Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C34F6_2
(852 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ... 251 1e-65
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno... 226 6e-58
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 150 2e-56
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ... 218 2e-55
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno... 207 2e-52
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e... 150 4e-35
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 136 5e-31
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 135 9e-31
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno... 135 1e-30
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 125 9e-28
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno... 122 1e-26
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 121 2e-26
gi|687634|gb|AAA62504.1| collagen 120 5e-26
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ... 118 1e-25
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab... 118 1e-25
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 78 2e-25
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [... 117 2e-25
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 116 7e-25
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 116 7e-25
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 112 8e-24
gi|39579268|emb|CAE56955.1| Hypothetical protein CBG24805 [Caeno... 106 7e-22
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 104 2e-21
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [... 100 4e-20
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 97 6e-19
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 96 8e-19
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 96 8e-19
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 96 1e-18
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 96 1e-18
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 94 3e-18
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 93 6e-18
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 92 1e-17
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 92 2e-17
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 91 2e-17
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 91 3e-17
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 90 7e-17
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 87 4e-16
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 87 4e-16
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 86 1e-15
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 86 1e-15
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 86 1e-15
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 84 5e-15
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 84 5e-15
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 82 1e-14
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40 80 6e-14
gi|1813688|gb|AAC47626.1| unknown [Brugia malayi] >gnl|BL_ORD_ID... 80 6e-14
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 77 4e-13
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 77 4e-13
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 77 5e-13
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 77 6e-13
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 77 6e-13
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 76 8e-13
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 76 8e-13
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 76 1e-12
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 76 1e-12
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 76 1e-12
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 75 2e-12
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 75 2e-12
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 75 2e-12
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 74 3e-12
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 74 4e-12
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 74 5e-12
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 74 5e-12
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 73 7e-12
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 72 1e-11
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 72 2e-11
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 71 3e-11
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 71 3e-11
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl... 70 6e-11
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 68 2e-10
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 67 6e-10
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 65 2e-09
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 65 2e-09
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 65 2e-09
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 64 3e-09
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 64 5e-09
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 61 4e-08
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 60 5e-08
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 60 8e-08
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 59 1e-07
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 58 2e-07
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 57 4e-07
gi|39581447|emb|CAE74729.1| Hypothetical protein CBG22547 [Caeno... 57 4e-07
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 57 5e-07
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 57 5e-07
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 56 1e-06
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ... 56 1e-06
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 55 1e-06
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 55 3e-06
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 55 3e-06
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 55 3e-06
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 53 1e-05
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 52 1e-05
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 52 1e-05
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 52 1e-05
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 52 1e-05
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 52 1e-05
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 52 2e-05
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 52 2e-05
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 52 2e-05
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 52 2e-05
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 52 2e-05
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 51 3e-05
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 51 3e-05
gi|17535207|ref|NP_495726.1| COLlagen structural gene (col-76) [... 50 8e-05
gi|37619779|emb|CAA90258.2| C. elegans COL-76 protein (correspon... 50 8e-05
gi|17542460|ref|NP_499889.1| COLlagen structural gene (col-100) ... 49 1e-04
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 49 1e-04
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 49 1e-04
gi|39587241|emb|CAE57709.1| Hypothetical protein CBG00716 [Caeno... 49 1e-04
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 49 2e-04
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 49 2e-04
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 49 2e-04
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 49 2e-04
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 49 2e-04
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 49 2e-04
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 49 2e-04
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 48 2e-04
gi|39596084|emb|CAE69720.1| Hypothetical protein CBG15991 [Caeno... 47 4e-04
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 47 5e-04
gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD) ... 47 5e-04
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 47 5e-04
gi|1222642|emb|CAA63070.1| collagen [Brugia pahangi] 47 5e-04
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 47 7e-04
gi|39583745|emb|CAE63849.1| Hypothetical protein CBG08408 [Caeno... 47 7e-04
gi|32567349|ref|NP_872207.1| COLlagen structural gene (col-42) [... 47 7e-04
gi|39595279|emb|CAE60316.1| Hypothetical protein CBG03907 [Caeno... 47 7e-04
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 46 9e-04
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 46 9e-04
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 46 0.001
gi|39588941|emb|CAE69571.1| Hypothetical protein CBG15783 [Caeno... 46 0.001
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno... 45 0.002
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 45 0.002
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 45 0.002
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 45 0.002
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 45 0.002
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno... 45 0.002
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 45 0.002
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 45 0.002
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno... 45 0.002
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 45 0.002
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 45 0.002
gi|17557099|ref|NP_499700.1| COLlagen structural gene (30.3 kD) ... 45 0.002
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 45 0.002
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 45 0.003
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ... 45 0.003
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 44 0.003
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-... 44 0.004
gi|17536751|ref|NP_495952.1| predicted CDS, COLlagen structural ... 44 0.004
gi|17507553|ref|NP_490679.1| COLlagen structural gene (col-45) [... 44 0.004
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 44 0.006
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno... 43 0.010
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 43 0.010
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT... 42 0.013
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 42 0.013
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 42 0.013
gi|1589837|gb|AAC48358.1| cuticle preprocollagen [Meloidogyne in... 42 0.013
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 42 0.013
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [... 42 0.017
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 42 0.022
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno... 42 0.022
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 42 0.022
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 42 0.022
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno... 42 0.022
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 42 0.022
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 42 0.022
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 41 0.029
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 41 0.029
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 41 0.038
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 41 0.038
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 40 0.049
gi|17539916|ref|NP_500598.1| COLlagen structural gene (col-110) ... 40 0.049
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno... 40 0.049
gi|17551374|ref|NP_510617.1| COLlagen structural gene (col-186) ... 40 0.064
gi|39579438|emb|CAE56766.1| Hypothetical protein CBG24569 [Caeno... 40 0.084
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 39 0.11
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [... 39 0.11
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder... 39 0.11
gi|39593314|emb|CAE64784.1| Hypothetical protein CBG09577 [Caeno... 39 0.11
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [... 39 0.14
gi|38649335|gb|AAH63134.1| Unknown (protein for IMAGE:4246623) [... 39 0.14
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 39 0.19
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 39 0.19
gi|1184072|gb|AAC47437.1| COL-1 39 0.19
gi|17561476|ref|NP_505888.1| COLlagen structural gene (col-155) ... 39 0.19
gi|23822071|sp|Q28298|RRB1_CANFA Ribosome-binding protein 1 (180... 39 0.19
gi|33589142|emb|CAE45096.1| Hypothetical protein Y51H4A.28 [Caen... 39 0.19
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder... 39 0.19
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 39 0.19
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ... 38 0.24
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida] 38 0.24
gi|17557220|ref|NP_505647.1| COLlagen structural gene (col-150) ... 38 0.24
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 38 0.24
gi|39598361|emb|CAE69054.1| Hypothetical protein CBG15063 [Caeno... 38 0.24
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 35 0.31
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno... 38 0.32
gi|320995|pir||A44982 collagen UCOL1 - pig roundworm (fragment) ... 38 0.32
gi|23483514|gb|EAA19159.1| hypothetical protein [Plasmodium yoel... 37 0.42
gi|4249701|gb|AAD13772.1| myosin heavy chain [Rana catesbeiana] 37 0.42
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 37 0.42
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-... 37 0.42
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ... 37 0.42
gi|5882259|gb|AAD55265.1| genethonin 3 [Homo sapiens] 37 0.54
gi|23508158|ref|NP_700828.1| hypothetical protein [Plasmodium fa... 37 0.54
gi|42780042|ref|NP_977289.1| collagen adhesin domain protein [Ba... 37 0.71
gi|15242707|ref|NP_198861.1| expressed protein [Arabidopsis thal... 37 0.71
gi|23479921|gb|EAA16622.1| Arabidopsis thaliana At3g58560/F14P22... 36 0.93
gi|39596517|emb|CAE63136.1| Hypothetical protein CBG07436 [Caeno... 36 0.93
gi|17540820|ref|NP_500070.1| COLlagen structural gene (28.0 kD) ... 36 0.93
gi|50405259|ref|YP_054351.1| Guanylate nucleotide binding protei... 36 1.2
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl... 36 1.2
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 35 1.6
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 35 1.6
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 35 1.6
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 35 2.1
gi|17570601|ref|NP_509692.1| COLlagen structural gene (28.7 kD) ... 35 2.1
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 35 2.1
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ... 35 2.1
gi|17561652|ref|NP_505094.1| myosin heavy chain family member (5... 35 2.7
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 35 2.7
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 35 2.7
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 35 2.7
gi|39590997|emb|CAE58777.1| Hypothetical protein CBG01972 [Caeno... 35 2.7
gi|39595994|emb|CAE67497.1| Hypothetical protein CBG13007 [Caeno... 35 2.7
gi|39587615|emb|CAE58553.1| Hypothetical protein CBG01712 [Caeno... 35 2.7
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 35 2.7
gi|32566158|ref|NP_501528.2| M protein repeat and RepA / Rep+ pr... 34 3.5
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ... 34 3.5
gi|46226391|gb|EAK87396.1| possible apicomplexan-specific protei... 34 3.5
gi|34878300|ref|XP_237924.2| similar to RIKEN cDNA 5730509K17 ge... 34 3.5
gi|23509680|ref|NP_702347.1| hypothetical protein [Plasmodium fa... 34 3.5
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 34 3.5
gi|23612220|ref|NP_703800.1| myosin-like protein, putative [Plas... 34 3.5
gi|7508662|pir||T25410 hypothetical protein T28C6.7 - Caenorhabd... 34 3.5
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (... 34 4.6
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita] 34 4.6
gi|28829087|gb|AAO51651.1| similar to Dictyostelium discoideum (... 34 4.6
gi|29246951|gb|EAA38529.1| GLP_108_37491_40610 [Giardia lamblia ... 34 4.6
gi|28848634|gb|AAO45015.1| ATP synthase F0 subunit b [Jakoba lib... 34 4.6
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 34 4.6
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno... 34 4.6
gi|129260|sp|P10451|OSTP_HUMAN Osteopontin precursor (Bone sialo... 33 6.0
gi|992948|dbj|BAA05949.1| OPN-a [Homo sapiens] 33 6.0
gi|30583805|gb|AAP36151.1| Homo sapiens secreted phosphoprotein ... 33 6.0
gi|39585885|emb|CAE61299.1| Hypothetical protein CBG05125 [Caeno... 33 6.0
gi|7503488|pir||T22235 hypothetical protein F45G2.3 - Caenorhabd... 33 6.0
gi|39594543|emb|CAE72121.1| Hypothetical protein CBG19217 [Caeno... 33 6.0
gi|992950|dbj|BAA05951.1| OPN-c [Homo sapiens] 33 6.0
gi|9453839|dbj|BAB03273.1| myosin [Chara corallina] 33 6.0
gi|6472600|dbj|BAA87057.1| unconventional myosin heavy chain [Ch... 33 6.0
gi|17553462|ref|NP_499769.1| myosin heavy family member (3O511) ... 33 6.0
gi|24584994|ref|NP_609888.2| CG10333-PA [Drosophila melanogaster... 33 6.0
gi|17533645|ref|NP_496367.1| COLlagen structural gene (col-83) [... 33 6.0
gi|4759166|ref|NP_000573.1| secreted phosphoprotein 1 (osteopont... 33 6.0
gi|992949|dbj|BAA05950.1| OPN-b [Homo sapiens] 33 6.0
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 33 6.0
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 33 6.0
gi|17539078|ref|NP_502507.1| COLlagen structural gene (col-131) ... 33 6.0
gi|50423813|ref|XP_460491.1| unnamed protein product [Debaryomyc... 33 6.0
gi|42528111|ref|NP_973209.1| conserved hypothetical protein [Tre... 33 6.0
gi|39590295|emb|CAE66033.1| Hypothetical protein CBG11229 [Caeno... 33 7.9
gi|27803037|emb|CAD60740.1| unnamed protein product [Podospora a... 33 7.9
gi|34853998|ref|XP_238336.2| similar to serine/arginine-rich pro... 33 7.9
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 33 7.9
gi|30023824|ref|NP_835229.1| similar to delta 5 fatty acid desat... 33 7.9
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ... 33 7.9
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno... 33 7.9
gi|11342672|ref|NP_002461.1| myosin, heavy polypeptide 3, skelet... 33 7.9
gi|3043372|sp|P11055|MYH3_HUMAN Myosin heavy chain, fast skeleta... 33 7.9
gi|47217757|emb|CAG05979.1| unnamed protein product [Tetraodon n... 33 7.9
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 33 7.9
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 33 7.9
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 33 7.9
gi|17551704|ref|NP_508747.1| COLlagen structural gene (33.9 kD) ... 33 7.9
gi|31144|emb|CAA31492.1| myosin heavy chain (1167 AA) [Homo sapi... 33 7.9
gi|29464|emb|CAA35942.1| embryonic myosin heavy chain (1085 AA) ... 33 7.9
gi|1335313|emb|CAA33731.1| unnamed protein product [Homo sapiens] 33 7.9
gi|15077111|gb|AAK83075.1| collagen [Meloidogyne javanica] 33 7.9
gi|39590394|emb|CAE66133.1| Hypothetical protein CBG11357 [Caeno... 33 7.9
>gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD)
(col-178) [Caenorhabditis elegans]
gi|7497039|pir||T19731 hypothetical protein C34F6.2 -
Caenorhabditis elegans
gi|3874797|emb|CAB03941.1| Hypothetical protein C34F6.2
[Caenorhabditis elegans]
Length = 283
Score = 251 bits (641), Expect = 1e-65
Identities = 124/139 (89%), Positives = 124/139 (89%)
Frame = +1
Query: 1 MEDKAKLVQASELKKFAFFGVAVSTVATLIAIIAVPLLCLHMQTVHSGLSDELLFCKSKN 180
MEDKAKLVQASELKKFAFFGVAVSTVATLIAIIAVPLLCLHMQTVHSGLSDELLFCKSKN
Sbjct: 1 MEDKAKLVQASELKKFAFFGVAVSTVATLIAIIAVPLLCLHMQTVHSGLSDELLFCKSKN 60
Query: 181 VDMRSEIEKLSVIRDNGRQKRQTPQTCCSCGIGETGPAGVPGQEGAPGNXXXXXXXXXXX 360
VDMRSEIEKLSVIRDNGRQKRQTPQTCCSCGIGETGPAGVPGQEGAPGN
Sbjct: 61 VDMRSEIEKLSVIRDNGRQKRQTPQTCCSCGIGETGPAGVPGQEGAPGNDGKAGQPGAPG 120
Query: 361 XXXXEQGFHYKAPEFCFDC 417
EQGFHYKAPEFCFDC
Sbjct: 121 ADADEQGFHYKAPEFCFDC 139
Score = 39.7 bits (91), Expect = 0.084
Identities = 14/14 (100%), Positives = 14/14 (100%)
Frame = +1
Query: 808 SCDHCPPPRTAPGY 849
SCDHCPPPRTAPGY
Sbjct: 270 SCDHCPPPRTAPGY 283