Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C33A12_12
(186 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17538946|ref|NP_501685.1| serpentine Receptor, class U (6.9 k... 133 9e-31
gi|39588414|emb|CAE72765.1| Hypothetical protein CBG20015 [Caeno... 114 4e-25
gi|29566595|ref|NP_818160.1| gp87 [Mycobacteriophage Bxz1] >gnl|... 35 0.44
gi|20091632|ref|NP_617707.1| hypothetical protein (multi-domain)... 33 1.3
gi|38707846|ref|NP_944915.1| unknown [Bacteriophage Felix 01] >g... 33 1.3
gi|34858065|ref|XP_342299.1| similar to acidic (leucine-rich) nu... 33 1.7
gi|23484569|gb|EAA19860.1| Drosophila melanogaster LD33051p [Pla... 33 2.2
gi|46048807|ref|NP_990365.1| L-type voltage-gated calcium channe... 32 2.9
gi|32422105|ref|XP_331496.1| hypothetical protein [Neurospora cr... 32 2.9
gi|50754265|ref|XP_429273.1| PREDICTED: hypothetical protein XP_... 32 2.9
gi|50732389|ref|XP_418612.1| PREDICTED: LIM and SH3 protein [Gal... 32 3.8
gi|49474482|ref|YP_032524.1| Probable transporter [Bartonella qu... 32 3.8
gi|23480050|gb|EAA16715.1| hypothetical protein [Plasmodium yoel... 32 3.8
gi|47211958|emb|CAF90094.1| unnamed protein product [Tetraodon n... 32 4.9
gi|30421352|gb|AAP31289.1| Hsc-70-interacting protein-like prote... 32 4.9
gi|50795515|ref|XP_423783.1| PREDICTED: similar to acidic (leuci... 32 4.9
gi|47208848|emb|CAF92940.1| unnamed protein product [Tetraodon n... 31 6.4
gi|15235529|ref|NP_193030.1| expressed protein [Arabidopsis thal... 31 6.4
gi|50259504|gb|EAL22177.1| hypothetical protein CNBC3150 [Crypto... 31 8.4
gi|32473144|ref|NP_866138.1| hypothetical protein-transmembrane ... 31 8.4
gi|49084950|ref|XP_404634.1| hypothetical protein AN0497.2 [Aspe... 31 8.4
>gi|17538946|ref|NP_501685.1| serpentine Receptor, class U (6.9 kD)
(sru-1) [Caenorhabditis elegans]
gi|7496887|pir||T19658 hypothetical protein C33A12.4 -
Caenorhabditis elegans
gi|3874665|emb|CAA92788.1| Hypothetical protein C33A12.4
[Caenorhabditis elegans]
Length = 61
Score = 133 bits (335), Expect = 9e-31
Identities = 61/61 (100%), Positives = 61/61 (100%)
Frame = -1
Query: 186 MSDQEDKEVPDVEVDYSKYDEDSVPIPEKDIEESHPGRPDLDYDETPVGPAPTECTEEKN 7
MSDQEDKEVPDVEVDYSKYDEDSVPIPEKDIEESHPGRPDLDYDETPVGPAPTECTEEKN
Sbjct: 1 MSDQEDKEVPDVEVDYSKYDEDSVPIPEKDIEESHPGRPDLDYDETPVGPAPTECTEEKN 60
Query: 6 D 4
D
Sbjct: 61 D 61