Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C34F11_1
(384 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535301|ref|NP_494970.1| major Sperm Protein MSP-49, major S... 268 1e-71
gi|17535289|ref|NP_494898.1| major Sperm Protein MSP-31, major S... 266 5e-71
gi|17542416|ref|NP_501742.1| major Sperm Protein MSP-78, Major S... 266 7e-71
gi|17543834|ref|NP_501464.1| major Sperm Protein (4J335) [Caenor... 265 1e-70
gi|17535285|ref|NP_494858.1| major Sperm Protein MSP-3, major Sp... 265 1e-70
gi|17535293|ref|NP_494888.1| major Sperm Protein MSP-33, major S... 265 2e-70
gi|17535313|ref|NP_494901.1| major Sperm Protein MSP-152, major ... 265 2e-70
gi|17541646|ref|NP_501781.1| major Sperm Protein MSP-77, Major S... 265 2e-70
gi|17543816|ref|NP_500755.1| major Sperm Protein (14.5 kD) (4G15... 265 2e-70
gi|21730213|pdb|1GRW|A Chain A, C. Elegans Major Sperm Protein >... 265 2e-70
gi|17535305|ref|NP_495143.1| major Sperm Protein MSP-63, major S... 263 5e-70
gi|17537885|ref|NP_494906.1| predicted CDS, major Sperm Protein ... 263 6e-70
gi|17541634|ref|NP_500711.1| major Sperm Protein MSP-55, Major S... 263 6e-70
gi|17541624|ref|NP_501760.1| major Sperm Protein MSP-10, Major S... 262 1e-69
gi|39589839|emb|CAE60837.1| Hypothetical protein CBG04546 [Caeno... 262 1e-69
gi|39590724|emb|CAE65094.1| Hypothetical protein CBG09953 [Caeno... 261 2e-69
gi|17541380|ref|NP_501849.1| major Sperm Protein MSP-38, Major S... 261 2e-69
gi|156378|gb|AAA28116.1| major sperm protein 260 4e-69
gi|156376|gb|AAA28115.1| major sperm protein 260 4e-69
gi|39596870|emb|CAE59097.1| Hypothetical protein CBG02389 [Caeno... 259 7e-69
gi|39597263|emb|CAE59491.1| Hypothetical protein CBG02876 [Caeno... 259 7e-69
gi|39592203|emb|CAE75424.1| Hypothetical protein CBG23417 [Caeno... 257 3e-68
gi|39596998|emb|CAE59225.1| Hypothetical protein CBG02544 [Caeno... 256 1e-67
gi|17535291|ref|NP_494891.1| predicted CDS, major Sperm Protein ... 249 9e-66
gi|127353|sp|P13263|MSP2_ONCVO Major sperm protein 2 (MSP2) >gnl... 232 1e-60
gi|3183538|sp|P27440|MSP2_ASCSU Major sperm protein, isoform bet... 232 1e-60
gi|127350|sp|P13262|MSP1_ONCVO Major sperm protein 1 (MSP1) >gnl... 230 4e-60
gi|42627274|emb|CAF29504.1| major sperm protein [Oesophagostomum... 230 4e-60
gi|42627270|emb|CAF29502.1| major sperm protein [Oesophagostomum... 229 1e-59
gi|42627268|emb|CAF29501.1| major sperm protein [Oesophagostomum... 228 3e-59
gi|2506876|sp|P27439|MSP1_ASCSU Major sperm protein, isoform alp... 226 8e-59
gi|42627276|emb|CAF29505.1| major sperm protein [Oesophagostomum... 226 8e-59
gi|1942980|pdb|1MSP|A Chain A, Major Sperm Protein, Alpha Isofor... 224 3e-58
gi|255455|gb|AAB23264.1| major sperm protein alpha isoform, alph... 221 2e-57
gi|3114299|pdb|2MSP|A Chain A, Major Sperm Protein, Beta Isoform... 221 2e-57
gi|39589838|emb|CAE60836.1| Hypothetical protein CBG04545 [Caeno... 221 3e-57
gi|39589556|emb|CAE66791.1| Hypothetical protein CBG12151 [Caeno... 218 2e-56
gi|39597192|emb|CAE59419.1| Hypothetical protein CBG02788 [Caeno... 209 1e-53
gi|12055875|emb|CAC20742.1| major sperm protein [Onchocerca volv... 195 2e-49
gi|12055873|emb|CAC20741.1| major sperm protein [Onchocerca volv... 194 3e-49
gi|12055879|emb|CAC20709.1| major sperm protein [Mansonella ozza... 193 8e-49
gi|12055871|emb|CAC20740.1| major sperm protein [Onchocerca volv... 192 1e-48
gi|12055867|emb|CAC20738.1| major sperm protein [Onchocerca volv... 192 1e-48
gi|12055899|emb|CAC20719.1| major sperm protein [Mansonella ozza... 192 2e-48
gi|12055895|emb|CAC20717.1| major sperm protein [Mansonella ozza... 191 3e-48
gi|12055887|emb|CAC20713.1| major sperm protein [Mansonella ozza... 191 3e-48
gi|12055877|emb|CAC20708.1| major sperm protein [Mansonella ozza... 191 4e-48
gi|12055869|emb|CAC20739.1| major sperm protein [Onchocerca volv... 190 6e-48
gi|12055891|emb|CAC20715.1| major sperm protein [Mansonella ozza... 190 6e-48
gi|12055907|emb|CAC20723.1| major sperm protein [Mansonella ozza... 189 8e-48
gi|12055893|emb|CAC20716.1| major sperm protein [Mansonella ozza... 189 8e-48
gi|12055905|emb|CAC20722.1| major sperm protein [Mansonella ozza... 189 1e-47
gi|39585146|emb|CAE57389.1| Hypothetical protein CBG00337 [Caeno... 165 2e-46
gi|39590722|emb|CAE65092.1| Hypothetical protein CBG09951 [Caeno... 166 4e-43
gi|1709138|sp|P53022|MSP2_GLORO Major sperm protein 2 >gnl|BL_OR... 171 4e-42
gi|17544364|ref|NP_502908.1| major Sperm Protein family member (... 170 5e-42
gi|17541610|ref|NP_502824.1| major Sperm Protein family member (... 170 5e-42
gi|1709136|sp|P53021|MSP1_GLORO Major sperm protein 1 >gnl|BL_OR... 168 3e-41
gi|1709139|sp|P53023|MSP3_GLORO Major sperm protein 3 >gnl|BL_OR... 166 8e-41
gi|17534493|ref|NP_494960.1| major Sperm Protein (8.7 kD) (2F448... 166 8e-41
gi|451224|gb|AAB27962.1| diagnostic antigen [Dictyocaulus vivipa... 108 6e-37
gi|39593483|emb|CAE61775.1| Hypothetical protein CBG05735 [Caeno... 143 9e-34
gi|17544384|ref|NP_502992.1| predicted CDS, major Sperm Protein ... 141 3e-33
gi|17544392|ref|NP_502995.1| major Sperm Protein (4R769) [Caenor... 141 3e-33
gi|1373359|gb|AAB02251.1| major sperm protein 140 4e-33
gi|17538101|ref|NP_495165.1| major Sperm Protein family member (... 136 1e-31
gi|1373308|gb|AAB02239.1| major sperm protein >gnl|BL_ORD_ID|869... 134 5e-31
gi|39583946|emb|CAE64036.1| Hypothetical protein CBG08633 [Caeno... 132 2e-30
gi|1373357|gb|AAB02250.1| major sperm protein 130 8e-30
gi|1373312|gb|AAB02241.1| major sperm protein 122 2e-27
gi|17565914|ref|NP_506636.1| predicted CDS, major Sperm Protein ... 122 2e-27
gi|1373355|gb|AAB02249.1| major sperm protein 120 5e-27
gi|1373314|gb|AAB02242.1| major sperm protein 116 1e-25
gi|39589548|emb|CAE66783.1| Hypothetical protein CBG12140 [Caeno... 98 4e-20
gi|39579270|emb|CAE56957.1| Hypothetical protein CBG24807 [Caeno... 97 6e-20
gi|17539072|ref|NP_502434.1| major Sperm Protein family member (... 86 1e-16
gi|39587522|emb|CAE58460.1| Hypothetical protein CBG01600 [Caeno... 85 4e-16
gi|39594774|emb|CAE70642.1| Hypothetical protein CBG17343 [Caeno... 82 3e-15
gi|39593170|emb|CAE64639.1| Hypothetical protein CBG09401 [Caeno... 75 4e-13
gi|39585546|emb|CAE65306.1| Hypothetical protein CBG10225 [Caeno... 69 2e-11
gi|2499127|sp|Q16943|VP33_APLCA Vesicle-associated membrane prot... 54 6e-07
gi|29841172|gb|AAP06185.1| similar to GenBank Accession Number U... 52 4e-06
gi|39595297|emb|CAE60334.1| Hypothetical protein CBG03926 [Caeno... 50 1e-05
gi|48138819|ref|XP_393426.1| similar to vesicle-associated membr... 50 1e-05
gi|42734418|ref|NP_956212.2| Unknown (protein for MGC:65776); wu... 47 9e-05
gi|38303797|gb|AAH61951.1| Zgc:77382 protein [Danio rerio] 47 9e-05
gi|8099350|gb|AAF72105.1| 33 kDa Vamp-associated protein [Homo s... 46 2e-04
gi|3320446|gb|AAC26508.1| VAMP-associated protein of 33 kDa [Hom... 46 2e-04
gi|37588850|ref|NP_919415.1| vesicle-associated membrane protein... 46 2e-04
gi|37588848|ref|NP_003565.3| vesicle-associated membrane protein... 46 2e-04
gi|13928870|ref|NP_113819.1| vesicle-associated membrane protein... 45 4e-04
gi|38197359|gb|AAH61875.1| Unknown (protein for MGC:72396) [Ratt... 45 4e-04
gi|7305623|ref|NP_038961.1| vesicle-associated membrane protein,... 44 6e-04
gi|6671046|gb|AAF23076.1| VAMP-associated protein 33a [Mus muscu... 44 6e-04
gi|27674169|ref|XP_228394.1| similar to vessicle-associated memb... 44 7e-04
gi|17538762|ref|NP_501084.1| putative protein (4H777) [Caenorhab... 44 7e-04
gi|50540158|ref|NP_001002546.1| zgc:92788 [Danio rerio] >gnl|BL_... 44 0.001
gi|38083597|ref|XP_128948.2| RIKEN cDNA 2010013H21 [Mus musculus] 44 0.001
gi|12842294|dbj|BAB25547.1| unnamed protein product [Mus musculus] 44 0.001
gi|26345712|dbj|BAC36507.1| unnamed protein product [Mus musculus] 43 0.002
gi|47223045|emb|CAG07132.1| unnamed protein product [Tetraodon n... 42 0.003
gi|45360485|ref|NP_988905.1| hypothetical protein MGC76271 [Xeno... 40 0.008
gi|1373413|gb|AAB02262.1| Ppmsp-4 40 0.011
gi|7677066|gb|AAF67013.1| VAMP-associated 33 kDa protein [Homo s... 40 0.014
gi|49328137|gb|AAT58835.1| 'unknown protein, contains major sper... 40 0.014
gi|27371213|gb|AAH41550.1| MGC53868 protein [Xenopus laevis] 39 0.031
gi|47086745|ref|NP_997812.1| vesicle-associated membrane protein... 38 0.041
gi|31543940|ref|NP_062780.2| vesicle-associated membrane protein... 38 0.041
gi|11177880|ref|NP_068619.1| VAMP-associated protein B; vesicle-... 38 0.041
gi|24638341|sp|Q9QY76|VAPB_MOUSE Vesicle-associated membrane pro... 38 0.054
gi|17507123|ref|NP_491704.1| VAMP-associated protein (26.9 kD) (... 37 0.070
gi|47220459|emb|CAG03239.1| unnamed protein product [Tetraodon n... 37 0.091
gi|39595373|emb|CAE60411.1| Hypothetical protein CBG04017 [Caeno... 36 0.16
gi|33328907|gb|AAQ09860.1| CG7919 [Drosophila yakuba] 35 0.27
gi|50762142|ref|XP_424948.1| PREDICTED: similar to inhibitor of ... 35 0.35
gi|17510227|ref|NP_493034.1| heat shock factor 2 (1M562) [Caenor... 33 1.3
gi|27380234|ref|NP_771763.1| two-component response regulator [B... 33 1.7
gi|46314906|ref|ZP_00215490.1| COG3938: Proline racemase [Burkho... 33 1.7
gi|11994635|dbj|BAB02787.1| unnamed protein product [Arabidopsis... 32 2.2
gi|29247880|gb|EAA39429.1| GLP_762_1744_6912 [Giardia lamblia AT... 32 2.2
gi|15232143|ref|NP_189369.1| zinc finger (C3HC4-type RING finger... 32 2.2
gi|1373417|gb|AAB02264.1| Ppmsp-6 32 2.2
gi|47155039|emb|CAE85238.1| hypothetical protein [Escherichia coli] 32 2.2
gi|42761338|dbj|BAD11591.1| 27k vesicle-associated membrane prot... 32 2.2
gi|16127790|ref|NP_422354.1| response regulator/sensor histidine... 32 2.9
gi|29561775|emb|CAD87780.1| SI:dZ258D18.1 (novel protein similar... 32 2.9
gi|45533220|ref|ZP_00184212.1| hypothetical protein Exigu020377 ... 32 2.9
gi|34901800|ref|NP_912246.1| hypothetical protein [Oryza sativa ... 32 2.9
gi|38102501|gb|EAA49335.1| hypothetical protein MG00993.4 [Magna... 32 2.9
gi|39842108|gb|AAR31652.1| UL102 [Human herpesvirus 5] 32 3.8
gi|28373240|ref|NP_783791.1| UL102 [Human herpesvirus 5] >gnl|BL... 32 3.8
gi|44903309|gb|AAS48988.1| UL102 [Human herpesvirus 5] 32 3.8
gi|136996|sp|P16827|HEPA_HCMVA DNA HELICASE/PRIMASE COMPLEX ASSO... 32 3.8
gi|603227|gb|AAA67889.1| UL102 protein 31 5.0
gi|38345482|emb|CAE01696.2| OSJNBa0010H02.20 [Oryza sativa (japo... 31 5.0
gi|15238034|ref|NP_199529.1| vesicle-associated membrane family ... 31 5.0
gi|19552739|ref|NP_600741.1| ABC-type transporter, ATPase compon... 31 5.0
gi|15642513|ref|NP_232146.1| conserved hypothetical protein [Vib... 31 5.0
gi|37536644|ref|NP_922624.1| putative membrane protein [Oryza sa... 31 5.0
gi|34907216|ref|NP_914955.1| P0504E02.2 [Oryza sativa (japonica ... 31 5.0
gi|18415696|ref|NP_567627.1| vesicle-associated membrane family ... 31 6.5
gi|41017498|sp|Q8WNM1|PGHD_GORGO Prostaglandin-H2 D-isomerase pr... 31 6.5
gi|14140121|emb|CAC39038.1| putative vesicle-associated membrane... 31 6.5
gi|49387510|dbj|BAD24975.1| putative vesicle-associated membrane... 31 6.5
gi|48095982|ref|XP_394578.1| similar to ENSANGP00000020300 [Apis... 31 6.5
gi|46321091|ref|ZP_00221471.1| COG0611: Thiamine monophosphate k... 31 6.5
gi|42572975|ref|NP_974584.1| vesicle-associated membrane family ... 31 6.5
gi|13475700|ref|NP_107267.1| hypothetical protein mll6838 [Mesor... 30 8.5
>gi|17535301|ref|NP_494970.1| major Sperm Protein MSP-49, major
Sperm Protein (14.2 kD) (msp-49) [Caenorhabditis
elegans]
gi|24638044|sp|Q18461|MS49_CAEEL Major sperm protein 49 (MSP)
gi|25344638|pir||F88146 protein C34F11.6 [imported] -
Caenorhabditis elegans
gi|1166625|gb|AAA85759.1| Major sperm protein protein 49
[Caenorhabditis elegans]
Length = 127
Score = 268 bits (686), Expect = 1e-71
Identities = 127/127 (100%), Positives = 127/127 (100%)
Frame = +1
Query: 1 MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTINMKRLGVDPPC 180
MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTINMKRLGVDPPC
Sbjct: 1 MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTINMKRLGVDPPC 60
Query: 181 GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN 360
GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN
Sbjct: 61 GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN 120
Query: 361 LPIEYNP 381
LPIEYNP
Sbjct: 121 LPIEYNP 127