Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C34E10_9
(1068 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17552462|ref|NP_498118.1| ATP/GTP binding protein, Gro-1 OPer... 600 e-170
gi|39586546|emb|CAE73673.1| Hypothetical protein CBG21182 [Caeno... 545 e-154
gi|19526970|ref|NP_598517.1| XPA binding protein 1; methyl-CpG b... 339 6e-92
gi|14149629|ref|NP_009197.1| XPA binding protein 1; MBD2 interac... 336 6e-91
gi|3646130|emb|CAA09376.1| ATP(GTP)-binding protein [Homo sapiens] 336 6e-91
gi|50745115|ref|XP_419990.1| PREDICTED: similar to XPA binding p... 334 2e-90
gi|50417230|gb|AAH78195.1| Unknown (protein for MGC:100927) [Dan... 332 9e-90
gi|47209487|emb|CAF89603.1| unnamed protein product [Tetraodon n... 327 4e-88
gi|46442683|gb|EAL01970.1| hypothetical protein CaO19.13821 [Can... 315 1e-84
gi|46443216|gb|EAL02499.1| hypothetical protein CaO19.6463 [Cand... 315 1e-84
gi|45198946|ref|NP_985975.1| AFR428Cp [Eremothecium gossypii] >g... 313 6e-84
gi|50258774|gb|EAL21459.1| hypothetical protein CNBD1540 [Crypto... 311 1e-83
gi|50425385|ref|XP_461286.1| unnamed protein product [Debaryomyc... 311 1e-83
gi|6322532|ref|NP_012606.1| Cytoplasmic protein required for cel... 308 1e-82
gi|31239409|ref|XP_320118.1| ENSANGP00000023211 [Anopheles gambi... 308 1e-82
gi|50304421|ref|XP_452160.1| unnamed protein product [Kluyveromy... 306 5e-82
gi|50291621|ref|XP_448243.1| unnamed protein product [Candida gl... 304 3e-81
gi|34862639|ref|XP_343026.1| similar to RIKEN cDNA 2410004J02 [R... 302 1e-80
gi|50553652|ref|XP_504237.1| hypothetical protein [Yarrowia lipo... 301 1e-80
gi|19112089|ref|NP_595297.1| hypothetical protein; similar to S.... 301 2e-80
gi|38101488|gb|EAA48443.1| hypothetical protein MG00101.4 [Magna... 290 4e-77
gi|49069612|ref|XP_399095.1| hypothetical protein UM01480.1 [Ust... 285 1e-75
gi|31239407|ref|XP_320117.1| ENSANGP00000001801 [Anopheles gambi... 281 1e-74
gi|15234595|ref|NP_193911.1| ATP-binding family protein [Arabido... 281 2e-74
gi|21594440|gb|AAM66008.1| putative protein [Arabidopsis thaliana] 281 2e-74
gi|32406494|ref|XP_323860.1| hypothetical protein [Neurospora cr... 281 2e-74
gi|49096426|ref|XP_409673.1| hypothetical protein AN5536.2 [Aspe... 278 1e-73
gi|23508712|ref|NP_701380.1| XPA binding protein 1, putative [Pl... 278 2e-73
gi|23486518|gb|EAA20817.1| Arabidopsis thaliana At4g21800/F17L22... 275 2e-72
gi|46116392|ref|XP_384214.1| hypothetical protein FG04038.1 [Gib... 274 2e-72
gi|18543199|ref|NP_569872.1| CG3704-PA [Drosophila melanogaster]... 273 4e-72
gi|7487824|pir||T05462 hypothetical protein T8O5.10 - Arabidopsi... 270 4e-71
gi|25407581|pir||A85249 hypothetical protein AT4g21800 [imported... 270 4e-71
gi|29247614|gb|EAA39171.1| GLP_178_39538_40647 [Giardia lamblia ... 218 2e-55
gi|13812166|ref|NP_113294.1| ATP(GTP)-binding protein [Guillardi... 211 2e-53
gi|18129667|emb|CAC33986.1| probable XPA binding protein 1 [Leis... 211 2e-53
gi|19074062|ref|NP_584668.1| similarity to HYPOTHETICAL ATP-BIND... 179 7e-44
gi|15921181|ref|NP_376850.1| 254aa long conserved hypothetical p... 134 4e-30
gi|15897913|ref|NP_342518.1| Conserved hypothetical protein [Sul... 122 2e-26
gi|11499791|ref|NP_071034.1| conserved hypothetical protein [Arc... 121 2e-26
gi|13540867|ref|NP_110555.1| Predicted GTPase [Thermoplasma volc... 120 7e-26
gi|46229693|gb|EAK90511.1| XPA1 binding protein-like GTpase, tra... 116 8e-25
gi|18313997|ref|NP_560664.1| conserved hypothetical protein [Pyr... 116 1e-24
gi|48852404|ref|ZP_00306591.1| COG1100: GTPase SAR1 and related ... 113 9e-24
gi|16081217|ref|NP_393516.1| conserved hypothetical protein [The... 112 1e-23
gi|46437061|gb|EAK96414.1| hypothetical protein CaO19.3130 [Cand... 108 3e-22
gi|50307779|ref|XP_453883.1| unnamed protein product [Kluyveromy... 104 3e-21
gi|48477692|ref|YP_023398.1| ATP (GTP)-binding protein [Picrophi... 103 7e-21
gi|50254375|gb|EAL17128.1| hypothetical protein CNBN2200 [Crypto... 103 7e-21
gi|45200980|ref|NP_986550.1| AGL117Cp [Eremothecium gossypii] >g... 103 9e-21
gi|14590504|ref|NP_142572.1| hypothetical protein PH0611 [Pyroco... 102 1e-20
gi|14600972|ref|NP_147498.1| hypothetical protein APE0791 [Aerop... 100 4e-20
gi|50425131|ref|XP_461157.1| unnamed protein product [Debaryomyc... 100 1e-19
gi|15242226|ref|NP_197629.1| ATP-binding family protein [Arabido... 100 1e-19
gi|18413871|ref|NP_567393.1| ATP-binding family protein [Arabido... 99 2e-19
gi|50725780|dbj|BAD33311.1| putative purine nucleotide binding p... 98 4e-19
gi|50551149|ref|XP_503048.1| hypothetical protein [Yarrowia lipo... 97 5e-19
gi|46436168|gb|EAK95535.1| hypothetical protein CaO19.3169 [Cand... 97 5e-19
gi|6323272|ref|NP_013344.1| Protein required for cell viability;... 97 6e-19
gi|46436307|gb|EAK95671.1| hypothetical protein CaO19.10678 [Can... 97 6e-19
gi|50305323|ref|XP_452621.1| unnamed protein product [Kluyveromy... 97 6e-19
gi|11498150|ref|NP_069375.1| conserved hypothetical protein [Arc... 97 8e-19
gi|14521637|ref|NP_127113.1| hypothetical protein PAB0955 [Pyroc... 97 8e-19
gi|50285741|ref|XP_445299.1| unnamed protein product [Candida gl... 97 8e-19
gi|18976856|ref|NP_578213.1| hypothetical translation elongation... 96 1e-18
gi|31207847|ref|XP_312890.1| ENSANGP00000014768 [Anopheles gambi... 96 1e-18
gi|50427015|ref|XP_462112.1| unnamed protein product [Debaryomyc... 96 1e-18
gi|50288589|ref|XP_446724.1| unnamed protein product [Candida gl... 96 1e-18
gi|32399003|emb|CAD98468.1| conserved hypothetical ATP binding p... 96 2e-18
gi|6324836|ref|NP_014905.1| Protein required for cell viability;... 95 2e-18
gi|49086660|ref|XP_405360.1| hypothetical protein AN1223.2 [Aspe... 95 3e-18
gi|37606123|emb|CAE50613.1| SI:zK83D9.3 (novel protein similar t... 94 4e-18
gi|49069138|ref|XP_398858.1| hypothetical protein UM01243.1 [Ust... 94 5e-18
gi|50549153|ref|XP_502047.1| hypothetical protein [Yarrowia lipo... 94 7e-18
gi|46106369|ref|XP_380596.1| hypothetical protein FG00420.1 [Gib... 93 9e-18
gi|45550609|ref|NP_648641.2| CG10222-PA [Drosophila melanogaster... 93 1e-17
gi|21312642|ref|NP_077178.1| RIKEN cDNA A930018B01 [Mus musculus... 93 1e-17
gi|50259997|gb|EAL22660.1| hypothetical protein CNBB1090 [Crypto... 92 3e-17
gi|19115877|ref|NP_594965.1| purine nucleotide binding protein f... 92 3e-17
gi|49067703|ref|XP_398141.1| hypothetical protein UM00526.1 [Ust... 91 3e-17
gi|47220828|emb|CAG00035.1| unnamed protein product [Tetraodon n... 91 3e-17
gi|38567175|emb|CAE76468.1| conserved hypothetical protein [Neur... 91 3e-17
gi|23613695|ref|NP_704716.1| hypothetical protein, conserved [Pl... 91 5e-17
gi|21410245|gb|AAH31024.1| Protein x 0004 [Homo sapiens] 91 5e-17
gi|42538980|ref|NP_973720.1| similar to RIKEN cDNA A930018B01 [R... 91 6e-17
gi|18071342|gb|AAL58201.1| putative ATP(GTP)-binding protein [Or... 90 1e-16
gi|26352870|dbj|BAC40065.1| unnamed protein product [Mus musculus] 90 1e-16
gi|23482169|gb|EAA18229.1| similar to unknown protein [Plasmodiu... 89 1e-16
gi|37183274|gb|AAQ89437.1| PRYA1876 [Homo sapiens] 89 1e-16
gi|7487264|pir||T06637 hypothetical protein T20K18.140 - Arabido... 89 2e-16
gi|21361523|ref|NP_057385.2| protein x 0004 [Homo sapiens] >gnl|... 89 2e-16
gi|19115580|ref|NP_594668.1| conserved hypothetical protein [Sch... 88 3e-16
gi|39587465|emb|CAE75119.1| Hypothetical protein CBG23047 [Caeno... 88 4e-16
gi|45184707|ref|NP_982425.1| AAL117Cp [Eremothecium gossypii] >g... 87 5e-16
gi|17556506|ref|NP_499587.1| atp-binding protein like (31.0 kD) ... 87 9e-16
gi|47550895|ref|NP_999966.1| hypothetical protein LOC407722 [Dan... 87 9e-16
gi|34871770|ref|XP_342933.1| similar to expressed sequence AI838... 87 9e-16
gi|33303753|gb|AAQ02390.1| hypothetical protein FLJ10349 [synthe... 86 1e-15
gi|7981259|emb|CAB92117.1| dJ50O24.2.1 (novel protein (translati... 86 1e-15
gi|40254895|ref|NP_060536.2| hypothetical protein FLJ10349 [Homo... 86 1e-15
gi|14250403|gb|AAH08634.1| Hypothetical protein FLJ10349 [Homo s... 86 1e-15
gi|46121841|ref|XP_385474.1| hypothetical protein FG05298.1 [Gib... 86 1e-15
gi|7022323|dbj|BAA91556.1| unnamed protein product [Homo sapiens] 85 2e-15
gi|25395280|pir||A87790 protein B0207.6 [imported] - Caenorhabdi... 85 2e-15
gi|25141394|ref|NP_491713.2| conserved hypothetical ATP binding ... 85 2e-15
gi|19527098|ref|NP_598645.1| expressed sequence AI838661 [Mus mu... 84 4e-15
gi|39595385|emb|CAE60423.1| Hypothetical protein CBG04029 [Caeno... 84 4e-15
gi|38101820|gb|EAA48724.1| hypothetical protein MG00382.4 [Magna... 84 7e-15
gi|27735409|gb|AAH41519.1| LOC398460 protein [Xenopus laevis] 82 2e-14
gi|31874038|emb|CAD97937.1| hypothetical protein [Homo sapiens] 81 4e-14
gi|19074476|ref|NP_585982.1| putative ATP binding protein [Encep... 80 6e-14
gi|21358191|ref|NP_649699.1| CG2656-PA [Drosophila melanogaster]... 80 8e-14
gi|6563232|gb|AAF17210.1| protein x 0004 [Homo sapiens] 79 1e-13
gi|31243133|ref|XP_322008.1| ENSANGP00000012063 [Anopheles gambi... 78 3e-13
gi|23485894|gb|EAA20628.1| Drosophila melanogaster CG2656 gene p... 78 4e-13
gi|23619421|ref|NP_705383.1| ATP binding protein, putative [Plas... 77 5e-13
gi|29248475|gb|EAA40008.1| GLP_572_37861_37058 [Giardia lamblia ... 77 9e-13
gi|13812143|ref|NP_113270.1| purine nucleotide binding protein [... 75 2e-12
gi|38106710|gb|EAA52982.1| hypothetical protein MG06110.4 [Magna... 75 2e-12
gi|50756469|ref|XP_425270.1| PREDICTED: similar to PRYA1876 [Gal... 75 3e-12
gi|32419903|ref|XP_330395.1| hypothetical protein [Neurospora cr... 73 1e-11
gi|47210825|emb|CAF90882.1| unnamed protein product [Tetraodon n... 68 4e-10
gi|29246786|gb|EAA38370.1| GLP_375_24471_25223 [Giardia lamblia ... 59 1e-07
gi|49090012|ref|XP_406575.1| hypothetical protein AN2438.2 [Aspe... 56 1e-06
gi|19074380|ref|NP_585886.1| similarity to HYPOTHETICAL PROTEIN ... 51 5e-05
gi|32422827|ref|XP_331857.1| hypothetical protein [Neurospora cr... 47 0.001
gi|13541284|ref|NP_110972.1| Translation initiation factor IF-2 ... 44 0.005
gi|13812334|ref|NP_113452.1| hypothetical protein [Guillardia th... 44 0.006
gi|46916990|emb|CAG23752.1| hypothetical ferrous ion transport p... 42 0.024
gi|22970349|ref|ZP_00017447.1| hypothetical protein [Chloroflexu... 41 0.041
gi|48837569|ref|ZP_00294543.1| COG0532: Translation initiation f... 40 0.070
gi|32398799|emb|CAD98509.1| putative translation initiation fact... 40 0.12
gi|21228565|ref|NP_634487.1| protein translation initiation fact... 40 0.12
gi|46229287|gb|EAK90136.1| Fun12p GTpase; translation initiation... 40 0.12
gi|22974546|ref|ZP_00020763.1| hypothetical protein [Chloroflexu... 39 0.20
gi|46437889|gb|EAK97228.1| hypothetical protein CaO19.6387 [Cand... 38 0.46
gi|20090384|ref|NP_616459.1| translation initiation factor If2 [... 38 0.46
gi|46437803|gb|EAK97143.1| hypothetical protein CaO19.13747 [Can... 38 0.46
gi|14335456|gb|AAK60626.1| heat shock protein Hsp104 [Candida al... 38 0.46
gi|14335454|gb|AAK60625.1| heat shock protein Hsp104 [Candida al... 38 0.46
gi|49084150|ref|XP_404298.1| hypothetical protein AN0161.2 [Aspe... 37 0.78
gi|48839217|ref|ZP_00296151.1| COG1084: Predicted GTPase [Methan... 37 0.78
gi|46123941|ref|XP_386524.1| hypothetical protein FG06348.1 [Gib... 37 1.0
gi|32410955|ref|XP_325958.1| hypothetical protein [Neurospora cr... 36 1.3
gi|34395610|sp|O05560|FTSK_MYCLE DNA translocase ftsK 36 1.7
gi|34557761|ref|NP_907576.1| PUTATIVE FERROUS IRON TRANSPORT PRO... 36 1.7
gi|15827463|ref|NP_301726.1| Cell division protein [Mycobacteriu... 36 1.7
gi|50291855|ref|XP_448360.1| unnamed protein product [Candida gl... 36 1.7
gi|23127765|ref|ZP_00109628.1| COG1132: ABC-type multidrug trans... 36 1.7
gi|50365296|ref|YP_053721.1| signal recognition particle (signal... 36 1.7
gi|15639566|ref|NP_219016.1| cell division protein (ftsY) [Trepo... 35 2.3
gi|13541271|ref|NP_110959.1| Predicted ATPase (PilT family) [The... 35 2.3
gi|1709326|sp|P52978|NODQ_RHITR NodQ bifunctional enzyme (Nodula... 35 2.3
gi|50309043|ref|XP_454527.1| unnamed protein product [Kluyveromy... 35 2.3
gi|47572425|ref|ZP_00242469.1| COG1703: Putative periplasmic pro... 35 3.0
gi|31544492|ref|NP_853070.1| Ffh [Mycoplasma gallisepticum R] >g... 35 3.0
gi|50557436|ref|XP_502350.1| hypothetical protein [Yarrowia lipo... 35 3.9
gi|10177528|dbj|BAB10923.1| GTP-binding protein-like [Arabidopsi... 35 3.9
gi|48858096|ref|ZP_00312062.1| COG0572: Uridine kinase [Clostrid... 35 3.9
gi|22328152|ref|NP_201448.2| expressed protein [Arabidopsis thal... 35 3.9
gi|15672169|ref|NP_266343.1| ferrous ion transport protein B [La... 35 3.9
gi|45916220|ref|ZP_00195093.2| COG0523: Putative GTPases (G3E fa... 35 3.9
gi|16081452|ref|NP_393796.1| conserved hypothetical protein [The... 34 5.0
gi|46121235|ref|XP_385172.1| hypothetical protein FG04996.1 [Gib... 34 5.0
gi|38104761|gb|EAA51282.1| hypothetical protein MG08804.4 [Magna... 34 5.0
gi|23509141|ref|NP_701809.1| hypothetical protein [Plasmodium fa... 34 5.0
gi|24379050|ref|NP_721005.1| putative ferrous ion transport prot... 34 5.0
gi|15603975|ref|NP_220490.1| POSSIBLE RIBONUCLEOTIDE TRANSPORT A... 34 5.0
gi|49097736|ref|XP_410328.1| hypothetical protein AN6191.2 [Aspe... 34 6.6
gi|29249770|gb|EAA41275.1| GLP_190_29164_27251 [Giardia lamblia ... 34 6.6
gi|45200836|ref|NP_986406.1| AGL261Wp [Eremothecium gossypii] >g... 34 6.6
gi|20808197|ref|NP_623368.1| Uridine kinase [Thermoanaerobacter ... 34 6.6
gi|46579253|ref|YP_010061.1| signal recognition particle protein... 34 6.6
gi|46434105|gb|EAK93524.1| hypothetical protein CaO19.14193 [Can... 34 6.6
gi|401118|sp|Q01442|SR54_MYCMY SIGNAL RECOGNITION PARTICLE PROTE... 34 6.6
gi|42560958|ref|NP_975409.1| Signal recognition particle M54 pro... 34 6.6
gi|15828858|ref|NP_326218.1| ABC TRANSPORTER ATP-BINDING PROTEIN... 34 6.6
gi|15643514|ref|NP_228560.1| uridine kinase-related protein [The... 34 6.6
gi|29347937|ref|NP_811440.1| uridine kinase (uridine monophospho... 34 6.6
gi|32470644|gb|AAP45170.1| putative nuclear WD protein [Solanum ... 33 8.6
gi|46314515|ref|ZP_00215101.1| COG0606: Predicted ATPase with ch... 33 8.6
gi|32452626|gb|AAP43988.1| TadA [Actinobacillus actinomycetemcom... 33 8.6
gi|50421881|ref|XP_459498.1| unnamed protein product [Debaryomyc... 33 8.6
gi|13475420|ref|NP_106984.1| secretory protein kinase [Mesorhizo... 33 8.6
gi|23113124|ref|ZP_00098528.1| COG0572: Uridine kinase [Desulfit... 33 8.6
gi|50553206|ref|XP_504013.1| hypothetical protein [Yarrowia lipo... 33 8.6
>gi|17552462|ref|NP_498118.1| ATP/GTP binding protein, Gro-1 OPeron
gene GOP-2 (39.7 kD) (gop-2) [Caenorhabditis elegans]
gi|1176528|sp|P46577|GOP2_CAEEL Gro-1 operon protein 2
gi|7497018|pir||T15759 hypothetical protein C34E10.2 - Caenorhabditis
elegans
gi|500725|gb|AAA19064.1| Gro-1 operon gene protein 2 [Caenorhabditis
elegans]
gi|16209584|gb|AAL14109.1| GOP-2 [Caenorhabditis elegans]
Length = 355
Score = 600 bits (1548), Expect = e-170
Identities = 306/343 (89%), Positives = 306/343 (89%)
Frame = +1
Query: 1 MAEKAENLXXXXXXXXXXXXXQTGPNVNQKPSILVLGMAGSGKTTFVQRLTAFLHARKTP 180
MAEKAENL QTGPNVNQKPSILVLGMAGSGKTTFVQRLTAFLHARKTP
Sbjct: 1 MAEKAENLPSSSAEASEEPSPQTGPNVNQKPSILVLGMAGSGKTTFVQRLTAFLHARKTP 60
Query: 181 PYVINLDPAVSKVPYPVNVDIRDTVKYKEVMKEFGMGPNGAIMTCLNLMCTRFDKVIELI 360
PYVINLDPAVSKVPYPVNVDIRDTVKYKEVMKEFGMGPNGAIMTCLNLMCTRFDKVIELI
Sbjct: 61 PYVINLDPAVSKVPYPVNVDIRDTVKYKEVMKEFGMGPNGAIMTCLNLMCTRFDKVIELI 120
Query: 361 NKRSSDFSVCLLDTPGQIEAFTWSASGSIITDSLASSHPTVVMYIVDSARATNPTTFMSN 540
NKRSSDFSVCLLDTPGQIEAFTWSASGSIITDSLASSHPTVVMYIVDSARATNPTTFMSN
Sbjct: 121 NKRSSDFSVCLLDTPGQIEAFTWSASGSIITDSLASSHPTVVMYIVDSARATNPTTFMSN 180
Query: 541 MLYACSILYRTKLPFIVVFNKADIVKPTFALKWMQDFERFDEALEDARSSYMNDLSRSLS 720
MLYACSILYRTKLPFIVVFNKADIVKPTFALKWMQDFERFDEALEDARSSYMNDLSRSLS
Sbjct: 181 MLYACSILYRTKLPFIVVFNKADIVKPTFALKWMQDFERFDEALEDARSSYMNDLSRSLS 240
Query: 721 LVLDEFYCGLKTVCVSSATGEGFEDVMTAIDESVEAYKKEYVPMYXXXXXXXXXXXXXXX 900
LVLDEFYCGLKTVCVSSATGEGFEDVMTAIDESVEAYKKEYVPMY
Sbjct: 241 LVLDEFYCGLKTVCVSSATGEGFEDVMTAIDESVEAYKKEYVPMYEKVLAEKKLLDEEER 300
Query: 901 XXXXXXXXXGKAVHDLNKVANPDEFLESELNSKIDRIHLGGVD 1029
GKAVHDLNKVANPDEFLESELNSKIDRIHLGGVD
Sbjct: 301 KKRDEETLKGKAVHDLNKVANPDEFLESELNSKIDRIHLGGVD 343