Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C32D5_9
(372 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535125|ref|NP_495277.1| LC3, GABARAP and GATE-16 related, G... 254 3e-67
gi|39597071|emb|CAE59298.1| Hypothetical protein CBG02633 [Caeno... 249 1e-65
gi|47420092|gb|AAT27387.1| gabarap protein [Branchiostoma belche... 208 2e-53
gi|24641085|ref|NP_727447.1| CG32672-PA [Drosophila melanogaster... 207 3e-53
gi|31206551|ref|XP_312238.1| ENSANGP00000023684 [Anopheles gambi... 205 2e-52
gi|20664105|pdb|1KJT|A Chain A, Crystal Structure Of The Gaba(A)... 204 3e-52
gi|18655903|pdb|1KOT|A Chain A, Solution Structure Of Human Gaba... 204 3e-52
gi|46250271|gb|AAH68621.1| MGC78908 protein [Xenopus laevis] 204 3e-52
gi|6005764|ref|NP_009209.1| GABA(A) receptor-associated protein;... 204 3e-52
gi|12833187|dbj|BAB22426.1| unnamed protein product [Mus musculus] 203 6e-52
gi|31206553|ref|XP_312239.1| ENSANGP00000010857 [Anopheles gambi... 202 1e-51
gi|47214049|emb|CAG00707.1| unnamed protein product [Tetraodon n... 201 2e-51
gi|46393742|gb|AAS91376.1| GABA(A) receptor associated protein [... 201 2e-51
gi|37779024|gb|AAP20172.1| gaba receptor protein [Pagrus major] 201 2e-51
gi|41351254|gb|AAH65894.1| Gabarap protein [Danio rerio] 201 2e-51
gi|34784077|gb|AAH56701.1| Gabarap protein [Danio rerio] 201 2e-51
gi|10121677|gb|AAG13318.1| GABA(A) receptor associated protein [... 197 3e-50
gi|10181206|ref|NP_065615.1| gamma-aminobutyric acid (GABA(A)) r... 195 2e-49
gi|19354096|gb|AAH24706.1| Gamma-aminobutyric acid (GABA(A)) rec... 193 6e-49
gi|21402924|gb|AAL39171.2| AT01047p [Drosophila melanogaster] 187 4e-47
gi|21358545|ref|NP_650649.1| CG12334-PA [Drosophila melanogaster... 187 4e-47
gi|44887967|sp|Q8HYB6|GRL1_BOVIN Gamma-aminobutyric acid recepto... 183 6e-46
gi|44887972|sp|Q9BY60|GRL3_HUMAN Gamma-aminobutyric acid recepto... 182 1e-45
gi|25989543|gb|AAM77033.1| polyprotein [Bovine viral diarrhea vi... 182 2e-45
gi|38048671|gb|AAR10238.1| similar to Drosophila melanogaster CG... 159 2e-38
gi|28629735|gb|AAO45172.1| hypothetical GABA(A) receptor-associa... 156 8e-38
gi|50729477|ref|XP_416528.1| PREDICTED: similar to Kell protein,... 152 2e-36
gi|47208882|emb|CAF98184.1| unnamed protein product [Tetraodon n... 151 3e-36
gi|50540486|ref|NP_001002707.1| zgc:92606 [Danio rerio] >gnl|BL_... 150 6e-36
gi|49078968|ref|XP_403182.1| hypothetical protein UM05567.1 [Ust... 148 2e-35
gi|3024687|sp|P87068|SYRP_LACBI SYMBIOSIS-RELATED PROTEIN 147 4e-35
gi|2072023|gb|AAB53650.1| symbiosis-related protein [Laccaria bi... 147 4e-35
gi|25989541|gb|AAM77034.1| polyprotein [Bovine viral diarrhea vi... 147 6e-35
gi|15724332|gb|AAL06559.1| At2g45170/T14P1.2 [Arabidopsis thalia... 145 2e-34
gi|24022346|gb|AAN41258.1| IDI-7 [Podospora anserina] 145 2e-34
gi|6005768|ref|NP_009216.1| GABA(A) receptor-associated protein-... 144 3e-34
gi|12832696|dbj|BAB22217.1| unnamed protein product [Mus musculus] 144 3e-34
gi|21592920|gb|AAM64870.1| putative microtubule-associated prote... 144 3e-34
gi|23394382|gb|AAN31480.1| microtubial binding protein [Phytopht... 144 4e-34
gi|47221926|emb|CAF98938.1| unnamed protein product [Tetraodon n... 144 5e-34
gi|15225418|ref|NP_182042.1| autophagy 8e (APG8e) [Arabidopsis t... 143 7e-34
gi|4689140|gb|AAD27779.1| ganglioside expression factor 2 homolo... 143 7e-34
gi|15224577|ref|NP_178631.1| autophagy 8d (APG8d) [Arabidopsis t... 143 7e-34
gi|46138451|ref|XP_390916.1| hypothetical protein FG10740.1 [Gib... 143 9e-34
gi|32415009|ref|XP_327984.1| hypothetical protein ( probable aut... 143 9e-34
gi|45387851|ref|NP_991286.1| GABA(A) receptor-associated protein... 142 1e-33
gi|49095614|ref|XP_409268.1| hypothetical protein AN5131.2 [Aspe... 142 2e-33
gi|19113323|ref|NP_596531.1| putative autophagy protein [Schizos... 140 5e-33
gi|38102583|gb|EAA49404.1| hypothetical protein MG01062.4 [Magna... 140 5e-33
gi|50260350|gb|EAL23009.1| hypothetical protein CNBA7760 [Crypto... 140 8e-33
gi|50285085|ref|XP_444971.1| unnamed protein product [Candida gl... 139 1e-32
gi|21615419|emb|CAD33929.1| microtubule associated protein [Cice... 139 1e-32
gi|50551987|ref|XP_503468.1| hypothetical protein [Yarrowia lipo... 139 2e-32
gi|18414683|ref|NP_567504.1| autophagy 8f (APG8f) [Arabidopsis t... 139 2e-32
gi|15232387|ref|NP_191623.1| autophagy 8g (APG8g) [Arabidopsis t... 138 2e-32
gi|34882911|ref|XP_346226.1| similar to GABA(A) receptor-associa... 138 3e-32
gi|38344173|emb|CAE03504.2| OSJNBa0053K19.12 [Oryza sativa (japo... 137 7e-32
gi|32401365|gb|AAP80854.1| autophagy [Triticum aestivum] 136 9e-32
gi|40253647|dbj|BAD05590.1| putative microtubial binding protein... 136 9e-32
gi|34595981|gb|AAQ76706.1| microtubule-associated protein 1 ligh... 135 2e-31
gi|6319393|ref|NP_009475.1| Forms a protein complex with Aut2p t... 135 3e-31
gi|15233593|ref|NP_192371.1| autophagy 8b (APG8b) [Arabidopsis t... 134 3e-31
gi|18415813|ref|NP_567642.1| autophagy 8a (APG8a) [Arabidopsis t... 134 3e-31
gi|21553487|gb|AAM62580.1| symbiosis-related like protein [Arabi... 134 4e-31
gi|50309737|ref|XP_454881.1| unnamed protein product [Kluyveromy... 133 7e-31
gi|50508631|dbj|BAD31027.1| putative microtubule associated prot... 133 7e-31
gi|37776903|emb|CAD23144.1| putative microtubule-associated prot... 132 2e-30
gi|21585557|gb|AAL25848.1| Paz2 [Pichia pastoris] 132 2e-30
gi|15220686|ref|NP_176395.1| autophagy 8c (APG8c) [Arabidopsis t... 129 1e-29
gi|11279074|pir||T49105 symbiosis-related like protein - Arabido... 127 7e-29
gi|38089129|ref|XP_146182.2| similar to gamma-aminobutyric acid ... 125 3e-28
gi|45190997|ref|NP_985251.1| AER396Wp [Eremothecium gossypii] >g... 125 3e-28
gi|29841411|gb|AAP06443.1| similar to GABA(A receptor-associated... 123 8e-28
gi|28395469|gb|AAO39078.1| autophagy protein 8 [Dictyostelium di... 123 1e-27
gi|7446944|pir||T02148 hypothetical protein F8K4.23 - Arabidopsi... 121 4e-27
gi|50420213|ref|XP_458639.1| unnamed protein product [Debaryomyc... 121 4e-27
gi|34879720|ref|XP_222596.2| similar to GABA(A) receptor-associa... 117 4e-26
gi|34852003|ref|XP_226586.2| similar to GABA(A) receptor-associa... 117 4e-26
gi|18397569|ref|NP_566283.1| autophagy 8h (APG8h) [Arabidopsis t... 116 1e-25
gi|6437547|gb|AAF08574.1| hypothetical protein [Arabidopsis thal... 113 1e-24
gi|18400815|ref|NP_566518.1| autophagy 8i (APG8i) [Arabidopsis t... 111 4e-24
gi|47208552|emb|CAF90119.1| unnamed protein product [Tetraodon n... 109 1e-23
gi|23480688|gb|EAA17180.1| autophagy 8i [Plasmodium yoelii yoelii] 106 1e-22
gi|7446943|pir||B71432 hypothetical protein - Arabidopsis thalia... 105 2e-22
gi|34868516|ref|XP_345535.1| similar to GABA(A) receptor-associa... 105 2e-22
gi|23507997|ref|NP_700667.1| hypothetical protein, conserved [Pl... 100 7e-21
gi|41053535|ref|NP_956592.1| hypothetical protein MGC56565 [Dani... 95 3e-19
gi|47210040|emb|CAF92881.1| unnamed protein product [Tetraodon n... 94 5e-19
gi|38089524|ref|XP_357910.1| similar to GABA(A) receptor-associa... 94 6e-19
gi|38073562|ref|XP_136306.3| similar to GABA(A) receptor-associa... 94 6e-19
gi|13625773|gb|AAK35152.1| MAP1 light chain 3-like protein 2 [Ho... 89 2e-17
gi|48102349|ref|XP_395337.1| similar to Map1lc3a-prov protein [A... 89 2e-17
gi|50740752|ref|XP_419549.1| PREDICTED: similar to MAP1 light ch... 87 6e-17
gi|47225247|emb|CAG09747.1| unnamed protein product [Tetraodon n... 85 4e-16
gi|50758585|ref|XP_417327.1| PREDICTED: similar to Zgc:77094 [Ga... 81 4e-15
gi|47209952|emb|CAF89960.1| unnamed protein product [Tetraodon n... 81 6e-15
gi|47550759|ref|NP_999904.1| zgc:77094 [Danio rerio] >gnl|BL_ORD... 80 7e-15
gi|27694816|gb|AAH43946.1| Map1lc3a-prov protein [Xenopus laevis] 79 2e-14
gi|33416682|gb|AAH56047.1| MGC69006 protein [Xenopus laevis] 78 4e-14
gi|14210522|ref|NP_115903.1| microtubule-associated protein 1 li... 78 4e-14
gi|10944273|emb|CAC14079.1| bA346K17.1.2 (Novel protein similar ... 78 4e-14
gi|45709237|gb|AAH67797.1| Microtubule-associated proteins 1A/1B... 78 4e-14
gi|12833586|dbj|BAB22582.1| unnamed protein product [Mus musculus] 78 5e-14
gi|17541478|ref|NP_502035.1| LC3, GABARAP and GATE-16 related (l... 77 6e-14
gi|3024150|sp|Q62625|MPL3_RAT Microtubule-associated proteins 1A... 77 1e-13
gi|2465192|gb|AAB72082.1| polyprotein [pestivirus type 1] 77 1e-13
gi|41054555|ref|NP_955898.1| microtubule-associated protein 1 li... 77 1e-13
gi|50513823|pdb|1UGM|A Chain A, Crystal Structure Of Lc3 77 1e-13
gi|41054912|ref|NP_074058.2| microtubule-associated proteins 1A/... 77 1e-13
gi|13385664|ref|NP_080436.1| microtubule-associated protein 1 li... 77 1e-13
gi|39593670|emb|CAE61962.1| Hypothetical protein CBG05962 [Caeno... 77 1e-13
gi|12833728|dbj|BAB22641.1| unnamed protein product [Mus musculus] 76 1e-13
gi|44887919|sp|Q9GJW7|GBAP_BOVIN Gamma-aminobutyric acid recepto... 76 2e-13
gi|12383056|ref|NP_073729.1| microtubule-associated proteins 1A/... 76 2e-13
gi|34879226|ref|XP_344544.1| similar to microtubule-associated p... 75 4e-13
gi|47564106|ref|NP_001001169.1| light chain 3 [Bos taurus] >gnl|... 75 4e-13
gi|3914059|sp|O41515|MPL3_BOVIN Microtubule-associated proteins ... 74 7e-13
gi|45361539|ref|NP_989346.1| hypothetical protein MGC76283 [Xeno... 73 1e-12
gi|20883841|ref|XP_134668.1| similar to microtubule-associated p... 72 2e-12
gi|31563518|ref|NP_852610.1| microtubule-associated protein 1 li... 72 2e-12
gi|37994672|gb|AAH60359.1| MGC68744 protein [Xenopus laevis] 72 3e-12
gi|41149003|ref|XP_373277.1| similar to microtubule-associated p... 63 2e-09
gi|32264635|gb|AAP78764.1| zbs559 [Rattus norvegicus] 57 7e-08
gi|49388314|dbj|BAD25426.1| hypothetical protein [Oryza sativa (... 54 7e-07
gi|41201796|ref|XP_372470.1| similar to microtubule-associated p... 53 2e-06
gi|50753968|ref|XP_425132.1| PREDICTED: similar to MGC68744 prot... 39 0.024
gi|47180830|emb|CAG14694.1| unnamed protein product [Tetraodon n... 39 0.032
gi|47208319|emb|CAF91560.1| unnamed protein product [Tetraodon n... 38 0.054
gi|50785765|ref|XP_427682.1| PREDICTED: similar to MGC68744 prot... 37 0.12
gi|28395477|gb|AAO39080.1| autophagy protein 12 [Dictyostelium d... 36 0.16
gi|42522522|ref|NP_967902.1| hypothetical protein predicted by G... 32 2.3
gi|39933823|ref|NP_946099.1| possible deca-heme c-type cytochrom... 32 2.3
gi|28830016|gb|AAO52506.1| similar to vacuolar Protein Sorting; ... 32 3.9
gi|42662671|ref|XP_293354.5| similar to H326 [Homo sapiens] 32 3.9
gi|50758655|ref|XP_417356.1| PREDICTED: similar to ribophorin II... 32 3.9
gi|28211329|ref|NP_782273.1| putative fliH protein [Clostridium ... 31 5.1
gi|49074064|ref|XP_401192.1| hypothetical protein UM03577.1 [Ust... 31 5.1
gi|50747320|ref|XP_420835.1| PREDICTED: similar to hypothetical ... 31 5.1
gi|50256896|gb|EAL19614.1| hypothetical protein CNBG2420 [Crypto... 31 5.1
gi|49077518|ref|XP_402609.1| hypothetical protein UM04994.1 [Ust... 31 6.7
gi|50728364|ref|XP_416108.1| PREDICTED: similar to oxysterol-bin... 31 6.7
gi|2494725|sp|Q28235|PRLR_CEREL Prolactin receptor precursor (PR... 31 6.7
gi|9230797|gb|AAF82176.1| ComQ [Bacillus mojavensis] 31 6.7
gi|46226913|gb|EAK87879.1| cyclin B like [Cryptosporidium parvum] 31 6.7
gi|18307873|gb|AAL67730.1| pre-ComX modifying enzyme [Bacillus m... 31 6.7
gi|38639000|gb|AAR25674.1| class I helical cytokine receptor num... 30 8.7
gi|27806459|ref|NP_776580.1| prolactin receptor [Bos taurus] >gn... 30 8.7
gi|2494724|sp|Q28172|PRLR_BOVIN Prolactin receptor precursor (PR... 30 8.7
gi|23478159|gb|EAA15321.1| similar ATP-dependent RNA Helicase [P... 30 8.7
gi|45916852|ref|ZP_00195890.2| COG2249: Putative NADPH-quinone r... 30 8.7
gi|45201376|ref|NP_986946.1| AGR280Cp [Eremothecium gossypii] >g... 28 9.1
>gi|17535125|ref|NP_495277.1| LC3, GABARAP and GATE-16 related, GABA
A receptor-associated protein homolog (14.8 kD) (lgg-1)
[Caenorhabditis elegans]
gi|3025287|sp|Q09490|YQD9_CAEEL Hypothetical protein C32D5.9 in
chromosome II
gi|7496840|pir||T15740 hypothetical protein C32D5.9 -
Caenorhabditis elegans
gi|746472|gb|AAC46797.1| Lc3, gabarap and gate-16 family protein 1
[Caenorhabditis elegans]
gi|12232102|gb|AAG49393.1| GABA A receptor-associated protein
[Caenorhabditis elegans]
Length = 123
Score = 254 bits (649), Expect = 3e-67
Identities = 123/123 (100%), Positives = 123/123 (100%)
Frame = -1
Query: 372 MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQF 193
MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQF
Sbjct: 1 MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQF 60
Query: 192 YFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGEVE 13
YFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGEVE
Sbjct: 61 YFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGEVE 120
Query: 12 KKE 4
KKE
Sbjct: 121 KKE 123