling 6 al...    65   2e-09
gi|4972617|gb|AAD34717.1| regulator of G-protein signaling-6 [Ho...    65   2e-09
gi|19908835|gb|AAM03008.1| regulator of G protein signaling 6 ga...    65   2e-09
gi|32250992|gb|AAP74389.1| RGS6 protein epsilon isoform [Homo sa...    65   2e-09
gi|32250989|gb|AAP74388.1| RGS6 protein delta isoform [Homo sapi...    65   2e-09
gi|32250986|gb|AAP74387.1| RGS6 protein y isoform [Homo sapiens]       65   2e-09
gi|26337601|dbj|BAC32486.1| unnamed protein product [Mus musculus]     65   3e-09
gi|26347453|dbj|BAC37375.1| unnamed protein product [Mus musculus]     65   3e-09
gi|9910532|ref|NP_064342.1| regulator of G-protein signaling 17;...    65   4e-09
gi|18203661|sp|Q9Z2H2|RGS6_MOUSE Regulator of G-protein signalin...    64   5e-09
gi|47217743|emb|CAG03695.1| unnamed protein product [Tetraodon n...    64   5e-09
gi|30584103|gb|AAP36300.1| Homo sapiens regulator of G-protein s...    64   5e-09
gi|29789076|ref|NP_056627.1| regulator of G-protein signaling 6 ...    64   5e-09
gi|4506511|ref|NP_002918.1| regulator of G-protein signalling 13...    64   5e-09
gi|47217742|emb|CAG03694.1| unnamed protein product [Tetraodon n...    64   6e-09
gi|4836812|gb|AAD30569.1| G-alpha interacting protein [Gallus ga...    64   8e-09
gi|47218135|emb|CAG10055.1| unnamed protein product [Tetraodon n...    63   1e-08
gi|31199373|ref|XP_308634.1| ENSANGP00000011139 [Anopheles gambi...    63   1e-08
gi|47215298|emb|CAF98107.1| unnamed protein product [Tetraodon n...    63   1e-08
gi|30584301|gb|AAP36399.1| Homo sapiens regulator of G-protein s...    63   1e-08
gi|21361405|ref|NP_036551.3| regulator of G-protein signalling 1...    63   1e-08
gi|34853560|ref|XP_217837.2| similar to regulator of G-protein s...    63   1e-08
gi|20147769|gb|AAM12652.1| regulator of G protein signalling 17 ...    63   1e-08
gi|6706659|emb|CAB65995.1| dJ101K10.2 (regulator of G-protein si...    63   1e-08
gi|20147763|gb|AAM12649.1| regulator of G protein signalling 13 ...    63   1e-08
gi|45383187|ref|NP_989822.1| axin-related protein [Gallus gallus...    62   2e-08
gi|37548779|ref|XP_089307.4| similar to implantation-related RGS...    62   2e-08
gi|41017772|sp|Q8WQC0|RGSC_CAEEL Regulator of G-protein signalin...    62   3e-08
gi|15967124|gb|AAL11463.1| Hypothetical protein F56B6.2c [Caenor...    62   3e-08
gi|39590699|emb|CAE65069.1| Hypothetical protein CBG09919 [Caeno...    62   3e-08
gi|7504377|pir||T31002 hypothetical protein F56B6.2 - Caenorhabd...    62   3e-08
gi|25153215|ref|NP_508610.2| C2-RGS protein family member (88.6 ...    62   3e-08
gi|6653584|gb|AAF22799.1| AXIN2 [Homo sapiens]                         61   4e-08
gi|4757824|ref|NP_004646.1| axin 2 [Homo sapiens] >gnl|BL_ORD_ID...    61   4e-08
gi|39592273|emb|CAE75494.1| Hypothetical protein CBG23499 [Caeno...    61   4e-08
gi|39597753|emb|CAE68445.1| Hypothetical protein CBG14233 [Caeno...    61   4e-08
gi|48095906|ref|XP_394553.1| similar to CG5058-PC [Apis mellifera]     61   5e-08
gi|50801857|ref|XP_424195.1| PREDICTED: similar to hypothetical ...    61   5e-08
gi|17862594|gb|AAL39774.1| LD40005p [Drosophila melanogaster]          60   7e-08
gi|50540392|ref|NP_001002662.1| zgc:91965 [Danio rerio] >gnl|BL_...    60   7e-08
gi|24654630|ref|NP_611271.2| CG5036-PA [Drosophila melanogaster]...    60   7e-08
gi|47230246|emb|CAG10660.1| unnamed protein product [Tetraodon n...    60   7e-08
gi|6093966|sp|P56700|RGSG_RAT Regulator of G-protein signaling 1...    60   7e-08
gi|34452688|ref|NP_899180.1| regulator of G-protein signalling 1...    60   9e-08
gi|4239944|dbj|BAA74751.1| regulator of G-protein signaling 11 [...    60   9e-08
gi|4506507|ref|NP_003825.1| regulator of G-protein signalling 11...    60   9e-08
gi|41152016|ref|NP_958461.1| regulator of G-protein signalling 1...    60   9e-08
gi|50415301|gb|AAH78010.1| Unknown (protein for IMAGE:4963340) [...    60   9e-08
gi|7500042|pir||T21468 hypothetical protein F28C1.2 - Caenorhabd...    60   1e-07
gi|34880501|ref|XP_341135.1| similar to Rgs16 protein [Rattus no...    60   1e-07
gi|17559244|ref|NP_506125.1| EGg Laying defective EGL-10, G prot...    60   1e-07
gi|39587991|emb|CAE57222.1| Hypothetical protein CBG00085 [Caeno...    60   1e-07
gi|23346630|ref|NP_694811.1| regulator of G-protein signaling 13...    60   1e-07
gi|1813546|gb|AAC16913.1| mA28-RGS14p [Mus musculus]                   59   2e-07
gi|28498827|ref|XP_128488.3| regulator of G-protein signaling 11...    59   2e-07
gi|15214250|sp|Q9Z2H1|RGSB_MOUSE Regulator of G-protein signalin...    59   2e-07
gi|50748251|ref|XP_421174.1| PREDICTED: similar to RGS6 protein ...    59   2e-07
gi|33859610|ref|NP_035397.1| regulator of G-protein signaling 16...    59   2e-07
gi|2500171|sp|P97428|RGSG_MOUSE Regulator of G-protein signaling...    59   2e-07
gi|18044305|gb|AAH19741.1| Rgs11 protein [Mus musculus]                59   2e-07
gi|47215930|emb|CAF96332.1| unnamed protein product [Tetraodon n...    59   2e-07
gi|48391468|gb|AAT42371.1| axin [Lytechinus variegatus]                59   3e-07
gi|25316535|pir||G88571 protein C05B5.7 [imported] - Caenorhabdi...    59   3e-07
gi|48096545|ref|XP_392482.1| similar to ENSANGP00000012471 [Apis...    59   3e-07
gi|6653586|gb|AAF22800.1| Axin2 [Mus musculus]                         59   3e-07
gi|630523|pir||S43576 C05B5.7 protein (clone C05B5) - Caenorhabd...    59   3e-07
gi|17551990|ref|NP_499221.1| regulator of G protein Signaling RG...    59   3e-07
gi|34452690|ref|NP_002919.2| regulator of G-protein signalling 1...    59   3e-07
gi|1813544|gb|AAC16912.1| A28-RGS14p [Homo sapiens]                    59   3e-07
gi|6002533|gb|AAF00026.1| Gz-selective GTPase-activating protein...    59   3e-07
gi|47206923|emb|CAF94521.1| unnamed protein product [Tetraodon n...    59   3e-07
gi|34784597|gb|AAH57714.1| MGC68862 protein [Xenopus laevis]           58   3e-07
gi|40254370|ref|NP_056547.3| axin2 [Mus musculus] >gnl|BL_ORD_ID...    58   3e-07
gi|12643651|sp|O88566|AXN2_MOUSE Axin 2 (Axis inhibition protein...    58   3e-07
gi|27806119|ref|NP_776875.1| regulator of G-protein signalling 1...    58   3e-07
gi|13242243|ref|NP_077331.1| axin2; axin 2; axin-like [Rattus no...    58   3e-07
gi|50540132|ref|NP_001002531.1| zgc:92913 [Danio rerio] >gnl|BL_...    58   3e-07
gi|6002550|gb|AAF00034.1| Gz-selective GTPase-activating protein...    58   4e-07
gi|28278811|gb|AAH45281.1| Axin2 protein [Danio rerio]                 57   6e-07
gi|18858325|ref|NP_571636.1| axin 2 (conductin, axil); etID37069...    57   6e-07
gi|47220674|emb|CAG06596.1| unnamed protein product [Tetraodon n...    57   6e-07
gi|50751092|ref|XP_422252.1| PREDICTED: similar to regulator of ...    57   6e-07
gi|50540148|ref|NP_001002541.1| zgc:92793 [Danio rerio] >gnl|BL_...    57   1e-06
gi|47215294|emb|CAF98103.1| unnamed protein product [Tetraodon n...    57   1e-06
gi|39591249|emb|CAE73302.1| Hypothetical protein CBG20725 [Caeno...    56   1e-06
gi|39591246|emb|CAE73299.1| Hypothetical protein CBG20722 [Caeno...    56   2e-06
gi|4581018|gb|AAD24581.1| regulator of G-protein signalling LOCO...    55   2e-06
gi|24649093|ref|NP_732776.1| CG5248-PC [Drosophila melanogaster]...    55   2e-06
gi|7417385|gb|AAF62552.1| regulator of G-protein signalling LOCO...    55   2e-06
gi|45551948|ref|NP_732774.2| CG5248-PA [Drosophila melanogaster]...    55   2e-06
gi|47224372|emb|CAG09218.1| unnamed protein product [Tetraodon n...    55   2e-06
gi|24649087|ref|NP_732773.1| CG5248-PD [Drosophila melanogaster]...    55   2e-06
gi|47215562|emb|CAG06292.1| unnamed protein product [Tetraodon n...    55   2e-06
gi|4581016|gb|AAD24580.1| regulator of G-protein signalling LOCO...    55   2e-06
gi|24649091|ref|NP_732775.1| CG5248-PB [Drosophila melanogaster]...    55   2e-06
gi|10719898|sp|Q9YGY0|AXN_XENLA Axin (Axis inhibition protein) (...    55   2e-06
gi|22261815|sp|P49758|RGS6_HUMAN Regulator of G-protein signalin...    55   3e-06
gi|49256563|gb|AAH72967.1| Unknown (protein for MGC:82511) [Xeno...    55   3e-06
gi|34859371|ref|XP_341937.1| regulator of G-protein signaling 10...    55   4e-06
gi|4506519|ref|NP_003608.1| regulator of G-protein signalling 5;...    55   4e-06
gi|29835264|gb|AAH51133.1| Rgs7 protein [Mus musculus]                 55   4e-06
gi|6755318|ref|NP_036010.1| regulator of G protein signaling 7 [...    55   4e-06
gi|47202224|emb|CAF87401.1| unnamed protein product [Tetraodon n...    55   4e-06
gi|50740761|ref|XP_419551.1| PREDICTED: similar to regulator of ...    55   4e-06
gi|18858323|ref|NP_571578.1| axin 1 [Danio rerio] >gnl|BL_ORD_ID...    55   4e-06
gi|3341727|gb|AAC27488.1| RGS7 [Drosophila melanogaster]               54   5e-06
gi|4959230|gb|AAD34291.1| regulator of G-protein signaling 7b [H...    54   5e-06
gi|20147753|gb|AAM12644.1| regulator of G protein signalling 7 [...    54   5e-06
gi|27806431|ref|NP_776594.1| regulator of G-protein signalling 7...    54   5e-06
gi|4959228|gb|AAD34290.1| regulator of G-protein signaling 7 [Ho...    54   5e-06
gi|20147755|gb|AAM12645.1| regulator of G protein signalling 7 [...    54   5e-06
gi|17647899|ref|NP_523380.1| CG9108-PA [Drosophila melanogaster]...    54   5e-06
gi|1166512|gb|AAC50351.1| RGS7                                         54   5e-06
gi|17380284|sp|P49802|RGS7_HUMAN Regulator of G-protein signalin...    54   5e-06
gi|50612568|gb|AAT79494.1| regulator of G-protein signaling 9L [...    54   6e-06
gi|9957313|gb|AAG09312.1| RGS9 isoform 2 [Homo sapiens]                54   6e-06
gi|13385914|ref|NP_080694.1| regulator of G-protein signalling 1...    54   6e-06
gi|50612566|gb|AAT79493.1| regulator of G-protein signaling 9 [H...    54   6e-06
gi|50757867|ref|XP_415685.1| PREDICTED: similar to regulator of ...    54   6e-06
gi|41152195|ref|NP_957124.1| hypothetical protein MGC73189 [Dani...    54   6e-06
gi|8475983|sp|O75916|RGS9_HUMAN Regulator of G-protein signaling...    54   6e-06
gi|9957312|gb|AAG09311.1| RGS9 isoform 1 [Homo sapiens]                54   6e-06
gi|21361149|ref|NP_002915.2| regulator of G-protein signalling 7...    54   6e-06
gi|37606149|emb|CAE49899.1| SI:zC147H1.2 (novel protein similar ...    54   6e-06
gi|14424689|gb|AAH09361.1| RGS10 protein [Homo sapiens]                54   8e-06
gi|18266777|sp|O43665|RGSA_HUMAN Regulator of G-protein signalin...    54   8e-06
gi|7448001|pir||S71812 RGS10 protein - human                           54   8e-06
gi|7448002|pir||T13580 hypothetical protein 52C10.2 - fruit fly ...    54   8e-06
gi|28628609|gb|AAO49275.1| regulator of G protein signaling RGS9...    54   8e-06
gi|9507047|ref|NP_062216.1| regulator of G-protein signaling 7 [...    54   8e-06
gi|4506505|ref|NP_002916.1| regulator of G-protein signaling 10 ...    54   8e-06
gi|38327599|ref|NP_937870.1| regulator of G-protein signalling 1...    53   1e-05
gi|50414732|gb|AAH77275.1| Unknown (protein for MGC:80046) [Xeno...    53   1e-05
gi|2598196|gb|AAB84007.1| regulator of G protein signaling RGS12...    53   1e-05
gi|2766635|gb|AAB96646.1| regulator of G protein signaling 12 [H...    53   1e-05
gi|4506509|ref|NP_002917.1| regulator of G-protein signalling 12...    53   1e-05
gi|38327605|ref|NP_940832.1| regulator of G-protein signalling 1...    53   1e-05
gi|38327601|ref|NP_937872.1| regulator of G-protein signalling 1...    53   1e-05
gi|38327609|ref|NP_940989.1| regulator of G-protein signalling 1...    53   1e-05
gi|31207151|ref|XP_312542.1| ENSANGP00000001206 [Anopheles gambi...    53   1e-05
gi|27806433|ref|NP_776595.1| regulator of G-protein signalling 9...    53   1e-05
gi|13399565|pdb|1FQJ|B Chain B, Crystal Structure Of The Heterot...    53   1e-05
gi|47227993|emb|CAF97622.1| unnamed protein product [Tetraodon n...    52   2e-05
gi|2739458|gb|AAC99481.1| regulator of G-protein signaling 9 [Mu...    52   2e-05
gi|9507051|ref|NP_062097.1| regulator of G-protein signaling 9 [...    52   2e-05
gi|6755320|ref|NP_035398.1| regulator of G-protein signaling 9; ...    52   2e-05
gi|2707359|gb|AAC01959.1| regulator of G-protein signalling 9; R...    52   2e-05
gi|50747286|ref|XP_420820.1| PREDICTED: similar to regulator of ...    52   2e-05
gi|24643130|ref|NP_573328.1| CG7095-PA [Drosophila melanogaster]...    52   2e-05
gi|31203903|ref|XP_310900.1| ENSANGP00000012471 [Anopheles gambi...    52   2e-05
gi|12856494|dbj|BAB30688.1| unnamed protein product [Mus musculus]     52   2e-05
gi|47218156|emb|CAG10076.1| unnamed protein product [Tetraodon n...    52   2e-05
gi|49523119|gb|AAH75223.1| Unknown (protein for MGC:84381) [Xeno...    52   2e-05
gi|3290014|gb|AAC40154.1| RGS12 PDZ-less variant; Regulator of G...    52   3e-05
gi|20147757|gb|AAM12646.1| regulator of G protein signalling 9 [...    52   3e-05
gi|27777689|ref|NP_775578.1| regulator of G-protein signalling 1...    52   3e-05
gi|12852504|dbj|BAB29434.1| unnamed protein product [Mus musculus]     52   3e-05
gi|28828712|gb|AAO51307.1| similar to Plasmodium falciparum. Hyp...    52   3e-05
gi|9507043|ref|NP_062212.1| regulator of G-protein signalling 12...    52   3e-05
gi|4506521|ref|NP_003826.1| regulator of G-protein signalling 9 ...    52   3e-05
gi|50749865|ref|XP_421790.1| PREDICTED: similar to Regulator of ...    51   5e-05
gi|39591248|emb|CAE73301.1| Hypothetical protein CBG20724 [Caeno...    51   5e-05
gi|47523770|ref|NP_999521.1| regulator of G-protein signalling 5...    50   7e-05
gi|20147759|gb|AAM12647.1| regulator of G protein signalling 9L ...    50   7e-05
gi|47220081|emb|CAG12229.1| unnamed protein product [Tetraodon n...    50   9e-05
gi|31218429|ref|XP_316659.1| ENSANGP00000002611 [Anopheles gambi...    50   9e-05
gi|13399563|pdb|1FQI|A Chain A, Rgs9 Rgs Domain                        50   9e-05
gi|11279345|pir||JC7228 G-protein signaling regulator 5 homolog ...    50   1e-04
gi|13559029|emb|CAC36062.1| bA92K2.1 (regulator of G-protein sig...    50   1e-04
gi|50593341|gb|AAT79417.1| axin-related protein transcript varia...    49   2e-04
gi|49118797|gb|AAH73229.1| Unknown (protein for MGC:80558) [Xeno...    49   2e-04
gi|29336055|ref|NP_033089.2| regulator of G-protein signaling 5 ...    49   2e-04
gi|39591247|emb|CAE73300.1| Hypothetical protein CBG20723 [Caeno...    49   2e-04
gi|45384430|ref|NP_990275.1| AXIN protein; Fused is the classica...    49   2e-04
gi|50593343|gb|AAT79418.1| axin protein 1 transcript variant 1 [...    49   2e-04
gi|1911239|gb|AAB50618.1| G protein signaling regulator RGS5 [Mu...    49   3e-04
gi|9507045|ref|NP_062214.1| regulator of G-protein signaling 5 [...    48   3e-04
gi|17537037|ref|NP_496704.1| regulator of g protein signaling 6 ...    48   3e-04
gi|6652991|gb|AAF22574.1| axin-related protein [Xenopus laevis]        47   6e-04
gi|47212660|emb|CAF89487.1| unnamed protein product [Tetraodon n...    47   6e-04
gi|17567709|ref|NP_510482.1| regulator of G-protein signalling 3...    47   8e-04
gi|47218920|emb|CAF98118.1| unnamed protein product [Tetraodon n...    47   8e-04
gi|47218695|emb|CAG12419.1| unnamed protein product [Tetraodon n...    47   0.001
gi|47220257|emb|CAG03291.1| unnamed protein product [Tetraodon n...    47   0.001
gi|20532379|sp|O35625|AXN1_MOUSE Axin 1 (Axis inhibition protein...    47   0.001
gi|38082111|ref|XP_128515.3| axin [Mus musculus]                       47   0.001
gi|2252816|gb|AAC53285.1| Axin [Mus musculus]                          47   0.001
gi|20532377|sp|O70239|AXN1_RAT Axin 1 protein (Axis inhibition p...    47   0.001
gi|13242326|ref|NP_077381.1| GSK-3beta interacting protein rAxin...    47   0.001
gi|31083144|ref|NP_851393.1| axin 1 isoform b; axis inhibition p...    46   0.002
gi|9256861|pdb|1EMU|A Chain A, Structure Of The Axin Rgs-Homolog...    46   0.002
gi|2252820|gb|AAC51624.1| axin [Homo sapiens]                          46   0.002
gi|9955244|pdb|1DK8|A Chain A, Crystal Structure Of The Rgs-Homo...    46   0.002
gi|27501450|ref|NP_003493.1| axin 1 isoform a; axis inhibition p...    46   0.002
gi|50751024|ref|XP_426615.1| PREDICTED: similar to regulator of ...    45   0.002
gi|38569111|gb|AAR24264.1| RGS12TS [Danio rerio] >gnl|BL_ORD_ID|...    44   0.005
gi|47550843|ref|NP_999889.1| RGS12TS-S [Danio rerio] >gnl|BL_ORD...    44   0.005
gi|38569110|gb|AAR24263.1| RGS12TS [Danio rerio] >gnl|BL_ORD_ID|...    44   0.005
gi|47212548|emb|CAF94997.1| unnamed protein product [Tetraodon n...    44   0.009
gi|47213780|emb|CAF92669.1| unnamed protein product [Tetraodon n...    43   0.011
gi|39595204|emb|CAE60241.1| Hypothetical protein CBG03814 [Caeno...    42   0.019
gi|25145850|ref|NP_740905.1| EATing: abnormal pharyngeal pumping...    42   0.025
gi|25145848|ref|NP_740904.1| EATing: abnormal pharyngeal pumping...    42   0.025
gi|46123701|ref|XP_386404.1| hypothetical protein FG06228.1 [Gib...    42   0.025
gi|50750960|ref|XP_422205.1| PREDICTED: similar to Regulator of ...    42   0.025
gi|32565002|ref|NP_498229.3| regulator of G protein (55.9 kD) (3...    41   0.056
gi|19855059|sp|O43566|RGSE_HUMAN Regulator of G-protein signalin...    39   0.16
gi|21361304|ref|NP_006471.2| regulator of G-protein signalling 1...    39   0.16
gi|19527695|gb|AAL89962.1| AT01932p [Drosophila melanogaster]          39   0.21
gi|24640444|ref|NP_572421.1| CG1514-PA [Drosophila melanogaster]...    39   0.21
gi|16758600|ref|NP_446216.1| regulator of G-protein signaling 14...    39   0.21
gi|31980626|ref|NP_058038.2| regulator of G-protein signaling 14...    39   0.28
gi|3914636|sp|P97492|RGSE_MOUSE Regulator of G-protein signaling...    39   0.28
gi|34935346|ref|XP_345703.1| regulator of G-protein signaling 6 ...    38   0.36
gi|39585631|emb|CAE65391.1| Hypothetical protein CBG10338 [Caeno...    38   0.36
gi|39584897|emb|CAE64321.1| Hypothetical protein CBG08999 [Caeno...    38   0.47
gi|47185934|emb|CAG14842.1| unnamed protein product [Tetraodon n...    38   0.47
gi|4836810|gb|AAD30568.1| regulator of G-protein signalling 4 [G...    38   0.47
gi|50755083|ref|XP_425204.1| PREDICTED: similar to Na+/phosphate...    38   0.47
gi|49097140|ref|XP_410030.1| FLBA_EMENI Developmental regulator ...    37   0.62
gi|31202599|ref|XP_310248.1| ENSANGP00000015182 [Anopheles gambi...    37   0.62
gi|8745527|gb|AAF78951.1| putative regulator of G protein signal...    37   0.62
gi|6002535|gb|AAF00027.1| regulator of G-protein signalling 9 [G...    37   0.81
gi|17567707|ref|NP_510483.1| regulator of G-protein family membe...    37   1.1
gi|38708169|ref|NP_114159.2| sorting nexin 25; MSTP043 protein [...    37   1.1
gi|3024533|sp|P97844|RGS1_RAT Regulator of G-protein signaling 1...    37   1.1
gi|6002544|gb|AAF00031.1| regulator of G-protein signalling 9 [G...    36   1.4
gi|19552458|ref|NP_600460.1| spermidine synthase [Corynebacteriu...    36   1.8
gi|34328657|gb|AAO83655.1| putative protein Roco10 [Dictyosteliu...    35   2.3
gi|13623399|gb|AAH06295.1| Unknown (protein for MGC:10366) [Homo...    35   3.1
gi|6324681|ref|NP_014750.1| Regulator of G-protein Signalling fo...    35   3.1
gi|47223863|emb|CAG06040.1| unnamed protein product [Tetraodon n...    35   3.1
gi|25027888|ref|NP_737942.1| conserved hypothetical protein [Cor...    35   3.1
gi|47217744|emb|CAG03696.1| unnamed protein product [Tetraodon n...    35   4.0
gi|26336150|dbj|BAC31760.1| unnamed protein product [Mus musculus]     35   4.0
gi|2492661|sp|Q12397|STCA_EMENI Putative sterigmatocystin biosyn...    34   5.2
gi|22477784|gb|AAH36665.1| Unknown (protein for IMAGE:5268331) [...    34   5.2
gi|49113564|ref|XP_411962.1| STCA_EMENI Putative sterigmatocysti...    34   5.2
gi|49092596|ref|XP_407759.1| hypothetical protein AN3622.2 [Aspe...    34   6.8
gi|31240177|ref|XP_320502.1| ENSANGP00000008658 [Anopheles gambi...    33   8.9
gi|32475688|ref|NP_868682.1| probable membrane protein [Pirellul...    33   8.9
gi|50746457|ref|XP_420506.1| PREDICTED: similar to sorting nexin...    33   8.9


>gi|17533385|ref|NP_495223.1| regulator of G protein (41.4 kD) (2G399)
            [Caenorhabditis elegans]
 gi|22096404|sp|Q18312|YTN3_CAEEL Hypothetical protein C29H12.3 in
            chromosome II
 gi|15617715|gb|AAL02450.1| Hypothetical protein C29H12.3a
            [Caenorhabditis elegans]
          Length = 363

 Score =  609 bits (1570), Expect = e-173
 Identities = 310/363 (85%), Positives = 310/363 (85%)
 Frame = +1

Query: 1    MWRSYKAETPELADETQEVDLNLHDSSESDHEGRQXXXXXXXXXXXXXXXNDVTLQVXXX 180
            MWRSYKAETPELADETQEVDLNLHDSSESDHEGRQ               NDVTLQV
Sbjct: 1    MWRSYKAETPELADETQEVDLNLHDSSESDHEGRQSRSASITSSTSAPASNDVTLQVPIT 60

Query: 181  XXXXXXXXXXXXXMYFIAGMFDGKEKVNREQPPMPTTDGVEYPRAASWAAGNCANVLNDD 360
                         MYFIAGMFDGKEKVNREQPPMPTTDGVEYPRAASWAAGNCANVLNDD
Sbjct: 61   NSSATSPTPSTGSMYFIAGMFDGKEKVNREQPPMPTTDGVEYPRAASWAAGNCANVLNDD 120

Query: 361  KGKQLFRVFLFQSLAEENLAFLEAMEKLKKMKISDEKVAYAKEILETYQGXXXXXXXXXX 540
            KGKQLFRVFLFQSLAEENLAFLEAMEKLKKMKISDEKVAYAKEILETYQG
Sbjct: 121  KGKQLFRVFLFQSLAEENLAFLEAMEKLKKMKISDEKVAYAKEILETYQGSINLSSSSMK 180

Query: 541  XLRNAVASETLDMEEFAPAIKEVRRLLENDQFPRFRRSXXXXXXXXXXXPRSYAEKWAQS 720
             LRNAVASETLDMEEFAPAIKEVRRLLENDQFPRFRRS           PRSYAEKWAQS
Sbjct: 181  SLRNAVASETLDMEEFAPAIKEVRRLLENDQFPRFRRSELYLEYLEELLPRSYAEKWAQS 240

Query: 721  FEGLLGNHVGRHHFRIFLRSIHAEENLRFWEAVVEFRSSRHKANAMNNLGKVILSTYLAE 900
            FEGLLGNHVGRHHFRIFLRSIHAEENLRFWEAVVEFRSSRHKANAMNNLGKVILSTYLAE
Sbjct: 241  FEGLLGNHVGRHHFRIFLRSIHAEENLRFWEAVVEFRSSRHKANAMNNLGKVILSTYLAE 300

Query: 901  GTTNEVFLPFGVRQVIERRIQDNQIDITLFDEAIKHVEQVLRNDPYVRFLQSSQYIDLLS 1080
            GTTNEVFLPFGVRQVIERRIQDNQIDITLFDEAIKHVEQVLRNDPYVRFLQSSQYIDLLS
Sbjct: 301  GTTNEVFLPFGVRQVIERRIQDNQIDITLFDEAIKHVEQVLRNDPYVRFLQSSQYIDLLS 360

Query: 1081 KLK 1089
            KLK
Sbjct: 361  KLK 363




[DB home][top]