Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C32D5_7
(423 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532245|ref|NP_495275.1| thioredoxin family member (2G632) [... 239 9e-63
gi|39597070|emb|CAE59297.1| Hypothetical protein CBG02632 [Caeno... 204 4e-52
gi|17564492|ref|NP_503954.1| predicted CDS, thioredoxin family m... 198 2e-50
gi|25153934|ref|NP_503440.2| predicted CDS, thioredoxin family m... 159 9e-39
gi|7505193|pir||T33313 hypothetical protein K02H11.6 - Caenorhab... 159 9e-39
gi|17564844|ref|NP_503892.1| predicted CDS, thioredoxin (5D726) ... 135 2e-31
gi|45861991|gb|AAS78778.1| thioredoxin [Ascaris suum] 128 3e-29
gi|23598166|gb|AAN34969.1| thioredoxin 1; ov-thioredoxin 1 [Onch... 127 6e-29
gi|23598164|gb|AAN34968.1| thioredoxin; wb-Thioredoxin [Wucherer... 123 9e-28
gi|21436483|gb|AAM51563.1| thioredoxin [Brugia malayi] >gnl|BL_O... 119 1e-26
gi|19698793|gb|AAL91107.1| thioredoxin [Brugia malayi] 116 1e-25
gi|23598162|gb|AAN34967.1| thioredoxin 2; ov-thioredoxin 2 [Onch... 113 9e-25
gi|39589121|emb|CAE57854.1| Hypothetical protein CBG00891 [Caeno... 105 2e-22
gi|17535459|ref|NP_496200.1| thioredoxin family member (17.3 kD)... 101 3e-21
gi|39595082|emb|CAE60119.1| Hypothetical protein CBG03662 [Caeno... 100 1e-20
gi|17537401|ref|NP_494757.1| thioredoxin family member (2E596) [... 99 2e-20
gi|17506685|ref|NP_493308.1| putative cytoplasmic protein family... 98 3e-20
gi|39587621|emb|CAE58559.1| Hypothetical protein CBG01721 [Caeno... 89 1e-17
gi|47219909|emb|CAF97179.1| unnamed protein product [Tetraodon n... 89 2e-17
gi|32563627|ref|NP_492564.2| putative nuclear protein family mem... 88 3e-17
gi|7507212|pir||T24545 hypothetical protein T05F1.11 - Caenorhab... 88 3e-17
gi|14550374|gb|AAK67231.1| Hypothetical protein F29B9.5 [Caenorh... 87 6e-17
gi|7500138|pir||T29930 hypothetical protein F29B9.5 - Caenorhabd... 86 2e-16
gi|13435627|gb|AAH04688.1| Nxn protein [Mus musculus] 77 6e-14
gi|6679160|ref|NP_032776.1| nucleoredoxin [Mus musculus] >gnl|BL... 77 6e-14
gi|34872883|ref|XP_340858.1| similar to red-1 [Rattus norvegicus] 77 6e-14
gi|33991273|gb|AAH09327.2| NXN protein [Homo sapiens] 77 1e-13
gi|33149331|ref|NP_071908.2| nucleoredoxin; nucleoredoxin 1 [Hom... 77 1e-13
gi|49522545|gb|AAH73845.1| NXN protein [Homo sapiens] 77 1e-13
gi|49256203|gb|AAH71162.1| Unknown (protein for MGC:83491) [Xeno... 75 2e-13
gi|50758318|ref|XP_415863.1| PREDICTED: similar to red-1 [Gallus... 75 4e-13
gi|49256234|gb|AAH74275.1| Unknown (protein for MGC:84045) [Xeno... 71 4e-12
gi|17539056|ref|NP_500478.1| thioredoxin family member (17.0 kD)... 70 1e-11
gi|39580153|emb|CAE56273.1| Hypothetical protein CBG23918 [Caeno... 69 3e-11
gi|32452987|gb|AAB09142.2| Hypothetical protein M01H9.1 [Caenorh... 68 3e-11
gi|38567893|emb|CAE03648.2| OSJNBa0060N03.13 [Oryza sativa (japo... 68 3e-11
gi|17541496|ref|NP_500578.1| thioredoxin family member (4F253) [... 68 3e-11
gi|22165362|ref|NP_083449.1| RIKEN cDNA 4930519N16 [Mus musculus... 67 1e-10
gi|34874056|ref|XP_344575.1| similar to RIKEN cDNA 4930519N16 [R... 66 1e-10
gi|31415911|gb|AAP50932.1| putative trypanothione-dependent pero... 65 4e-10
gi|39587599|emb|CAE58537.1| Hypothetical protein CBG01696 [Caeno... 63 1e-09
gi|21592996|gb|AAM64945.1| PDI-like protein [Arabidopsis thaliana] 63 1e-09
gi|18406743|ref|NP_564756.1| DC1 domain-containing protein [Arab... 63 1e-09
gi|23304737|emb|CAC87937.1| PDI-like protein [Quercus suber] 61 4e-09
gi|41393676|gb|AAS02080.1| protein disulfide isomerase [Quercus ... 61 4e-09
gi|34810146|pdb|1OKD|A Chain A, Nmr-Structure Of Tryparedoxin 1 60 7e-09
gi|8569430|pdb|1EZK|A Chain A, Crystal Structure Of Recombinant ... 60 7e-09
gi|8569420|pdb|1EWX|A Chain A, Crystal Structure Of Native Trypa... 60 7e-09
gi|8569320|pdb|1QK8|A Chain A, Tryparedoxin-I From Crithidia Fas... 60 7e-09
gi|39585201|emb|CAE57444.1| Hypothetical protein CBG00406 [Caeno... 60 1e-08
gi|17538896|ref|NP_503101.1| thioredoxin family member (20.1 kD)... 59 3e-08
gi|34908848|ref|NP_915771.1| PDI-like protein [Oryza sativa (jap... 58 5e-08
gi|29726921|pdb|1OC9|A Chain A, Tryparedoxin Ii From C.Fascicula... 57 6e-08
gi|19923987|ref|NP_612463.1| hypothetical protein BC014127; rod-... 57 6e-08
gi|3676476|gb|AAC61984.1| tryparedoxin II [Crithidia fasciculata] 57 8e-08
gi|27066375|pdb|1O6J|A Chain A, Tryparedoxin Ii From C.Fascicula... 57 8e-08
gi|27574271|pdb|1O81|A Chain A, Tryparedoxin Ii From C.Fascicula... 57 8e-08
gi|14278309|pdb|1FG4|A Chain A, Structure Of Tryparedoxin Ii >gn... 57 8e-08
gi|30749849|pdb|1O8X|A Chain A, Mutant Tryparedoxin-I Cys43ala 57 8e-08
gi|47227790|emb|CAG08953.1| unnamed protein product [Tetraodon n... 57 1e-07
gi|19171158|emb|CAC85916.1| tryparedoxin [Trypanosoma cruzi] 56 1e-07
gi|44889410|gb|AAS48350.1| tryparedoxin [Leishmania infantum] 56 1e-07
gi|48141594|ref|XP_397245.1| similar to red-1 [Apis mellifera] 55 2e-07
gi|44889412|gb|AAS48351.1| mitochondrial tryparedoxin [Leishmani... 55 4e-07
gi|18417767|ref|NP_567869.1| expressed protein [Arabidopsis thal... 54 5e-07
gi|7486675|pir||T04491 hypothetical protein F8F16.60 - Arabidops... 54 5e-07
gi|41018378|sp|O77404|TYPX_TRYBB Tryparedoxin >gnl|BL_ORD_ID|643... 54 7e-07
gi|31415915|gb|AAP50936.1| putative trypanothione-dependent pero... 54 7e-07
gi|4056568|gb|AAD04231.1| PDI-like protein [Zea mays] 54 9e-07
gi|13787131|pdb|1I5G|A Chain A, Tryparedoxin Ii Complexed With G... 53 1e-06
gi|34908844|ref|NP_915769.1| PDI-like protein [Oryza sativa (jap... 53 2e-06
gi|50796126|ref|XP_423839.1| PREDICTED: similar to RIKEN cDNA 49... 52 2e-06
gi|34877784|ref|XP_224718.2| similar to hypothetical protein BC0... 50 8e-06
gi|6175375|gb|AAF04973.1| tryparedoxin [Trypanosoma cruzi] 49 2e-05
gi|21704204|ref|NP_663573.1| thioredoxin-like 6 [Mus musculus] >... 49 3e-05
gi|39794699|gb|AAH63828.1| NXN protein [Homo sapiens] 47 6e-05
gi|23474644|ref|ZP_00129937.1| COG0526: Thiol-disulfide isomeras... 46 2e-04
gi|10434208|dbj|BAB14171.1| unnamed protein product [Homo sapien... 45 3e-04
gi|24374636|ref|NP_718679.1| thioredoxin, putative [Shewanella o... 45 4e-04
gi|16740634|gb|AAH16199.1| 4930519N16Rik protein [Mus musculus] 44 0.001
gi|28626437|gb|AAO44001.1| tryparedoxin [Trypanosoma cruzi] >gnl... 43 0.002
gi|28626435|gb|AAO44000.1| tryparedoxin [Trypanosoma cruzi] 43 0.002
gi|5051813|emb|CAB45042.1| putative [Amycolatopsis orientalis] 42 0.003
gi|41406499|ref|NP_959335.1| hypothetical protein MAP0401 [Mycob... 42 0.003
gi|13358154|ref|NP_078428.1| thioredoxin [Ureaplasma parvum sero... 41 0.005
gi|50794394|ref|XP_423688.1| PREDICTED: similar to RIKEN cDNA A9... 41 0.006
gi|46124497|ref|XP_386802.1| hypothetical protein FG06626.1 [Gib... 40 0.008
gi|15803110|ref|NP_289141.1| putative thioredoxin-like protein [... 40 0.008
gi|46317795|ref|ZP_00218373.1| COG0526: Thiol-disulfide isomeras... 40 0.013
gi|46322800|ref|ZP_00223167.1| COG0526: Thiol-disulfide isomeras... 40 0.013
gi|15828232|ref|NP_302495.1| putative membrane protein [Mycobact... 40 0.013
gi|20092028|ref|NP_618103.1| thioredoxin [Methanosarcina acetivo... 39 0.017
gi|21226538|ref|NP_632460.1| Thioredoxin [Methanosarcina mazei G... 39 0.017
gi|46191650|ref|ZP_00206922.1| COG0526: Thiol-disulfide isomeras... 39 0.023
gi|3915131|sp|Q42443|THIH_ORYSA Thioredoxin H-type (TRX-H) (Phlo... 39 0.023
gi|16765969|ref|NP_461584.1| thioredoxin 2 [Salmonella typhimuri... 39 0.023
gi|34498208|ref|NP_902423.1| probable disulphide-isomerase [Chro... 39 0.030
gi|48838344|ref|ZP_00295289.1| COG0526: Thiol-disulfide isomeras... 39 0.030
gi|16761507|ref|NP_457124.1| thioredoxin 2 [Salmonella enterica ... 39 0.030
gi|15610809|ref|NP_218190.1| hypothetical protein Rv3673c [Mycob... 38 0.039
gi|30249037|ref|NP_841107.1| Thioredoxin [Nitrosomonas europaea ... 38 0.039
gi|46916593|emb|CAG23358.1| hypothetical thioredoxin [Photobacte... 38 0.051
gi|48854964|ref|ZP_00309124.1| COG0526: Thiol-disulfide isomeras... 38 0.051
gi|39996423|ref|NP_952374.1| thioredoxin family protein [Geobact... 37 0.066
gi|45200868|ref|NP_986438.1| AGL229Cp [Eremothecium gossypii] >g... 37 0.066
gi|15805374|ref|NP_294068.1| cytochrome c biogenesis protein, th... 37 0.086
gi|48862305|ref|ZP_00316202.1| COG0526: Thiol-disulfide isomeras... 36 0.15
gi|15679737|ref|NP_276855.1| protein disulphide isomerase [Metha... 36 0.15
gi|28900827|ref|NP_800482.1| thioredoxin 2 [Vibrio parahaemolyti... 36 0.19
gi|18874552|gb|AAL79841.1| thioredoxin [Schistosoma mansoni] 36 0.19
gi|25010250|ref|NP_734645.1| Unknown [Streptococcus agalactiae N... 36 0.19
gi|22536361|ref|NP_687212.1| thioredoxin family protein [Strepto... 36 0.19
gi|21675042|ref|NP_663107.1| thiol:disulfide interchange protein... 35 0.25
gi|46317426|ref|ZP_00218004.1| COG0526: Thiol-disulfide isomeras... 35 0.33
gi|32474228|ref|NP_867222.1| probable thioredoxin related protei... 35 0.33
gi|34540820|ref|NP_905299.1| thioredoxin family protein [Porphyr... 35 0.33
gi|45515513|ref|ZP_00167068.1| COG0526: Thiol-disulfide isomeras... 35 0.33
gi|46364117|ref|ZP_00226762.1| COG0526: Thiol-disulfide isomeras... 35 0.33
gi|21699084|ref|NP_660326.1| chromosome 9 open reading frame 121... 35 0.33
gi|45517156|ref|ZP_00168708.1| COG0526: Thiol-disulfide isomeras... 35 0.33
gi|27367008|ref|NP_762535.1| Thiol-disulfide isomerase [Vibrio v... 35 0.43
gi|48845155|ref|ZP_00299442.1| COG0526: Thiol-disulfide isomeras... 34 0.73
gi|15226875|ref|NP_181046.1| thioredoxin family protein [Arabido... 34 0.73
gi|1169166|sp|P45409|CYCY_RHILV Thiol:disulfide interchange prot... 34 0.73
gi|48769611|ref|ZP_00273956.1| COG0526: Thiol-disulfide isomeras... 34 0.73
gi|23099277|ref|NP_692743.1| cytochrome c biogenesis [Oceanobaci... 33 0.95
gi|33597598|ref|NP_885241.1| thioredoxin 2 [Bordetella parapertu... 33 0.95
gi|48825261|ref|ZP_00286526.1| COG0526: Thiol-disulfide isomeras... 33 0.95
gi|50122438|ref|YP_051605.1| thioredoxin 2 [Erwinia carotovora s... 33 0.95
gi|24215011|ref|NP_712492.1| thioredoxin [Leptospira interrogans... 33 0.95
gi|11135265|sp|Q39362|THH2_BRANA Thioredoxin H-type 2 (TRX-H-2) ... 33 0.95
gi|48862904|ref|ZP_00316799.1| COG3118: Thioredoxin domain-conta... 33 1.2
gi|17507705|ref|NP_492913.1| peptide:N-glycanase (69.1 kD) (1L97... 33 1.6
gi|33592785|ref|NP_880429.1| thioredoxin 2 [Bordetella pertussis... 33 1.6
gi|33602001|ref|NP_889561.1| thioredoxin 2 [Bordetella bronchise... 33 1.6
gi|46916867|emb|CAG23630.1| putative thioredoxin 2 [Photobacteri... 33 1.6
gi|48763968|ref|ZP_00268521.1| COG0526: Thiol-disulfide isomeras... 33 1.6
gi|21674040|ref|NP_662105.1| thioredoxin [Chlorobium tepidum TLS... 33 1.6
gi|42521808|ref|NP_967188.1| thioredoxin [Bdellovibrio bacteriov... 33 1.6
gi|29346397|ref|NP_809900.1| putative cytochrome C-type biogenes... 33 1.6
gi|7488267|pir||T04492 protein kinase homolog F8F16.70 - Arabido... 33 1.6
gi|25395340|pir||E87921 protein F56G4.5 [imported] - Caenorhabdi... 33 1.6
gi|15608815|ref|NP_216193.1| dsbF [Mycobacterium tuberculosis H3... 33 1.6
gi|46576014|gb|AAT01375.1| unknown protein [Oryza sativa (japoni... 33 1.6
gi|18309723|ref|NP_561657.1| probable cytochrome C-type biogenes... 32 2.1
gi|79589|pir||A28215 thioredoxin - Rhodospirillum rubrum 32 2.1
gi|48862425|ref|ZP_00316321.1| COG0526: Thiol-disulfide isomeras... 32 2.1
gi|28379765|ref|NP_786657.1| thioredoxin [Lactobacillus plantaru... 32 2.1
gi|23024157|ref|ZP_00063378.1| COG0526: Thiol-disulfide isomeras... 32 2.1
gi|135777|sp|P10473|THIO_RHORU Thioredoxin (TRX) 32 2.1
gi|33867174|ref|NP_898732.1| putative thioredoxin [Rhodococcus e... 32 2.1
gi|23978434|dbj|BAC21264.1| thioredoxin h [Cucurbita maxima] 32 2.1
gi|46136273|ref|XP_389828.1| hypothetical protein FG09652.1 [Gib... 32 2.1
gi|27763685|gb|AAO20260.1| thioredoxin x [Chlamydomonas reinhard... 32 2.1
gi|14346023|gb|AAK60004.1| oxygenase-like protein [Streptomyces ... 32 2.1
gi|48835262|ref|ZP_00292263.1| COG0526: Thiol-disulfide isomeras... 32 2.1
gi|34556527|ref|NP_906342.1| PUTATIVE LIPOPROTEIN THIREDOXIN [Wo... 32 2.1
gi|19114496|ref|NP_593584.1| putative protein disulfide isomeras... 32 2.8
gi|26991891|ref|NP_747316.1| thioredoxin [Pseudomonas putida KT2... 32 2.8
gi|48869615|ref|ZP_00322366.1| COG0526: Thiol-disulfide isomeras... 32 2.8
gi|49079980|gb|AAT49956.1| PA5240 [synthetic construct] 32 2.8
gi|549079|sp|Q05739|THIO_STRCL Thioredoxin (TRX) >gnl|BL_ORD_ID|... 32 2.8
gi|26453152|dbj|BAC43652.1| putative thioredoxin [Arabidopsis th... 32 2.8
gi|50251453|dbj|BAD28518.1| putative tetratricoredoxin [Oryza sa... 32 2.8
gi|15600433|ref|NP_253927.1| thioredoxin [Pseudomonas aeruginosa... 32 2.8
gi|1705704|sp|P52236|CCMG_PARDE Thiol:disulfide interchange prot... 32 2.8
gi|1388084|gb|AAC49356.1| thioredoxin h 32 2.8
gi|15219537|ref|NP_175128.1| thioredoxin H-type 5 (TRX-H-5) (TOU... 32 2.8
gi|9755396|gb|AAF98203.1| F17F8.6 [Arabidopsis thaliana] 32 3.6
gi|29251147|gb|EAA42631.1| GLP_487_80448_80047 [Giardia lamblia ... 32 3.6
gi|21399393|ref|NP_655378.1| AhpC-TSA, AhpC/TSA family [Bacillus... 32 3.6
gi|30019621|ref|NP_831252.1| ResA protein [Bacillus cereus ATCC ... 32 3.6
gi|17547006|ref|NP_520408.1| PUTATIVE THIOL:DISULFIDE INTERCHANG... 32 3.6
gi|18397764|ref|NP_564371.1| thioredoxin o (TRXO2) [Arabidopsis ... 32 3.6
gi|46441186|gb|EAL00485.1| hypothetical protein CaO19.7611 [Cand... 32 3.6
gi|15615815|ref|NP_244119.1| thioredoxin H1 [Bacillus halodurans... 32 3.6
gi|48731068|ref|ZP_00264814.1| COG0526: Thiol-disulfide isomeras... 32 3.6
gi|1799987|dbj|BAA16469.1| THIOREDOXIN 1 (TRX-1) (THIOREDOXIN M)... 32 3.6
gi|21223797|ref|NP_629576.1| thioredoxin [Streptomyces coelicolo... 32 3.6
gi|50258889|gb|EAL21570.1| hypothetical protein CNBC6080 [Crypto... 32 3.6
gi|34499734|ref|NP_903949.1| thioredoxin-related transmembrane p... 32 3.6
gi|17548784|ref|NP_522124.1| PUTATIVE THIOL:DISULFIDE INTERCHANG... 32 3.6
gi|30575686|gb|AAP33009.1| thioredoxin H [Citrus x paradisi] 31 4.7
gi|42522861|ref|NP_968241.1| putative disulphide-isomerase [Bdel... 31 4.7
gi|1729942|sp|P80579|THIO_ALIAC Thioredoxin (TRX) >gnl|BL_ORD_ID... 31 4.7
gi|47215755|emb|CAG05766.1| unnamed protein product [Tetraodon n... 31 4.7
gi|46315493|ref|ZP_00216075.1| COG0526: Thiol-disulfide isomeras... 31 4.7
gi|48853637|ref|ZP_00307805.1| COG0526: Thiol-disulfide isomeras... 31 4.7
gi|34810800|pdb|1NW2|A Chain A, The Crystal Structure Of The Mut... 31 4.7
gi|48767644|ref|ZP_00271998.1| COG0526: Thiol-disulfide isomeras... 31 4.7
gi|31213043|ref|XP_315465.1| ENSANGP00000014263 [Anopheles gambi... 31 6.2
gi|15239136|ref|NP_199112.1| thioredoxin H-type 3 (TRX-H-3) (GIF... 31 6.2
gi|33595920|ref|NP_883563.1| putative thiol:disulfide interchang... 31 6.2
gi|33601302|ref|NP_888862.1| putative thiol:disulfide interchang... 31 6.2
gi|48833320|ref|ZP_00290341.1| COG3118: Thioredoxin domain-conta... 31 6.2
gi|27375582|ref|NP_767111.1| thiol:disulfide interchange protein... 31 6.2
gi|22219063|pdb|1KNG|A Chain A, Crystal Structure Of Ccmg Reduci... 31 6.2
gi|22994227|ref|ZP_00038739.1| COG0526: Thiol-disulfide isomeras... 31 6.2
gi|1388082|gb|AAC49355.1| thioredoxin h 31 6.2
gi|29829350|ref|NP_823984.1| putative thioredoxin [Streptomyces ... 31 6.2
gi|95143|pir||D39741 cytochrome c biogenesis protein CycX - Brad... 31 6.2
gi|15891342|ref|NP_357014.1| AGR_L_2458p [Agrobacterium tumefaci... 31 6.2
gi|2117426|pir||S58119 thioredoxin (clone GREN) - Arabidopsis th... 31 6.2
gi|15223645|ref|NP_173403.1| thioredoxin H-type 4 (TRX-H-4) (GRE... 31 6.2
gi|21617968|gb|AAM67018.1| thioredoxin [Arabidopsis thaliana] 31 6.2
gi|39594096|emb|CAE70206.1| Hypothetical protein CBG16681 [Caeno... 30 8.1
gi|13473659|ref|NP_105227.1| cytochrome c biogenesis protein Cyc... 30 8.1
gi|1086147|pir||S49353 protein S2 - Phalaris coerulescens 30 8.1
gi|24637231|gb|AAN63619.1| thioredoxin h-like protein [Nicotiana... 30 8.1
gi|16079372|ref|NP_390196.1| essential protein similar to cytoch... 30 8.1
gi|24461531|gb|AAN62102.1| putative thiol:disulfide interchange ... 30 8.1
gi|6321022|ref|NP_011101.1| Hydroperoxide and superoxide-radical... 30 8.1
gi|24637227|gb|AAN63617.1| thioredoxin h-like protein [Zea mays] 30 8.1
gi|29346866|ref|NP_810369.1| thioredoxin (TRX) [Bacteroides thet... 30 8.1
gi|39583758|emb|CAE63862.1| Hypothetical protein CBG08424 [Caeno... 30 8.1
gi|48835113|ref|ZP_00292115.1| COG0526: Thiol-disulfide isomeras... 30 8.1
gi|48850168|ref|ZP_00304410.1| COG3118: Thioredoxin domain-conta... 30 8.1
gi|29830849|ref|NP_825483.1| putative thioredoxin [Streptomyces ... 30 8.1
gi|28198930|ref|NP_779244.1| disulphide isomerase [Xylella fasti... 30 8.1
gi|22996532|ref|ZP_00040785.1| COG0526: Thiol-disulfide isomeras... 30 8.1
gi|15838432|ref|NP_299120.1| disulphide isomerase [Xylella fasti... 30 8.1
gi|49259146|pdb|1ST9|A Chain A, Crystal Structure Of A Soluble D... 30 8.1
gi|48895622|ref|ZP_00328606.1| COG0526: Thiol-disulfide isomeras... 30 8.1
gi|19703445|ref|NP_603007.1| Thioredoxin [Fusobacterium nucleatu... 30 8.1
gi|11362711|pir||T50862 thioredoxin-like protein [imported] - Ph... 30 8.1
gi|46359877|gb|AAS88809.1| putative thioredoxin h [Oryza sativa ... 30 8.1
gi|24637229|gb|AAN63618.1| thioredoxin h-like protein [Oryza sat... 30 8.1
gi|29840599|ref|NP_829705.1| conserved hypothetical protein [Chl... 30 8.1
gi|1085952|pir||S49352 protein S1 - Phalaris coerulescens 30 8.1
gi|34395959|sp|P35160|RESA_BACSU Thiol-disulfide oxidoreductase ... 30 8.1
>gi|17532245|ref|NP_495275.1| thioredoxin family member (2G632)
[Caenorhabditis elegans]
gi|7496839|pir||T15738 hypothetical protein C32D5.8 -
Caenorhabditis elegans
gi|746471|gb|AAC46796.1| Hypothetical protein C32D5.8
[Caenorhabditis elegans]
Length = 140
Score = 239 bits (610), Expect = 9e-63
Identities = 118/140 (84%), Positives = 118/140 (84%)
Frame = -1
Query: 423 MSLLAGVKLEKRDKTLVDATEALAGKAVGFYFSAHWCPPCRGFTPILKXXXXXXXXXXXX 244
MSLLAGVKLEKRDKTLVDATEALAGKAVGFYFSAHWCPPCRGFTPILK
Sbjct: 1 MSLLAGVKLEKRDKTLVDATEALAGKAVGFYFSAHWCPPCRGFTPILKDFYEEVEDEFEV 60
Query: 243 XXXXXXXXXXDLKMYMSEHGDWYHIPYGNDAIKELSTKYGVSGIPALIIVKPDGTEVTKD 64
DLKMYMSEHGDWYHIPYGNDAIKELSTKYGVSGIPALIIVKPDGTEVTKD
Sbjct: 61 VFVSFDRSESDLKMYMSEHGDWYHIPYGNDAIKELSTKYGVSGIPALIIVKPDGTEVTKD 120
Query: 63 GRNDVQNGKDPKATVAKWKA 4
GRNDVQNGKDPKATVAKWKA
Sbjct: 121 GRNDVQNGKDPKATVAKWKA 140