Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C34F11_8
(681 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532309|ref|NP_494977.1| RING zinc finger containing protein... 442 e-123
gi|17509243|ref|NP_492633.1| apoptosis regulator like family mem... 84 3e-15
gi|25150760|ref|NP_502431.2| putative mitochondrial protein fami... 84 3e-15
gi|39595215|emb|CAE60252.1| Hypothetical protein CBG03826 [Caeno... 70 3e-11
gi|7508383|pir||T25234 hypothetical protein T24D1.2 - Caenorhabd... 69 9e-11
gi|17540996|ref|NP_502665.1| putative nuclear protein, with a co... 69 1e-10
gi|17509247|ref|NP_492632.1| putative nuclear protein family mem... 68 1e-10
gi|39595216|emb|CAE60253.1| Hypothetical protein CBG03827 [Caeno... 68 2e-10
gi|17509241|ref|NP_492631.1| putative nuclear protein family mem... 60 4e-08
gi|31242297|ref|XP_321579.1| ENSANGP00000012253 [Anopheles gambi... 56 8e-07
gi|31208271|ref|XP_313102.1| ENSANGP00000012890 [Anopheles gambi... 45 0.001
gi|28829862|gb|AAL96747.2| similar to Plasmodium falciparum. Hyp... 45 0.002
gi|31242301|ref|XP_321581.1| ENSANGP00000011726 [Anopheles gambi... 44 0.003
gi|32411817|ref|XP_326389.1| hypothetical protein [Neurospora cr... 43 0.007
gi|39586215|emb|CAE66626.1| Hypothetical protein CBG11962 [Caeno... 43 0.007
gi|48137851|ref|XP_396821.1| similar to RIKEN cDNA 1110032A10 [A... 43 0.007
gi|38099493|gb|EAA46832.1| hypothetical protein MG10526.4 [Magna... 42 0.009
gi|4240285|dbj|BAA74921.1| KIAA0898 protein [Homo sapiens] 42 0.015
gi|23271192|gb|AAH36012.1| TRIM37 protein [Homo sapiens] 42 0.015
gi|15147333|ref|NP_056109.1| tripartite motif-containing 37; MUL... 42 0.015
gi|17221827|gb|AAL36460.1| POB1 [Homo sapiens] 42 0.015
gi|37574064|ref|NP_932104.1| tripartite motif protein 37 [Mus mu... 42 0.015
gi|50758336|ref|XP_415872.1| PREDICTED: similar to POB1 [Gallus ... 42 0.015
gi|15451335|dbj|BAB64471.1| hypothetical protein [Macaca fascicu... 42 0.015
gi|46120908|ref|XP_385124.1| hypothetical protein FG04948.1 [Gib... 42 0.015
gi|47222293|emb|CAG05042.1| unnamed protein product [Tetraodon n... 41 0.019
gi|47678325|emb|CAG30283.1| bK175E3.6 [Homo sapiens] 41 0.025
gi|13195721|dbj|BAB33319.1| KIAA1133 protein [Homo sapiens] 41 0.025
gi|18204309|gb|AAH21570.1| Unknown (protein for IMAGE:4125718) [... 41 0.025
gi|37563752|ref|XP_290972.2| novel C3HC4 type Zinc finger (ring ... 41 0.025
gi|50305763|ref|XP_452842.1| unnamed protein product [Kluyveromy... 40 0.033
gi|50750724|ref|XP_422114.1| PREDICTED: similar to rhysin 2; B-l... 40 0.033
gi|9506663|ref|NP_061935.1| hypothetical protein FLJ20225 [Homo ... 40 0.033
gi|46195909|gb|AAS80344.1| Hypothetical protein F10D7.5a [Caenor... 40 0.043
gi|46195911|gb|AAS80346.1| Hypothetical protein F10D7.5c [Caenor... 40 0.043
gi|7498826|pir||T16028 hypothetical protein F10D7.5 - Caenorhabd... 40 0.043
gi|25152902|ref|NP_741949.1| neuralized (XR998) [Caenorhabditis ... 40 0.043
gi|25152889|ref|NP_510818.2| neuralized, possibly N-myristoylate... 40 0.043
gi|6323904|ref|NP_013975.1| Hypothetical ORF; Ymr247cp [Saccharo... 40 0.056
gi|736313|emb|CAA88657.1| unknown [Saccharomyces cerevisiae] 40 0.056
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa... 39 0.073
gi|50423053|ref|XP_460105.1| unnamed protein product [Debaryomyc... 39 0.073
gi|30686999|ref|NP_850628.1| zinc finger (C3HC4-type RING finger... 39 0.096
gi|7939538|dbj|BAA95741.1| unnamed protein product [Arabidopsis ... 39 0.096
gi|18403707|ref|NP_566724.1| zinc finger (C3HC4-type RING finger... 39 0.096
gi|21593715|gb|AAM65682.1| unknown [Arabidopsis thaliana] 39 0.096
gi|39590842|emb|CAE65215.1| Hypothetical protein CBG10090 [Caeno... 39 0.12
gi|41351076|gb|AAH65891.1| LOC402959 protein [Danio rerio] 39 0.12
gi|38091555|ref|XP_356529.1| similar to KIAA1133 protein [Mus mu... 39 0.12
gi|45185172|ref|NP_982889.1| ABL058Cp [Eremothecium gossypii] >g... 39 0.12
gi|49089986|ref|XP_406565.1| hypothetical protein AN2428.2 [Aspe... 38 0.16
gi|31241259|ref|XP_321060.1| ENSANGP00000007854 [Anopheles gambi... 38 0.21
gi|50554083|ref|XP_504450.1| hypothetical protein [Yarrowia lipo... 38 0.21
gi|27660717|ref|XP_219011.1| similar to 52kD Ro/SSA autoantigen ... 38 0.21
gi|15241188|ref|NP_200445.1| zinc finger (C3HC4-type RING finger... 37 0.36
gi|50288961|ref|XP_446910.1| unnamed protein product [Candida gl... 37 0.36
gi|19112796|ref|NP_596004.1| hypothetical zinc finger protein [S... 37 0.47
gi|7707279|dbj|BAA95211.1| infected cell protein 0 [Canine herpe... 37 0.47
gi|50257919|gb|EAL20617.1| hypothetical protein CNBE3250 [Crypto... 37 0.47
gi|50422191|ref|XP_459658.1| unnamed protein product [Debaryomyc... 37 0.47
gi|46431800|gb|EAK91327.1| hypothetical protein CaO19.8806 [Cand... 37 0.47
gi|46431786|gb|EAK91314.1| hypothetical protein CaO19.1217 [Cand... 37 0.47
gi|39592530|emb|CAE63607.1| Hypothetical protein CBG08098 [Caeno... 36 0.62
gi|15221863|ref|NP_173313.1| zinc finger (C3HC4-type RING finger... 36 0.81
gi|15237191|ref|NP_200649.1| expressed protein [Arabidopsis thal... 36 0.81
gi|34222692|sp|Q24746|NEUR_DROVI Neuralized protein >gnl|BL_ORD_... 35 1.1
gi|28828757|gb|AAO51352.1| similar to Dictyostelium discoideum (... 35 1.1
gi|46108330|ref|XP_381223.1| hypothetical protein FG01047.1 [Gib... 35 1.1
gi|22749269|ref|NP_689833.1| ring finger protein 129 [Homo sapie... 35 1.4
gi|11357958|pir||T46025 hypothetical protein T10K17.240 - Arabid... 35 1.4
gi|50545415|ref|XP_500245.1| hypothetical protein [Yarrowia lipo... 35 1.4
gi|44889983|emb|CAF32101.1| zinc finger protein, putative [Asper... 35 1.4
gi|40255016|ref|NP_612405.2| hypothetical protein BC009489 [Homo... 35 1.4
gi|19074333|ref|NP_585839.1| hypothetical protein [Encephalitozo... 35 1.4
gi|17567751|ref|NP_510530.1| predicted CDS, c-terminal -finger l... 35 1.4
gi|29791835|gb|AAH50397.1| LOC92979 protein [Homo sapiens] 35 1.4
gi|23507876|ref|NP_700546.1| hypothetical protein [Plasmodium fa... 35 1.4
gi|22331846|ref|NP_191362.2| zinc finger (C3HC4-type RING finger... 35 1.4
gi|34899152|ref|NP_910922.1| RNA-binding protein-like~contains E... 35 1.4
gi|45185334|ref|NP_983051.1| ABR104Wp [Eremothecium gossypii] >g... 35 1.4
gi|50756553|ref|XP_415210.1| PREDICTED: similar to KIAA1133 prot... 35 1.4
gi|22325409|ref|NP_671763.1| zinc finger (C3HC4-type RING finger... 35 1.4
gi|38090991|ref|XP_125947.2| hypothetical protein XP_125947 [Mus... 35 1.4
gi|46434554|gb|EAK93960.1| hypothetical protein CaO19.719 [Candi... 35 1.8
gi|31223169|ref|XP_317272.1| ENSANGP00000021962 [Anopheles gambi... 35 1.8
gi|486788|pir||S35371 finger protein neuralized - fruit fly (Dro... 35 1.8
gi|20151897|gb|AAM11308.1| SD01201p [Drosophila melanogaster] 35 1.8
gi|24666814|ref|NP_730427.1| CG32210-PA [Drosophila melanogaster... 35 1.8
gi|9758562|dbj|BAB09063.1| cellulose synthase catalytic subunit-... 35 1.8
gi|46434579|gb|EAK93984.1| hypothetical protein CaO19.8338 [Cand... 35 1.8
gi|49067875|ref|XP_398227.1| hypothetical protein UM00612.1 [Ust... 35 1.8
gi|50754173|ref|XP_414271.1| PREDICTED: similar to TRAF-interact... 35 1.8
gi|38080024|ref|XP_128374.3| zinc finger protein 294 [Mus musculus] 34 2.4
gi|27735272|sp|O94822|Z294_HUMAN Zinc finger protein 294 34 2.4
gi|47221513|emb|CAG08175.1| unnamed protein product [Tetraodon n... 34 2.4
gi|50510603|dbj|BAD32287.1| mKIAA0714 protein [Mus musculus] 34 2.4
gi|47086243|ref|NP_998061.1| hypothetical protein zgc:77828 [Dan... 34 2.4
gi|49071934|ref|XP_400256.1| hypothetical protein UM02641.1 [Ust... 34 2.4
gi|47221407|emb|CAF97325.1| unnamed protein product [Tetraodon n... 34 2.4
gi|31657111|ref|NP_056380.1| zinc finger protein 294 [Homo sapiens] 34 2.4
gi|7486103|pir||T01440 hypothetical protein F24O1.2 - Arabidopsi... 34 2.4
gi|47227119|emb|CAG00481.1| unnamed protein product [Tetraodon n... 34 2.4
gi|3882149|dbj|BAA34434.1| KIAA0714 protein [Homo sapiens] 34 2.4
gi|11125661|emb|CAB90429.3| containing human KIAA0714 protein [H... 34 2.4
gi|42408883|dbj|BAD10141.1| zinc finger protein-like [Oryza sati... 34 2.4
gi|15220761|ref|NP_176421.1| transcription factor jumonji (jmjC)... 34 2.4
gi|50729889|ref|XP_416690.1| PREDICTED: similar to Zinc finger p... 34 2.4
gi|20381305|gb|AAH27795.1| Zfp294 protein [Mus musculus] 34 2.4
gi|34867507|ref|XP_213672.2| similar to zinc finger protein 294 ... 34 2.4
gi|50758512|ref|XP_425414.1| PREDICTED: similar to ROX protein [... 32 2.6
gi|17136356|ref|NP_476652.1| CG11988-PA [Drosophila melanogaster... 34 3.1
gi|24645249|ref|NP_731311.1| CG11988-PB [Drosophila melanogaster... 34 3.1
gi|38346175|emb|CAE04093.2| OSJNBa0096F01.2 [Oryza sativa (japon... 34 3.1
gi|46441122|gb|EAL00421.1| hypothetical protein CaO19.7547 [Cand... 34 3.1
gi|15227484|ref|NP_181733.1| zinc finger (C3HC4-type RING finger... 34 3.1
gi|37535546|ref|NP_922075.1| putative zinc finger protein [Oryza... 34 3.1
gi|24645245|ref|NP_731309.1| CG11988-PD [Drosophila melanogaster... 34 3.1
gi|38082115|ref|XP_139844.3| similar to bA416N2.1 (neuralized (D... 34 3.1
gi|24645247|ref|NP_731310.1| CG11988-PC [Drosophila melanogaster... 34 3.1
gi|49079938|ref|XP_403555.1| hypothetical protein UM05940.1 [Ust... 34 3.1
gi|45758402|gb|AAS76510.1| putative AraC/XylS family transcripti... 34 3.1
gi|13242456|ref|NP_077475.1| transactivator [Cercopithecine herp... 33 4.0
gi|17510313|ref|NP_491118.1| zinc finger protein 294 (1D746) [Ca... 33 4.0
gi|27462651|gb|AAO15532.1| cellulose synthase [Arabidopsis thali... 33 4.0
gi|31199341|ref|XP_308618.1| ENSANGP00000018823 [Anopheles gambi... 33 4.0
gi|30923659|gb|EAA46136.1| CG40374-PA.3 [Drosophila melanogaster] 33 4.0
gi|24114651|ref|NP_709161.1| putative membrane protein; interfer... 33 4.0
gi|47220684|emb|CAG11753.1| unnamed protein product [Tetraodon n... 33 4.0
gi|32408427|ref|XP_324695.1| predicted protein [Neurospora crass... 33 4.0
gi|40556135|ref|NP_955220.1| CNPV197 N1R/p28-like protein [Canar... 33 4.0
gi|46227796|gb|EAK88716.1| ring domain at very C-terminus of lar... 33 4.0
gi|21593353|gb|AAM65302.1| unknown [Arabidopsis thaliana] 33 4.0
gi|18413797|ref|NP_568096.1| zinc finger (C3HC4-type RING finger... 33 4.0
gi|39598043|emb|CAE68735.1| Hypothetical protein CBG14665 [Caeno... 33 4.0
gi|9507059|ref|NP_062276.1| ring finger protein 5 [Mus musculus]... 33 4.0
gi|48059988|gb|AAF60772.3| Hypothetical protein Y54E10A.11 [Caen... 33 4.0
gi|30694433|ref|NP_199216.2| cellulose synthase, catalytic subun... 33 4.0
gi|12667358|gb|AAK01405.1| CBLC protein [Mus musculus] 33 5.2
gi|28573723|ref|NP_788406.1| CG15086-PC [Drosophila melanogaster... 33 5.2
gi|17553966|ref|NP_499375.1| RING and zinc finger protein requir... 33 5.2
gi|12805349|gb|AAH02144.1| 9530046H09Rik protein [Mus musculus] ... 33 5.2
gi|7106870|gb|AAF36160.1| HSPC240 [Homo sapiens] 33 5.2
gi|20072636|gb|AAH27221.1| Bifunctional apoptosis regulator [Mus... 33 5.2
gi|20891793|ref|XP_148088.1| similar to ring finger protein 36 [... 33 5.2
gi|31543082|ref|NP_057580.2| hypothetical protein LOC51257 [Homo... 33 5.2
gi|34877738|ref|XP_341422.1| similar to hypothetical protein FLJ... 33 5.2
gi|34862397|ref|XP_343182.1| similar to 9530046H09Rik protein [R... 33 5.2
gi|39597519|emb|CAE59749.1| Hypothetical protein CBG03194 [Caeno... 33 5.2
gi|7508322|pir||T25184 hypothetical protein T23F6.3 - Caenorhabd... 33 5.2
gi|26331438|dbj|BAC29449.1| unnamed protein product [Mus musculus] 33 5.2
gi|7505080|pir||T23197 hypothetical protein K01G5.1 - Caenorhabd... 33 5.2
gi|28573721|ref|NP_788407.1| CG15086-PD [Drosophila melanogaster... 33 5.2
gi|20130129|ref|NP_611357.1| CG15086-PA [Drosophila melanogaster... 33 5.2
gi|42734483|ref|NP_780397.2| RIKEN cDNA 2900024D24 [Mus musculus... 33 5.2
gi|19584503|emb|CAD28529.1| hypothetical protein [Homo sapiens] 33 5.2
gi|8923613|ref|NP_060393.1| hypothetical protein FLJ20668 [Homo ... 33 5.2
gi|39597073|emb|CAE59300.1| Hypothetical protein CBG02635 [Caeno... 33 5.2
gi|26354170|dbj|BAC40715.1| unnamed protein product [Mus musculus] 33 5.2
gi|16358983|gb|AAH15910.1| hypothetical protein [Homo sapiens] 33 5.2
gi|28573719|ref|NP_788405.1| CG15086-PB [Drosophila melanogaster... 33 5.2
gi|8885559|dbj|BAA97489.1| unnamed protein product [Arabidopsis ... 33 5.2
gi|26349191|dbj|BAC38235.1| unnamed protein product [Mus musculus] 33 5.2
gi|18424254|ref|NP_568910.1| zinc finger (C3HC4-type RING finger... 33 5.2
gi|50761493|ref|XP_424734.1| PREDICTED: similar to Mitogen-activ... 33 5.2
gi|26343457|dbj|BAC35385.1| unnamed protein product [Mus musculus] 33 5.2
gi|31542053|ref|NP_663461.2| RIKEN cDNA 9530046H09 [Mus musculus... 33 5.2
gi|26324536|dbj|BAC26022.1| unnamed protein product [Mus musculus] 33 5.2
gi|47223316|emb|CAF98700.1| unnamed protein product [Tetraodon n... 33 5.2
gi|13509324|emb|CAC35389.1| KIAA0298 protein [Homo sapiens] 33 6.9
gi|47940004|gb|AAH72370.1| MGC84499 protein [Xenopus laevis] 33 6.9
gi|31981243|ref|NP_075713.2| Casitas B-lineage lymphoma c [Mus m... 33 6.9
gi|30584543|gb|AAP36524.1| Homo sapiens ring finger protein 5 [s... 33 6.9
gi|17569931|ref|NP_508680.1| c-terminal -finger like family memb... 33 6.9
gi|49093896|ref|XP_408409.1| hypothetical protein AN4272.2 [Aspe... 33 6.9
gi|9625935|ref|NP_040183.1| unnamed protein product [Human herpe... 33 6.9
gi|9632157|ref|NP_048983.1| similar to Chlorella virus PBCV-1 OR... 33 6.9
gi|39586085|emb|CAE69161.1| Hypothetical protein CBG15192 [Caeno... 33 6.9
gi|49250374|gb|AAH74623.1| Unknown (protein for MGC:69265) [Xeno... 33 6.9
gi|41148760|ref|XP_209913.3| similar to ring finger protein 5 [H... 33 6.9
gi|46105104|ref|XP_380356.1| hypothetical protein FG00180.1 [Gib... 33 6.9
gi|21553849|gb|AAM62942.1| putative RING zinc finger protein [Ar... 33 6.9
gi|15224062|ref|NP_179958.1| zinc finger (C3HC4-type RING finger... 33 6.9
gi|38638060|ref|NP_943034.1| putative long-chain-fatty-acid-CoA ... 33 6.9
gi|5902054|ref|NP_008844.1| ring finger protein 5 [Homo sapiens]... 33 6.9
gi|14917060|sp|O15016|Y298_HUMAN Hypothetical protein KIAA0298 >... 33 6.9
gi|46111685|ref|XP_382900.1| hypothetical protein FG02724.1 [Gib... 33 6.9
gi|39583935|emb|CAE64025.1| Hypothetical protein CBG08620 [Caeno... 33 6.9
gi|21617980|gb|AAM67030.1| putative RING zinc finger protein [Ar... 32 8.9
gi|15224210|ref|NP_179457.1| zinc finger (C3HC4-type RING finger... 32 8.9
gi|28374186|gb|AAH46337.1| Casitas B-lineage lymphoma c [Mus mus... 32 8.9
gi|45188073|ref|NP_984296.1| ADR200Cp [Eremothecium gossypii] >g... 32 8.9
gi|47218918|emb|CAF98116.1| unnamed protein product [Tetraodon n... 32 8.9
gi|34536650|dbj|BAC87665.1| unnamed protein product [Mus musculus] 32 8.9
gi|11359853|pir||T42634 connectin/titin - chicken (fragment) >gn... 32 8.9
gi|34536210|dbj|BAC87578.1| unnamed protein product [Homo sapiens] 32 8.9
gi|15221862|ref|NP_173312.1| zinc finger (C3HC4-type RING finger... 32 8.9
gi|16975488|ref|NP_080373.1| fring; rififylin [Mus musculus] >gn... 32 8.9
gi|12838629|dbj|BAB24269.1| unnamed protein product [Mus musculus] 32 8.9
gi|20306347|gb|AAH28424.1| LOC117584 protein [Homo sapiens] 32 8.9
gi|46318005|ref|ZP_00218583.1| COG2207: AraC-type DNA-binding do... 32 8.9
gi|37362706|ref|NP_015418.2| Hypothetical ORF; Ypr093cp [Sacchar... 32 8.9
gi|21064943|gb|AAM29181.1| FYVE-RING finger protein SAKURA [Homo... 32 8.9
gi|29249656|gb|EAA41163.1| GLP_38_25174_24752 [Giardia lamblia A... 32 8.9
gi|24496502|gb|AAN60074.1| RING finger protein SAKURA [Rattus no... 32 8.9
gi|2132275|pir||S69076 hypothetical protein YPR093c - yeast (Sac... 32 8.9
gi|40226017|gb|AAH15681.2| LOC117584 protein [Homo sapiens] 32 8.9
gi|15227643|ref|NP_180545.1| zinc finger (C3HC4-type RING finger... 32 8.9
gi|34783232|gb|AAH29501.2| RNF151 protein [Homo sapiens] 32 8.9
gi|38229301|ref|NP_938394.1| 143R [Yaba monkey tumor virus] >gnl... 32 8.9
gi|39579716|emb|CAE56229.1| Hypothetical protein CBG23864 [Caeno... 32 8.9
gi|15227513|ref|NP_178400.1| zinc finger (C3HC4-type RING finger... 32 8.9
gi|17432433|ref|NP_476519.1| fring [Homo sapiens] >gnl|BL_ORD_ID... 32 8.9
gi|39579607|emb|CAE56494.1| Hypothetical protein CBG24211 [Caeno... 32 8.9
gi|42661976|ref|XP_371140.2| similar to zinc finger protein 433 ... 32 8.9
gi|17933692|ref|NP_524704.1| CG7184-PA [Drosophila melanogaster]... 32 8.9
gi|6572962|gb|AAF17486.1| makorin 1 [Drosophila melanogaster] >g... 32 8.9
gi|34535580|dbj|BAC87366.1| unnamed protein product [Homo sapiens] 32 8.9
gi|41150504|ref|XP_370927.1| hypothetical protein LOC146310 [Hom... 32 8.9
gi|29150403|gb|AAO72412.1| unknown protein [Oryza sativa (japoni... 32 8.9
gi|15221860|ref|NP_173311.1| zinc finger (C3HC4-type RING finger... 32 8.9
gi|34872908|ref|XP_340860.1| similar to RING finger protein SAKU... 32 8.9
gi|39592658|emb|CAE62272.1| Hypothetical protein CBG06331 [Caeno... 32 8.9
gi|50259922|gb|EAL22590.1| hypothetical protein CNBB4670 [Crypto... 32 8.9
gi|38101539|gb|EAA48487.1| hypothetical protein MG00145.4 [Magna... 32 8.9
>gi|17532309|ref|NP_494977.1| RING zinc finger containing protein
family member (25.3 kD) (2F503) [Caenorhabditis elegans]
gi|7497029|pir||T15774 hypothetical protein C34F11.1 -
Caenorhabditis elegans
gi|1166631|gb|AAA85765.1| Hypothetical protein C34F11.1
[Caenorhabditis elegans]
Length = 226
Score = 442 bits (1138), Expect = e-123
Identities = 214/226 (94%), Positives = 214/226 (94%)
Frame = +1
Query: 1 MSTNLNIEVSINLTEIDVNAQLAEFARFQQVRDDSRYAQDVEREFVLGPIRHHRRQLEPS 180
MSTNLNIEVSINLTEIDVNAQLAEFARFQQVRDDSRYAQDVEREFVLGPIRHHRRQLEPS
Sbjct: 1 MSTNLNIEVSINLTEIDVNAQLAEFARFQQVRDDSRYAQDVEREFVLGPIRHHRRQLEPS 60
Query: 181 RSAPLASTEQPVAQATTHPSTENARVPALVLRSGSWRALPVAQGGSSHIRIWPVXXXXXX 360
RSAPLASTEQPVAQATTHPSTENARVPALVLRSGSWRALPVAQGGSSHIRIWPV
Sbjct: 61 RSAPLASTEQPVAQATTHPSTENARVPALVLRSGSWRALPVAQGGSSHIRIWPVSRSATT 120
Query: 361 XXXXXXHPPFTNTSASTSFAPYQRHRGSALQTSECTICFEKPVDPRGCPKCLKVIGCKKC 540
HPPFTNTSASTSFAPYQRHRGSALQTSECTICFEKPVDPRGCPKCLKVIGCKKC
Sbjct: 121 TSTATRHPPFTNTSASTSFAPYQRHRGSALQTSECTICFEKPVDPRGCPKCLKVIGCKKC 180
Query: 541 VKKWFDTSASKACPLCRFEWKLHRDNPDVVKISTLEVLKRQKQNRP 678
VKKWFDTSASKACPLCRFEWKLHRDNPDVVKISTLEVLKRQKQNRP
Sbjct: 181 VKKWFDTSASKACPLCRFEWKLHRDNPDVVKISTLEVLKRQKQNRP 226