Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C33A12_12
         (186 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17538946|ref|NP_501685.1| serpentine Receptor, class U (6.9 k...   133   9e-31
gi|39588414|emb|CAE72765.1| Hypothetical protein CBG20015 [Caeno...   114   4e-25
gi|29566595|ref|NP_818160.1| gp87 [Mycobacteriophage Bxz1] >gnl|...    35   0.44
gi|20091632|ref|NP_617707.1| hypothetical protein (multi-domain)...    33   1.3
gi|38707846|ref|NP_944915.1| unknown [Bacteriophage Felix 01] >g...    33   1.3
gi|34858065|ref|XP_342299.1| similar to acidic (leucine-rich) nu...    33   1.7
gi|23484569|gb|EAA19860.1| Drosophila melanogaster LD33051p [Pla...    33   2.2
gi|46048807|ref|NP_990365.1| L-type voltage-gated calcium channe...    32   2.9
gi|32422105|ref|XP_331496.1| hypothetical protein [Neurospora cr...    32   2.9
gi|50754265|ref|XP_429273.1| PREDICTED: hypothetical protein XP_...    32   2.9
gi|50732389|ref|XP_418612.1| PREDICTED: LIM and SH3 protein [Gal...    32   3.8
gi|49474482|ref|YP_032524.1| Probable transporter [Bartonella qu...    32   3.8
gi|23480050|gb|EAA16715.1| hypothetical protein [Plasmodium yoel...    32   3.8
gi|47211958|emb|CAF90094.1| unnamed protein product [Tetraodon n...    32   4.9
gi|30421352|gb|AAP31289.1| Hsc-70-interacting protein-like prote...    32   4.9
gi|50795515|ref|XP_423783.1| PREDICTED: similar to acidic (leuci...    32   4.9
gi|47208848|emb|CAF92940.1| unnamed protein product [Tetraodon n...    31   6.4
gi|15235529|ref|NP_193030.1| expressed protein [Arabidopsis thal...    31   6.4
gi|50259504|gb|EAL22177.1| hypothetical protein CNBC3150 [Crypto...    31   8.4
gi|32473144|ref|NP_866138.1| hypothetical protein-transmembrane ...    31   8.4
gi|49084950|ref|XP_404634.1| hypothetical protein AN0497.2 [Aspe...    31   8.4


>gi|17538946|ref|NP_501685.1| serpentine Receptor, class U (6.9 kD)
           (sru-1) [Caenorhabditis elegans]
 gi|7496887|pir||T19658 hypothetical protein C33A12.4 -
           Caenorhabditis elegans
 gi|3874665|emb|CAA92788.1| Hypothetical protein C33A12.4
           [Caenorhabditis elegans]
          Length = 61

 Score =  133 bits (335), Expect = 9e-31
 Identities = 61/61 (100%), Positives = 61/61 (100%)
 Frame = -1

Query: 186 MSDQEDKEVPDVEVDYSKYDEDSVPIPEKDIEESHPGRPDLDYDETPVGPAPTECTEEKN 7
           MSDQEDKEVPDVEVDYSKYDEDSVPIPEKDIEESHPGRPDLDYDETPVGPAPTECTEEKN
Sbjct: 1   MSDQEDKEVPDVEVDYSKYDEDSVPIPEKDIEESHPGRPDLDYDETPVGPAPTECTEEKN 60

Query: 6   D 4
           D
Sbjct: 61  D 61




[DB home][top]