Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C34B2_8
(408 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17505823|ref|NP_492800.1| putative protein, with a coiled coi... 264 3e-70
gi|39595841|emb|CAE67344.1| Hypothetical protein CBG12807 [Caeno... 112 2e-24
gi|127774|sp|P08799|MYS2_DICDI Myosin II heavy chain, non muscle... 45 4e-04
gi|6323283|ref|NP_013355.1| Hypothetical ORF; Ylr254cp [Saccharo... 42 0.003
gi|50733070|ref|XP_426013.1| PREDICTED: similar to FYVE and coil... 42 0.004
gi|15606308|ref|NP_213687.1| hypothetical protein aq_1006 [Aquif... 41 0.006
gi|24850117|ref|NP_733763.1| misshapen/NIK-related kinase isofor... 40 0.010
gi|7710058|ref|NP_057922.1| mitogen-activated protein kinase kin... 40 0.010
gi|28882060|ref|NP_795712.1| mitogen-activated protein kinase ki... 40 0.010
gi|29428007|sp|Q9JM52|M4K6_MOUSE Mitogen-activated protein kinas... 40 0.010
gi|30851421|gb|AAH52474.1| Map4k6-pending protein [Mus musculus] 40 0.010
gi|7657335|ref|NP_056531.1| misshapen/NIK-related kinase isoform... 40 0.010
gi|15030181|gb|AAH11346.1| Map4k6-pending protein [Mus musculus] 40 0.010
gi|29427834|sp|Q8N4C8|M4K6_HUMAN Mitogen-activated protein kinas... 40 0.010
gi|27436917|ref|NP_722549.2| misshapen/NIK-related kinase isofor... 40 0.010
gi|42557661|emb|CAF28780.1| FYVE and coiled-coil [Gallus gallus] 40 0.014
gi|47210347|emb|CAF90604.1| unnamed protein product [Tetraodon n... 40 0.014
gi|17531531|ref|NP_496434.1| putative protein, with 3 coiled coi... 40 0.014
gi|47224891|emb|CAG06461.1| unnamed protein product [Tetraodon n... 40 0.014
gi|46229277|gb|EAK90126.1| hypothetical protein cgd6_1440 [Crypt... 39 0.030
gi|28436851|gb|AAH46638.1| Myo18a protein [Mus musculus] 39 0.030
gi|37046947|gb|AAH57920.1| Myo18a protein [Mus musculus] 39 0.030
gi|32398729|emb|CAD98689.1| interaptin, possible [Cryptosporidiu... 39 0.030
gi|23508469|ref|NP_701138.1| hypothetical protein [Plasmodium fa... 39 0.030
gi|22094119|ref|NP_035716.1| myosin XVIIIa; myosin XVIIIb; myosi... 39 0.030
gi|34495237|gb|AAQ73468.1| erythrocyte binding protein 2 [Plasmo... 38 0.040
gi|45190269|ref|NP_984523.1| AEL337Cp [Eremothecium gossypii] >g... 38 0.040
gi|28571203|ref|NP_788908.1| CG33206-PB [Drosophila melanogaster... 38 0.040
gi|47212864|emb|CAF93221.1| unnamed protein product [Tetraodon n... 38 0.040
gi|47227314|emb|CAF96863.1| unnamed protein product [Tetraodon n... 38 0.040
gi|34495238|gb|AAQ73469.1| erythrocyte binding protein 3 [Plasmo... 38 0.040
gi|28571201|ref|NP_788907.1| CG33206-PA [Drosophila melanogaster... 38 0.040
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa... 38 0.040
gi|30172544|ref|NP_032043.2| structural maintenance of chromosom... 38 0.052
gi|50728494|ref|XP_416146.1| PREDICTED: similar to RIKEN cDNA 49... 38 0.052
gi|17558914|ref|NP_506120.1| predicted CDS, filamentous hemagglu... 38 0.052
gi|50758242|ref|XP_415827.1| PREDICTED: similar to myosin 18A is... 37 0.067
gi|34868391|ref|XP_342838.1| similar to SMC2 protein [Rattus nor... 37 0.088
gi|46110767|ref|XP_382441.1| hypothetical protein FG02265.1 [Gib... 37 0.088
gi|23482863|gb|EAA18721.1| glutamine-asparagine rich protein [Pl... 37 0.088
gi|3252880|gb|AAC24207.1| myosin heavy chain isoform A [Loligo p... 37 0.12
gi|38108884|gb|EAA54831.1| hypothetical protein MG05622.4 [Magna... 37 0.12
gi|21166153|gb|AAM43770.1| similar to Mus musculus (Mouse). DEAD... 37 0.12
gi|34856348|ref|XP_242562.2| similar to KIAA1940 protein [Rattus... 37 0.12
gi|34853775|ref|XP_217796.2| similar to acetyl CoA transferase-l... 37 0.12
gi|48095516|ref|XP_392311.1| similar to Short stop/Kakapo long i... 37 0.12
gi|17231480|ref|NP_488028.1| hypothetical protein [Nostoc sp. PC... 37 0.12
gi|47564092|ref|NP_001001160.1| DNA segment, Chr 6, ERATO Doi 53... 36 0.15
gi|37360596|dbj|BAC98276.1| mKIAA1940 protein [Mus musculus] 36 0.15
gi|14029769|gb|AAK52822.1| calmodulin-binding coil-coil protein ... 36 0.15
gi|42656366|ref|XP_377742.1| KIAA1940 protein [Homo sapiens] 36 0.15
gi|47117627|sp|Q9ER69|WTAP_MOUSE Wilms' tumor 1-associating prot... 36 0.15
gi|47216948|emb|CAG04890.1| unnamed protein product [Tetraodon n... 36 0.15
gi|11322455|emb|CAC16790.1| WTAP protein [Mus musculus] 36 0.15
gi|49091476|ref|XP_407199.1| hypothetical protein AN3062.2 [Aspe... 36 0.15
gi|48101374|ref|XP_395113.1| similar to CG18076-PH [Apis mellifera] 36 0.15
gi|4502443|ref|NP_001714.1| bullous pemphigoid antigen 1 isoform... 36 0.15
gi|38084561|ref|XP_355792.1| similar to mKIAA1940 protein [Mus m... 36 0.15
gi|2134838|pir||I39467 bullous pemphigoid antigen - human (fragm... 36 0.15
gi|18978304|ref|NP_579661.1| hypothetical protein PF1932 [Pyroco... 36 0.15
gi|47211795|emb|CAF93709.1| unnamed protein product [Tetraodon n... 36 0.15
gi|179519|gb|AAA35606.1| bullous pemphigoid antigen 36 0.15
gi|47223235|emb|CAF98619.1| unnamed protein product [Tetraodon n... 36 0.15
gi|47211793|emb|CAF93707.1| unnamed protein product [Tetraodon n... 36 0.15
gi|47211792|emb|CAF93706.1| unnamed protein product [Tetraodon n... 36 0.15
gi|48103366|ref|XP_395558.1| similar to CG15792-PA [Apis mellifera] 36 0.15
gi|18916721|dbj|BAB85526.1| KIAA1940 protein [Homo sapiens] 36 0.15
gi|27923959|sp|Q03001|BPA1_HUMAN Bullous pemphigoid antigen 1 is... 36 0.15
gi|36095|emb|CAA41528.1| hemidesmosomal plaque protein [Homo sap... 36 0.15
gi|24660442|gb|AAH39612.1| MYO18A protein [Homo sapiens] 36 0.20
gi|27529702|dbj|BAA13206.2| KIAA0216 [Homo sapiens] 36 0.20
gi|34881078|ref|XP_341166.1| similar to mena protein [Rattus nor... 36 0.20
gi|28416946|ref|NP_510880.2| myosin 18A isoform a; myosin 18A; m... 36 0.20
gi|50364834|ref|YP_053259.1| glutamine ABC transporter [Mesoplas... 36 0.20
gi|50758577|ref|XP_417323.1| PREDICTED: similar to centrosomal p... 36 0.20
gi|50556618|ref|XP_505717.1| hypothetical protein [Yarrowia lipo... 36 0.20
gi|42794779|ref|NP_976063.1| myosin 18A isoform b; myosin 18A; m... 36 0.20
gi|50728478|ref|XP_416138.1| PREDICTED: similar to Early endosom... 35 0.26
gi|50423813|ref|XP_460491.1| unnamed protein product [Debaryomyc... 35 0.26
gi|28316402|dbj|BAC56936.1| structural maintenance of chromosome... 35 0.26
gi|31205573|ref|XP_311738.1| ENSANGP00000000794 [Anopheles gambi... 35 0.26
gi|47210072|emb|CAF90125.1| unnamed protein product [Tetraodon n... 35 0.26
gi|21227896|ref|NP_633818.1| hypothetical protein MM1794 [Methan... 35 0.26
gi|48106337|ref|XP_396089.1| similar to CG5020-PB [Apis mellifera] 35 0.26
gi|12857151|dbj|BAB30909.1| unnamed protein product [Mus musculus] 35 0.33
gi|19075066|ref|NP_586667.1| hypothetical protein [Encephalitozo... 35 0.33
gi|23478448|gb|EAA15533.1| hypothetical protein [Plasmodium yoel... 35 0.33
gi|29251132|gb|EAA42616.1| GLP_487_61862_64360 [Giardia lamblia ... 35 0.33
gi|11384448|pir||S02771 myosin heavy chain A [similarity] - Caen... 35 0.33
gi|32566139|ref|NP_506065.2| MYOsin heavy chain structural gene,... 35 0.33
gi|7020037|dbj|BAA90971.1| unnamed protein product [Homo sapiens] 35 0.33
gi|15606061|ref|NP_213438.1| chromosome assembly protein homolog... 35 0.33
gi|42784018|ref|NP_981265.1| S-layer homology domain protein [Ba... 35 0.33
gi|45184755|ref|NP_982473.1| AAL069Cp [Eremothecium gossypii] >g... 35 0.33
gi|29244976|gb|EAA36646.1| GLP_400_7455_4195 [Giardia lamblia AT... 35 0.33
gi|41327691|ref|NP_078980.3| chromosome 20 open reading frame 23... 35 0.33
gi|27549391|gb|AAO17292.1| kinesin motor protein [Homo sapiens] 35 0.33
gi|11360016|pir||T42701 hypothetical protein DKFZp434G156.1 - hu... 35 0.33
gi|50259073|gb|EAL21750.1| hypothetical protein CNBC4520 [Crypto... 35 0.33
gi|47847434|dbj|BAD21389.1| mFLJ00150 protein [Mus musculus] 35 0.33
gi|13397859|emb|CAC34619.1| dJ971B4.1.1 (KIAA1590 (novel protein... 35 0.33
gi|38075615|ref|XP_130428.2| RIKEN cDNA 2310043D08 [Mus musculus] 35 0.33
gi|13397860|emb|CAC34620.1| dJ971B4.1.2 (KIAA1590 (novel protein... 35 0.33
gi|37675395|gb|AAQ97206.1| chimeric kinesin [synthetic construct] 35 0.33
gi|16078056|ref|NP_388873.1| yhaN [Bacillus subtilis subsp. subt... 35 0.33
gi|4204232|gb|AAD10625.1| MADS-box protein 1 [Lolium temulentum] 35 0.33
gi|14017803|dbj|BAB47422.1| KIAA1793 protein [Homo sapiens] 35 0.33
gi|50761005|ref|XP_425891.1| PREDICTED: similar to KIAA1981 prot... 35 0.33
gi|27529917|dbj|BAB13416.2| KIAA1590 protein [Homo sapiens] 35 0.33
gi|32171244|ref|NP_073579.2| hypothetical protein DKFZp434G156 [... 35 0.33
gi|34860830|ref|XP_221882.2| similar to Interferon-induced guany... 35 0.33
gi|40849886|gb|AAR95655.1| plectin 1 [Rattus norvegicus] 35 0.44
gi|40849896|gb|AAR95660.1| plectin 6 [Rattus norvegicus] 35 0.44
gi|552001|gb|AAA99987.1| [Streptococcus pyogenes DNA sequence, o... 35 0.44
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628... 35 0.44
gi|48139568|ref|XP_393467.1| similar to C330027C09Rik protein [A... 35 0.44
gi|40849888|gb|AAR95656.1| plectin 2 [Rattus norvegicus] 35 0.44
gi|125415|sp|P21613|KINH_LOLPE KINESIN HEAVY CHAIN >gnl|BL_ORD_I... 35 0.44
gi|49903646|gb|AAH76739.1| Unknown (protein for MGC:81432) [Xeno... 35 0.44
gi|40849904|gb|AAR95664.1| plectin 10 [Rattus norvegicus] 35 0.44
gi|40849890|gb|AAR95657.1| plectin 3 [Rattus norvegicus] 35 0.44
gi|17232403|ref|NP_488951.1| unknown protein [Nostoc sp. PCC 712... 35 0.44
gi|2145585|pir||S67921 multiple ligand-binding protein 1 precurs... 35 0.44
gi|40849898|gb|AAR95661.1| plectin 7 [Rattus norvegicus] 35 0.44
gi|13540714|ref|NP_071796.1| plectin [Rattus norvegicus] >gnl|BL... 35 0.44
gi|40849892|gb|AAR95658.1| plectin 4 [Rattus norvegicus] >gnl|BL... 35 0.44
gi|40849906|gb|AAR95665.1| plectin 11 [Rattus norvegicus] 35 0.44
gi|40849900|gb|AAR95662.1| plectin 8 [Rattus norvegicus] 35 0.44
gi|47607492|ref|NP_000436.2| plectin 1 isoform 1; hemidesmosomal... 34 0.57
gi|39588050|emb|CAE57282.1| Hypothetical protein CBG00187 [Caeno... 34 0.57
gi|7442004|pir||G02520 plectin - human >gnl|BL_ORD_ID|215627 gi|... 34 0.57
gi|2129174|pir||A64505 P115 homolog - Methanococcus jannaschii 34 0.57
gi|15669839|ref|NP_248653.1| chromosome segretation protein (smc... 34 0.57
gi|21554135|gb|AAM63215.1| unknown [Arabidopsis thaliana] 34 0.57
gi|12718849|gb|AAK02016.1| enterophilin-1 [Cavia porcellus] 34 0.57
gi|32401386|gb|AAP80862.1| Emr1 [Triticum aestivum] 34 0.57
gi|25406462|pir||F96795 hypothetical protein F28O16.9 [imported]... 34 0.57
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 34 0.57
gi|30699195|ref|NP_177798.2| eukaryotic translation initiation f... 34 0.57
gi|41322910|ref|NP_958783.1| plectin 1 isoform 7; hemidesmosomal... 34 0.57
gi|34871258|ref|XP_221965.2| similar to RIKEN cDNA 1700028P05 [R... 34 0.57
gi|41322919|ref|NP_958784.1| plectin 1 isoform 8; hemidesmosomal... 34 0.57
gi|41322923|ref|NP_958786.1| plectin 1 isoform 11; hemidesmosoma... 34 0.57
gi|27374294|gb|AAO01046.1| CG11915-PA [Drosophila pseudoobscura] 34 0.57
gi|28375561|emb|CAD66604.1| SMC protein [Synechococcus sp. PCC 7... 34 0.57
gi|25406470|pir||G96796 hypothetical protein F28O16.18 [imported... 34 0.57
gi|41322912|ref|NP_958780.1| plectin 1 isoform 2; hemidesmosomal... 34 0.57
gi|41322916|ref|NP_958782.1| plectin 1 isoform 6; hemidesmosomal... 34 0.57
gi|27151475|sp|Q9BLJ6|BAGS_BOMMO BAG domain-containing protein S... 34 0.57
gi|14195007|sp|Q15149|PLE1_HUMAN Plectin 1 (PLTN) (PCN) (Hemides... 34 0.57
gi|39581063|emb|CAE57365.1| Hypothetical protein CBG00309 [Caeno... 34 0.57
gi|41322914|ref|NP_958785.1| plectin 1 isoform 10; hemidesmosoma... 34 0.57
gi|41322908|ref|NP_958781.1| plectin 1 isoform 3; hemidesmosomal... 34 0.57
gi|47225596|emb|CAG07939.1| unnamed protein product [Tetraodon n... 34 0.57
gi|42563275|ref|NP_177807.3| eukaryotic translation initiation f... 34 0.57
gi|46229715|gb|EAK90533.1| protein with DEXDc plus ring plus HEL... 34 0.57
gi|29249857|gb|EAA41360.1| GLP_630_3463_8346 [Giardia lamblia AT... 34 0.57
gi|49476075|ref|YP_034116.1| ATP-dependent clp protease, ATP-bin... 34 0.75
gi|42572143|ref|NP_974162.1| myosin heavy chain-related [Arabido... 34 0.75
gi|15643303|ref|NP_228347.1| hypothetical protein TM0537 [Thermo... 34 0.75
gi|32413483|ref|XP_327221.1| predicted protein [Neurospora crass... 34 0.75
gi|33602268|ref|NP_889828.1| ATP-dependent protease, ATPase subu... 34 0.75
gi|33592328|ref|NP_879972.1| ATP-dependent protease, ATPase subu... 34 0.75
gi|30699270|ref|NP_177881.2| myosin heavy chain-related [Arabido... 34 0.75
gi|212450|gb|AAA48986.1| nonmuscle myosin heavy chain 34 0.75
gi|15238455|ref|NP_196137.1| expressed protein [Arabidopsis thal... 34 0.75
gi|33596441|ref|NP_884084.1| ATP-dependent protease, ATPase subu... 34 0.75
gi|15223228|ref|NP_174531.1| zinc finger (C3HC4-type RING finger... 34 0.75
gi|212449|gb|AAA48985.1| nonmuscle myosin heavy chain 34 0.75
gi|46136705|ref|XP_390044.1| hypothetical protein FG09868.1 [Gib... 34 0.75
gi|41386747|ref|NP_958819.1| conserved nuclear protein Nhn1 [Rat... 34 0.75
gi|39939179|ref|NP_950945.1| chromosome segregation ATPase homol... 34 0.75
gi|47221289|emb|CAG13225.1| unnamed protein product [Tetraodon n... 34 0.75
gi|548927|sp|Q02225|SKI_XENLA SKI ONCOGENE (C-SKI) >gnl|BL_ORD_I... 34 0.75
gi|50285883|ref|XP_445370.1| unnamed protein product [Candida gl... 34 0.75
gi|212451|gb|AAA48987.1| nonmuscle myosin heavy chain 34 0.75
gi|12018260|ref|NP_072118.1| cis-Golgi matrix protein GM130 [Rat... 34 0.75
gi|25518154|pir||G86450 F5D14.31 protein - Arabidopsis thaliana ... 34 0.75
gi|45360619|ref|NP_988982.1| hypothetical protein MGC75863 [Xeno... 34 0.75
gi|40807643|gb|AAR92227.1| Nhn1A [Rattus norvegicus] 34 0.75
gi|23111650|ref|ZP_00097255.1| COG1196: Chromosome segregation A... 34 0.75
gi|730093|sp|P39922|MYS3_HYDAT Myosin heavy chain, clone 203 >gn... 34 0.75
gi|45382679|ref|NP_990805.1| nonmuscle myosin heavy chain [Gallu... 34 0.75
gi|5453591|ref|NP_006435.1| structural maintenance of chromosome... 34 0.75
gi|17233314|ref|NP_490404.1| hypothetical protein [Nostoc sp. PC... 34 0.75
gi|42627769|tpe|CAD89875.1| TPA: SMC2 protein [Homo sapiens] 34 0.75
gi|15234871|ref|NP_192733.1| avirulence-responsive family protei... 34 0.75
gi|48734798|gb|AAH72137.1| C-ski-A protein [Xenopus laevis] 34 0.75
gi|48825837|ref|ZP_00287074.1| COG3027: Uncharacterized protein ... 34 0.75
gi|15193244|gb|AAK91740.1| axoneme-associated protein GASP-180 [... 34 0.75
gi|32398865|emb|CAD98575.1| repeat organellar protein, possible ... 33 0.97
gi|16125131|ref|NP_419695.1| ATP-dependent Clp protease, ATP-bin... 33 0.97
gi|1644457|gb|AAC52864.1| neural variant mena+ protein [Mus musc... 33 0.97
gi|11121496|emb|CAC14945.1| dJ756N5.1.1 (Continues in Em:AL13332... 33 0.97
gi|6753754|ref|NP_034265.1| enabled homolog; NPC derived proline... 33 0.97
gi|47213905|emb|CAF95847.1| unnamed protein product [Tetraodon n... 33 0.97
gi|42662294|ref|XP_371398.2| myosin, heavy polypeptide 7B, cardi... 33 0.97
gi|14279233|gb|AAK58539.1| RING finger protein 20 [Homo sapiens] 33 0.97
gi|34878777|ref|NP_062538.5| ring finger protein 20; homolog of ... 33 0.97
gi|14043677|gb|AAH07808.1| MYH7B protein [Homo sapiens] 33 0.97
gi|47124894|gb|AAH70598.1| MGC81234 protein [Xenopus laevis] 33 0.97
gi|47203641|emb|CAF87225.1| unnamed protein product [Tetraodon n... 33 0.97
gi|1644459|gb|AAC52865.1| neural variant mena++ protein [Mus mus... 33 0.97
gi|50729004|ref|XP_416384.1| PREDICTED: similar to Rab6-interact... 33 0.97
gi|44917433|gb|AAS49041.1| At2g19950 [Arabidopsis thaliana] 33 0.97
gi|17550052|ref|NP_508635.1| M protein repeat containing protein... 33 0.97
gi|47847534|dbj|BAD21439.1| mFLJ00419 protein [Mus musculus] 33 0.97
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa... 33 0.97
gi|47220539|emb|CAG05565.1| unnamed protein product [Tetraodon n... 33 0.97
gi|27529913|dbj|BAA96036.2| KIAA1512 protein [Homo sapiens] 33 0.97
gi|29788770|ref|NP_598708.2| nuclear mitotic apparatus protein 1... 33 0.97
gi|2982010|pdb|4HB1| A Designed Four Helix Bundle Protein 33 0.97
gi|46228257|gb|EAK89156.1| hypothetical protein cgd3_1280 [Crypt... 33 0.97
gi|28378976|ref|NP_785868.1| prophage Lp2 protein 46 [Lactobacil... 33 0.97
gi|21739840|emb|CAD38947.1| hypothetical protein [Homo sapiens] 33 0.97
gi|33859829|ref|NP_892044.1| ring finger protein 20 [Mus musculu... 33 0.97
gi|7023699|dbj|BAA92057.1| unnamed protein product [Homo sapiens] 33 0.97
gi|1644455|gb|AAC52863.1| mena protein [Mus musculus] >gnl|BL_OR... 33 0.97
gi|34874618|ref|XP_237042.2| similar to bullous pemphigoid antig... 33 0.97
gi|24653450|ref|NP_610896.1| CG18368-PA [Drosophila melanogaster... 33 0.97
gi|10433666|dbj|BAB14005.1| unnamed protein product [Homo sapiens] 33 0.97
gi|6323115|ref|NP_013187.1| Subunit of the condensin complex, wh... 33 1.3
gi|5803145|ref|NP_006779.1| ralA binding protein 1; ralA-binding... 33 1.3
gi|6320145|ref|NP_010225.1| involved intracellular protein trans... 33 1.3
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p... 33 1.3
gi|38045892|ref|NP_829881.1| Rab6-interacting protein 2 isoform ... 33 1.3
gi|1174412|sp|P02549|SPCA_HUMAN Spectrin alpha chain, erythrocyt... 33 1.3
gi|41581458|ref|NP_083488.1| RIKEN cDNA 4930535E21; speriolin-bi... 33 1.3
gi|20521758|dbj|BAA83033.2| KIAA1081 protein [Homo sapiens] 33 1.3
gi|38045896|ref|NP_829883.1| Rab6-interacting protein 2 isoform ... 33 1.3
gi|47211881|emb|CAF91177.1| unnamed protein product [Tetraodon n... 33 1.3
gi|17561158|ref|NP_507932.1| protein tyrosine phosphatase non-re... 33 1.3
gi|677198|gb|AAB00143.1| putative 33 1.3
gi|4507189|ref|NP_003117.1| spectrin, alpha, erythrocytic 1 (ell... 33 1.3
gi|14149661|ref|NP_055879.1| Rab6-interacting protein 2 isoform ... 33 1.3
gi|171959|gb|AAA34783.1| myosin-like protein 33 1.3
gi|6322948|ref|NP_013021.1| Mlp proteins restrict telomere lengt... 33 1.3
gi|38045898|ref|NP_829884.1| Rab6-interacting protein 2 isoform ... 33 1.3
gi|744457|prf||2014371A kinesin 33 1.3
gi|50419711|ref|XP_458383.1| unnamed protein product [Debaryomyc... 33 1.3
gi|26326767|dbj|BAC27127.1| unnamed protein product [Mus musculus] 33 1.3
gi|47229938|emb|CAG10352.1| unnamed protein product [Tetraodon n... 33 1.3
gi|2204269|emb|CAA97648.1| unnamed protein product [Saccharomyce... 33 1.3
gi|2760351|gb|AAB95253.1| myosin heavy chain [Girardia tigrina] 33 1.3
gi|38045894|ref|NP_829882.1| Rab6-interacting protein 2 isoform ... 33 1.3
gi|15641718|ref|NP_231350.1| cell division protein MukB [Vibrio ... 33 1.3
gi|47215907|emb|CAG00382.1| unnamed protein product [Tetraodon n... 33 1.3
gi|18402909|ref|NP_565741.1| expressed protein [Arabidopsis thal... 33 1.3
gi|49388303|dbj|BAD25418.1| unknown protein [Oryza sativa (japon... 33 1.3
gi|15982767|gb|AAL09731.1| At2g32240/F22D22.1 [Arabidopsis thali... 33 1.3
gi|28829643|gb|AAO52159.1| similar to C25A11.4b.p [Caenorhabditi... 33 1.3
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae] 33 1.3
gi|17509337|ref|NP_492100.1| tyrosine phosphatase family member ... 33 1.3
gi|41322941|ref|NP_958796.1| plectin 1 isoform 11 [Mus musculus]... 33 1.7
gi|41322935|ref|NP_958793.1| plectin 1 isoform 8 [Mus musculus] ... 33 1.7
gi|16716511|ref|NP_444434.1| Rab6-interacting protein 2 [Mus mus... 33 1.7
gi|38077811|ref|XP_128277.4| similar to plectin [Mus musculus] 33 1.7
gi|40850918|gb|AAH65238.1| ENAH protein [Homo sapiens] 33 1.7
gi|21755689|dbj|BAC04736.1| unnamed protein product [Homo sapiens] 33 1.7
gi|41322939|ref|NP_958795.1| plectin 1 isoform 10 [Mus musculus]... 33 1.7
gi|34499279|ref|NP_903494.1| conserved hypothetical protein [Chr... 33 1.7
gi|13272276|gb|AAK17065.1| fibronectin binding autolysin [Staphy... 33 1.7
gi|41322931|ref|NP_958791.1| plectin 1 isoform 6 [Mus musculus] ... 33 1.7
gi|39793885|gb|AAH64009.1| 1810043M20Rik protein [Mus musculus] 33 1.7
gi|46249876|gb|AAH68827.1| LOC414564 protein [Xenopus laevis] 33 1.7
gi|50750157|ref|XP_421895.1| PREDICTED: similar to Disco-interac... 33 1.7
gi|3986194|dbj|BAA34954.1| myosin heavy chain [Dugesia japonica] 33 1.7
gi|41322927|ref|NP_958789.1| plectin 1 isoform 4 [Mus musculus] ... 33 1.7
gi|10433974|dbj|BAB14081.1| unnamed protein product [Homo sapiens] 33 1.7
gi|39592202|emb|CAE75423.1| Hypothetical protein CBG23416 [Caeno... 33 1.7
gi|15616162|ref|NP_244467.1| cell wall-binding protein [Bacillus... 33 1.7
gi|48428086|sp|Q8N8S7|ENAH_HUMAN Enabled protein homolog >gnl|BL... 33 1.7
gi|50404859|ref|YP_053951.1| hypothetical protein with coiled-co... 33 1.7
gi|18417787|ref|NP_567873.1| myosin heavy chain-related [Arabido... 33 1.7
gi|39930375|ref|NP_060682.2| enabled homolog [Homo sapiens] >gnl... 33 1.7
gi|50741983|ref|XP_419647.1| PREDICTED: similar to RIKEN cDNA 28... 33 1.7
gi|47223952|emb|CAG06129.1| unnamed protein product [Tetraodon n... 33 1.7
gi|41322904|ref|NP_035247.1| plectin 1 isoform 1 [Mus musculus] ... 33 1.7
gi|49119563|gb|AAH73107.1| Unknown (protein for MGC:83587) [Xeno... 33 1.7
gi|7486664|pir||T04501 hypothetical protein F8F16.160 - Arabidop... 33 1.7
gi|14195008|sp|Q9JI55|PLE1_CRIGR Plectin 1 (PLTN) (PCN) (300-kDa... 33 1.7
gi|34868389|ref|XP_232995.2| similar to ring finger protein 20 [... 33 1.7
gi|47213350|emb|CAF92973.1| unnamed protein product [Tetraodon n... 33 1.7
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 33 1.7
gi|41322921|ref|NP_958788.1| plectin 1 isoform 3 [Mus musculus] ... 33 1.7
gi|47227646|emb|CAG09643.1| unnamed protein product [Tetraodon n... 33 1.7
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 33 1.7
gi|467292|gb|AAA17387.1| glutamine-asparagine rich protein 33 1.7
gi|28175578|gb|AAH43468.1| RIKEN cDNA 4921537D05 gene [Mus muscu... 33 1.7
gi|22024255|ref|NP_611787.2| CG3493-PA [Drosophila melanogaster]... 33 1.7
gi|40074461|gb|AAR39438.1| kinesin family member 8 [Dictyosteliu... 33 1.7
gi|18447644|gb|AAL68382.1| SD05887p [Drosophila melanogaster] 33 1.7
gi|27476088|gb|AAO17019.1| Hypothetical protein [Oryza sativa (j... 33 1.7
gi|6324250|ref|NP_014320.1| Actin-binding protein that stabilize... 33 1.7
gi|41322933|ref|NP_958792.1| plectin 1 isoform 7 [Mus musculus] ... 33 1.7
gi|13445784|gb|AAK26381.1| Rab6-interacting protein 2 isoform A ... 33 1.7
gi|11276949|pir||A59282 nonmuscle myosin II heavy chain A - Afri... 33 1.7
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 33 1.7
gi|27229249|ref|NP_084128.2| RIKEN cDNA 4921537D05 [Mus musculus... 33 1.7
gi|41322925|ref|NP_958787.1| plectin 1 isoform 2 [Mus musculus] ... 33 1.7
gi|23099705|ref|NP_693171.1| exonuclease [Oceanobacillus iheyens... 33 1.7
gi|34859473|ref|XP_218972.2| nuclear mitotic apparatus protein 1... 33 1.7
gi|31241027|ref|XP_320927.1| ENSANGP00000017712 [Anopheles gambi... 33 1.7
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut... 33 1.7
gi|382658|prf||1819485A CENP-E protein 33 1.7
gi|49389238|dbj|BAD25200.1| unknown protein [Oryza sativa (japon... 33 1.7
gi|13278786|gb|AAH04165.1| NUMA1 protein [Homo sapiens] 32 2.2
gi|3205211|gb|AAC19403.1| non-muscle myosin heavy chain [Bos tau... 32 2.2
gi|47211780|emb|CAF94090.1| unnamed protein product [Tetraodon n... 32 2.2
gi|3122264|sp|O15818|IF3X_DICDI Putative eukaryotic translation ... 32 2.2
gi|37718775|gb|AAR01646.1| unknown protein [Oryza sativa (japoni... 32 2.2
gi|1170907|sp|Q08014|MEDB_GIALA MEDIAN BODY PROTEIN >gnl|BL_ORD_... 32 2.2
gi|45383005|ref|NP_989918.1| myosin heavy chain [Gallus gallus] ... 32 2.2
gi|3043566|dbj|BAA25447.1| KIAA0521 protein [Homo sapiens] 32 2.2
gi|25406471|pir||H96796 hypothetical protein F28O16.19 [imported... 32 2.2
gi|2352260|gb|AAC26971.1| keratin [Canis familiaris] 32 2.2
gi|23128140|ref|ZP_00109994.1| COG0542: ATPases with chaperone a... 32 2.2
gi|42522699|ref|NP_968079.1| chromosome segregation SMC protein ... 32 2.2
gi|30680819|ref|NP_850769.1| expressed protein [Arabidopsis thal... 32 2.2
gi|31455194|gb|AAH13023.1| NUMA1 protein [Homo sapiens] 32 2.2
gi|50414437|gb|AAH77721.1| ARHGEF18 protein [Homo sapiens] 32 2.2
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 32 2.2
gi|15207981|dbj|BAB63015.1| hypothetical protein [Macaca fascicu... 32 2.2
gi|15606774|ref|NP_214154.1| ATPase subunit of ATP-dependent pro... 32 2.2
gi|41327769|ref|NP_056133.2| Rho-specific guanine nucleotide exc... 32 2.2
gi|40737018|gb|AAR89031.1| putative transposase [Oryza sativa (j... 32 2.2
gi|45384060|ref|NP_990605.1| MHC mRNA [Gallus gallus] >gnl|BL_OR... 32 2.2
gi|50258035|gb|EAL20729.1| hypothetical protein CNBE0920 [Crypto... 32 2.2
gi|32822886|gb|AAH55081.1| Unknown (protein for IMAGE:6708852) [... 32 2.2
gi|3915778|sp|P10587|MYHB_CHICK Myosin heavy chain, gizzard smoo... 32 2.2
gi|50400858|sp|Q14980|NUMA_HUMAN Nuclear mitotic apparatus prote... 32 2.2
gi|3122952|sp|O15736|TIPD_DICDI Protein tipD >gnl|BL_ORD_ID|3655... 32 2.2
gi|20066260|gb|AAM09367.1| similar to Dictyostelium discoideum (... 32 2.2
gi|50754766|ref|XP_414495.1| PREDICTED: similar to hyaluronan re... 32 2.2
gi|17509237|ref|NP_492137.1| putative protein, with 4 coiled coi... 32 2.2
gi|15292547|gb|AAK93542.1| SD06673p [Drosophila melanogaster] 32 2.2
gi|17026030|dbj|BAB72075.1| hypothetical protein [Macaca fascicu... 32 2.2
gi|32879817|gb|AAP88739.1| nuclear mitotic apparatus protein 1 [... 32 2.2
gi|24639806|ref|NP_572203.2| CG32767-PA [Drosophila melanogaster... 32 2.2
gi|19074177|ref|NP_584783.1| MYOSIN HEAVY CHAIN [Encephalitozoon... 32 2.2
gi|45199122|ref|NP_986151.1| AFR604Cp [Eremothecium gossypii] >g... 32 2.2
gi|33589366|gb|AAQ22450.1| RE54443p [Drosophila melanogaster] 32 2.2
gi|31199763|ref|XP_308829.1| ENSANGP00000021790 [Anopheles gambi... 32 2.2
gi|6678475|ref|NP_033479.1| U2 small nuclear ribonucleoprotein a... 32 2.2
gi|1346410|sp|P08928|LAM0_DROME Lamin Dm0 >gnl|BL_ORD_ID|745581 ... 32 2.2
gi|47940530|gb|AAH71750.1| Unknown (protein for IMAGE:6654356) [... 32 2.2
gi|15291841|gb|AAK93189.1| LD29301p [Drosophila melanogaster] 32 2.2
gi|49076248|ref|XP_402122.1| hypothetical protein UM04507.1 [Ust... 32 2.2
gi|42520020|ref|NP_965935.1| transposase, IS4 family [Wolbachia ... 32 2.2
gi|33438277|dbj|BAC65656.2| mKIAA0803 protein [Mus musculus] 32 2.2
gi|50419303|ref|XP_458176.1| unnamed protein product [Debaryomyc... 32 2.2
gi|39930557|ref|NP_919444.1| A kinase (PRKA) anchor protein (yot... 32 2.2
gi|34533778|dbj|BAC86801.1| unnamed protein product [Homo sapiens] 32 2.2
gi|21724197|gb|AAM28348.1| EIF3 [Culicoides sonorensis] 32 2.2
gi|24655781|ref|NP_647680.1| CG5690-PA [Drosophila melanogaster]... 32 2.2
gi|31205757|ref|XP_311830.1| ENSANGP00000017553 [Anopheles gambi... 32 2.2
gi|39597696|emb|CAE68387.1| Hypothetical protein CBG14146 [Caeno... 32 2.2
gi|15236607|ref|NP_194111.1| high mobility group (HMG1/2) family... 32 2.2
gi|18977539|ref|NP_578896.1| smc-like [Pyrococcus furiosus DSM 3... 32 2.2
gi|12045072|ref|NP_072883.1| cytadherence accessory protein (hmw... 32 2.2
gi|14249928|gb|AAH08345.1| Unknown (protein for IMAGE:3531356) [... 32 2.2
gi|2829746|sp|P90970|YG6P_CAEEL Hypothetical 60.7 kDa protein T2... 32 2.2
gi|4928755|gb|AAD33718.1| myosin heavy chain [Amoeba proteus] 32 2.2
gi|34880553|ref|XP_228973.2| similar to hypothetical protein FLJ... 32 2.2
gi|39597779|emb|CAE68471.1| Hypothetical protein CBG14270 [Caeno... 32 2.2
gi|2144796|pir||I36912 involucrin S - douroucouli (fragment) >gn... 32 2.2
gi|50417124|gb|AAH77139.1| Unknown (protein for IMAGE:7146502) [... 32 2.2
gi|50419075|ref|XP_458060.1| unnamed protein product [Debaryomyc... 32 2.2
gi|28896927|ref|NP_796532.1| putative exported protein [Vibrio p... 32 2.2
gi|17229814|ref|NP_486362.1| endopeptidase Clp ATP-binding chain... 32 2.8
gi|1045294|emb|CAA91434.1| cardiac tropomyosin [Salmo trutta] 32 2.8
gi|47228073|emb|CAF97702.1| unnamed protein product [Tetraodon n... 32 2.8
gi|11358978|pir||A59235 unconventional myosin heavy chain MyoM -... 32 2.8
gi|85042|pir||A29965 lamin Dm-0 precursor - fruit fly (Drosophil... 32 2.8
gi|50355643|dbj|BAD29962.1| Be158 [Babesia equi] 32 2.8
gi|17533741|ref|NP_494820.1| M protein repeat containing protein... 32 2.8
gi|50747697|ref|XP_420953.1| PREDICTED: similar to hypothetical ... 32 2.8
gi|47220555|emb|CAG05581.1| unnamed protein product [Tetraodon n... 32 2.8
gi|32565065|ref|NP_872028.1| M protein repeat containing protein... 32 2.8
gi|16804929|ref|NP_472958.1| hypothetical protein [Plasmodium fa... 32 2.8
gi|31544696|ref|NP_853274.1| Clp [Mycoplasma gallisepticum R] >g... 32 2.8
gi|50405083|ref|YP_054175.1| hypothetical protein PTMB.246c [Par... 32 2.8
gi|17533739|ref|NP_494819.1| M protein repeat containing protein... 32 2.8
gi|23485476|gb|EAA20445.1| hypothetical protein [Plasmodium yoel... 32 2.8
gi|34871052|ref|XP_239247.2| similar to misshapen/NIK-related ki... 32 2.8
gi|47214961|emb|CAG10783.1| unnamed protein product [Tetraodon n... 32 2.8
gi|743447|prf||2012303A SP-H antigen 32 2.8
gi|21740153|emb|CAD39090.1| hypothetical protein [Homo sapiens] 32 2.8
gi|39593982|emb|CAE70092.1| Hypothetical protein CBG16534 [Caeno... 32 2.8
gi|17533743|ref|NP_494821.1| M protein repeat containing protein... 32 2.8
gi|34867014|ref|XP_345851.1| similar to I-kappa-B-related protei... 32 2.8
gi|49328159|gb|AAT58855.1| putative microtubule-associated prote... 32 2.8
gi|47230171|emb|CAG10585.1| unnamed protein product [Tetraodon n... 32 2.8
gi|34851509|ref|XP_344734.1| similar to RIKEN cDNA 1700081O22 [R... 32 2.8
gi|5453820|ref|NP_006176.1| nuclear mitotic apparatus protein 1 ... 32 2.8
gi|50751308|ref|XP_422337.1| PREDICTED: similar to sarcoma antig... 32 2.8
gi|15896701|ref|NP_350050.1| Hypothetical protein CAC3461 [Clost... 32 2.8
gi|33340133|gb|AAQ14554.1| La binding protein 1 [Homo sapiens] 32 2.8
gi|7662158|ref|NP_055991.1| F-box protein 28 [Homo sapiens] >gnl... 32 2.8
gi|24286732|gb|AAN46886.1| nucleotide exchange factor RasGEF R [... 32 2.8
gi|9971579|dbj|BAB12571.1| myosin heavy chain [Pennahia argentata] 32 2.8
gi|50555636|ref|XP_505226.1| hypothetical protein [Yarrowia lipo... 32 2.8
gi|1173565|gb|AAC51791.1| golgin-245 [Homo sapiens] >gnl|BL_ORD_... 32 2.8
gi|47218355|emb|CAG04187.1| unnamed protein product [Tetraodon n... 32 2.8
gi|17136290|ref|NP_476616.1| CG6944-PA [Drosophila melanogaster]... 32 2.8
gi|48895327|ref|ZP_00328311.1| COG0488: ATPase components of ABC... 32 2.8
gi|33413425|ref|NP_061869.2| KIAA1582 protein [Homo sapiens] 32 2.8
gi|20521948|dbj|BAB13408.2| KIAA1582 protein [Homo sapiens] 32 2.8
gi|31236627|ref|XP_319447.1| ENSANGP00000014252 [Anopheles gambi... 32 2.8
gi|34882463|ref|XP_221183.2| similar to RIKEN cDNA 4933431D05 [R... 32 2.8
gi|47216282|emb|CAF96578.1| unnamed protein product [Tetraodon n... 32 2.8
gi|1722855|sp|P50532|SMC4_XENLA Structural maintenance of chromo... 32 2.8
gi|23490500|gb|EAA22262.1| hypothetical protein [Plasmodium yoel... 32 2.8
gi|3413926|dbj|BAA32327.1| KIAA0483 protein [Homo sapiens] 32 2.8
gi|31201125|ref|XP_309510.1| ENSANGP00000012681 [Anopheles gambi... 32 2.8
gi|27803037|emb|CAD60740.1| unnamed protein product [Podospora a... 32 2.8
gi|38107868|gb|EAA53982.1| hypothetical protein MG01967.4 [Magna... 32 2.8
gi|45751568|gb|AAH68006.1| ELKS protein [Homo sapiens] 32 2.8
gi|28374385|gb|AAH45631.1| KIAA1582 protein [Homo sapiens] 32 2.8
gi|34882599|ref|XP_229490.2| similar to RIKEN cDNA 4933431D05 [R... 32 2.8
gi|28828709|gb|AAO51304.1| hypothetical protein [Dictyostelium d... 32 2.8
gi|50286051|ref|XP_445454.1| unnamed protein product [Candida gl... 32 2.8
gi|19922156|ref|NP_610845.1| CG4616-PA [Drosophila melanogaster]... 32 3.7
gi|280616|pir||A37103 lamin precursor - fruit fly (Drosophila me... 32 3.7
gi|6321415|ref|NP_011492.1| Phosphatidylinositol 3-phosphate bin... 32 3.7
gi|34906092|ref|NP_914393.1| P0020E09.6 [Oryza sativa (japonica ... 32 3.7
gi|24762816|ref|NP_523860.2| CG15792-PA [Drosophila melanogaster... 32 3.7
gi|15240607|ref|NP_196838.1| expressed protein [Arabidopsis thal... 32 3.7
gi|13385186|ref|NP_080001.1| RIKEN cDNA 4921513E08 [Mus musculus... 32 3.7
gi|1589173|prf||2210342A myosin:SUBUNIT=heavy chain 32 3.7
gi|24653671|ref|NP_610972.2| CG12864-PA [Drosophila melanogaster... 32 3.7
gi|50748282|ref|XP_429303.1| PREDICTED: hypothetical protein XP_... 32 3.7
gi|50257196|gb|EAL19909.1| hypothetical protein CNBG0520 [Crypto... 32 3.7
gi|1572481|gb|AAB09049.1| nonmuscle myosin-II heavy chain [Droso... 32 3.7
gi|2119295|pir||S61477 myosin II heavy chain, non-muscle - fruit... 32 3.7
gi|31207321|ref|XP_312627.1| ENSANGP00000015381 [Anopheles gambi... 32 3.7
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 32 3.7
gi|50414445|gb|AAH77732.1| Unknown (protein for IMAGE:6292230) [... 32 3.7
gi|1141790|gb|AAB09051.1| nonmuscle myosin-II heavy chain [Droso... 32 3.7
gi|157953|gb|AAA28713.1| non-muscle myosin heavy chain 32 3.7
gi|41406064|ref|NP_005955.1| myosin, heavy polypeptide 10, non-m... 32 3.7
gi|1346640|sp|P35580|MYHA_HUMAN Myosin heavy chain, nonmuscle ty... 32 3.7
gi|42733836|gb|AAS38754.1| hypothetical protein [Dictyostelium d... 32 3.7
gi|20348846|ref|XP_111896.1| similar to testis expressed sequenc... 32 3.7
gi|27807325|ref|NP_777259.1| myosin, heavy polypeptide 10, non-m... 32 3.7
gi|1572482|gb|AAB09050.1| nonmuscle myosin-II heavy chain [Droso... 32 3.7
gi|15669512|ref|NP_248322.1| purine NTPase [Methanocaldococcus j... 32 3.7
gi|47208509|emb|CAF96454.1| unnamed protein product [Tetraodon n... 32 3.7
gi|39586701|emb|CAE69421.1| Hypothetical protein CBG15585 [Caeno... 32 3.7
gi|50757697|ref|XP_415612.1| PREDICTED: similar to KIAA1582 prot... 32 3.7
gi|38092558|ref|XP_126551.3| RIKEN cDNA 9930033H14 gene [Mus mus... 32 3.7
gi|17567379|ref|NP_509921.1| putative protein, with 3 coiled coi... 32 3.7
gi|11360170|pir||T46463 hypothetical protein DKFZp434P232.1 - hu... 32 3.7
gi|47225394|emb|CAG11877.1| unnamed protein product [Tetraodon n... 32 3.7
gi|7513094|pir||T08686 intracellular protein Mg11 homolog DKFZp5... 32 3.7
gi|38345942|emb|CAD41274.2| OSJNBb0103I08.13 [Oryza sativa (japo... 32 3.7
gi|31542604|ref|NP_740769.2| ELKS protein; RIM-Binding Protein; ... 32 3.7
gi|23664282|gb|AAN39293.1| ERC1b [Rattus norvegicus] 32 3.7
gi|13508213|ref|NP_110162.1| coiled coil protein, putative struc... 32 3.7
gi|42562828|ref|NP_176226.3| splicing factor PWI domain-containi... 32 3.7
gi|17539660|ref|NP_501873.1| myosin heavy chain (4K994) [Caenorh... 32 3.7
gi|1828|emb|CAA35992.1| trichohyalin [Ovis sp.] 32 3.7
gi|47222923|emb|CAF99079.1| unnamed protein product [Tetraodon n... 32 3.7
gi|27681007|ref|XP_223125.1| similar to DNA segment, Chr 1, ERAT... 32 3.7
gi|27695730|gb|AAH43115.1| 0610010D24Rik protein [Mus musculus] ... 32 3.7
gi|46107974|ref|XP_381045.1| hypothetical protein FG00869.1 [Gib... 32 3.7
gi|37651350|ref|NP_932752.1| immediate early protein 2 [Choristo... 32 3.7
gi|31198279|ref|XP_308087.1| ENSANGP00000019758 [Anopheles gambi... 32 3.7
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738... 32 3.7
gi|21357285|ref|NP_648066.1| CG18156-PA [Drosophila melanogaster... 32 3.7
gi|7486937|pir||T02272 hypothetical protein T13D8.9 - Arabidopsi... 32 3.7
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 32 3.7
gi|41191863|ref|XP_209505.3| similar to KIAA0445 protein [Homo s... 32 3.7
gi|34882568|ref|XP_226313.2| similar to RIKEN cDNA 4933431D05 [R... 32 3.7
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 32 3.7
gi|50285225|ref|XP_445041.1| unnamed protein product [Candida gl... 32 3.7
gi|48894044|ref|ZP_00327242.1| COG0419: ATPase involved in DNA r... 32 3.7
gi|50414793|gb|AAH77786.1| Unknown (protein for IMAGE:4970537) [... 32 3.7
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor... 32 3.7
gi|12653033|gb|AAH00280.1| Unknown (protein for IMAGE:3357927) [... 32 3.7
gi|34883103|ref|XP_343750.1| similar to RIKEN cDNA 4933431D05 [R... 32 3.7
gi|28829494|gb|AAO52027.1| similar to Dictyostelium discoideum (... 32 3.7
gi|1709211|sp|P54697|MYSJ_DICDI Myosin IJ heavy chain >gnl|BL_OR... 32 3.7
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 32 3.7
gi|50554961|ref|XP_504889.1| hypothetical protein [Yarrowia lipo... 32 3.7
gi|50289393|ref|XP_447128.1| unnamed protein product [Candida gl... 32 3.7
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 32 3.7
gi|28972790|dbj|BAC65811.1| mKIAA1582 protein [Mus musculus] 32 3.7
gi|31208287|ref|XP_313110.1| ENSANGP00000012912 [Anopheles gambi... 32 3.7
gi|6912526|ref|NP_036469.1| nasopharyngeal epithelium specific p... 32 3.7
gi|50549935|ref|XP_502439.1| hypothetical protein [Yarrowia lipo... 32 3.7
gi|23508231|ref|NP_700900.1| hypothetical protein [Plasmodium fa... 32 3.7
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 32 3.7
gi|24762818|ref|NP_726506.1| CG15792-PB [Drosophila melanogaster... 32 3.7
gi|34865346|ref|XP_216723.2| similar to ninein [Rattus norvegicus] 32 3.7
gi|46437637|gb|EAK96980.1| hypothetical protein CaO19.9753 [Cand... 32 3.7
gi|47564949|ref|ZP_00235993.1| hypothetical protein protein [Bac... 32 3.7
gi|38488759|ref|NP_942120.1| zgc:66459; ORFNames=zgc:66459 [Dani... 32 3.7
gi|32408643|ref|XP_324802.1| hypothetical protein [Neurospora cr... 32 3.7
gi|547969|sp|Q99323|MYSN_DROME Myosin heavy chain, non-muscle (Z... 32 3.7
>gi|17505823|ref|NP_492800.1| putative protein, with a coiled coil-4
domain (15.7 kD) (1L263) [Caenorhabditis elegans]
gi|7496967|pir||T32887 hypothetical protein C34B2.2 -
Caenorhabditis elegans
gi|2804413|gb|AAB97534.1| Hypothetical protein C34B2.2
[Caenorhabditis elegans]
Length = 135
Score = 264 bits (675), Expect = 3e-70
Identities = 135/135 (100%), Positives = 135/135 (100%)
Frame = +1
Query: 1 MNPNHNEGLLELYTQAISLEALKDAEQFLENSLLGKDAQVERLLAQVLIEEQQIETNRKK 180
MNPNHNEGLLELYTQAISLEALKDAEQFLENSLLGKDAQVERLLAQVLIEEQQIETNRKK
Sbjct: 1 MNPNHNEGLLELYTQAISLEALKDAEQFLENSLLGKDAQVERLLAQVLIEEQQIETNRKK 60
Query: 181 IAQLRIEKEELEFDCANSDLKSLEQMQAERDELQRKCQPGQHTKSNHKSSEQLLRMKKET 360
IAQLRIEKEELEFDCANSDLKSLEQMQAERDELQRKCQPGQHTKSNHKSSEQLLRMKKET
Sbjct: 61 IAQLRIEKEELEFDCANSDLKSLEQMQAERDELQRKCQPGQHTKSNHKSSEQLLRMKKET 120
Query: 361 DALRAYMKKISQFED 405
DALRAYMKKISQFED
Sbjct: 121 DALRAYMKKISQFED 135