Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C34F6_3
(852 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ... 252 8e-66
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno... 227 3e-58
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno... 218 2e-55
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ... 218 2e-55
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 140 4e-53
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e... 140 5e-32
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 127 3e-28
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 126 5e-28
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno... 126 5e-28
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 119 8e-26
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno... 119 1e-25
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ... 115 1e-24
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab... 115 1e-24
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 112 1e-23
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [... 112 1e-23
gi|687634|gb|AAA62504.1| collagen 110 4e-23
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 110 4e-23
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 109 7e-23
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 71 4e-22
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 105 1e-21
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 105 2e-21
gi|39579268|emb|CAE56955.1| Hypothetical protein CBG24805 [Caeno... 99 1e-19
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [... 94 5e-18
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 94 5e-18
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 92 1e-17
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 92 1e-17
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 92 1e-17
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 91 4e-17
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 91 4e-17
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 91 4e-17
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 88 2e-16
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 88 2e-16
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 87 4e-16
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 87 5e-16
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 87 6e-16
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 85 2e-15
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 83 7e-15
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 82 2e-14
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 81 3e-14
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 81 3e-14
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 80 4e-14
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 78 3e-13
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 77 5e-13
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40 74 3e-12
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 74 4e-12
gi|1813688|gb|AAC47626.1| unknown [Brugia malayi] >gnl|BL_ORD_ID... 74 5e-12
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 73 9e-12
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 73 9e-12
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 73 9e-12
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 72 1e-11
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 72 2e-11
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 72 2e-11
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 72 2e-11
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 72 2e-11
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 72 2e-11
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 72 2e-11
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 71 3e-11
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 71 3e-11
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 71 3e-11
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 71 3e-11
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 71 3e-11
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 70 4e-11
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 70 6e-11
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 69 1e-10
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 69 2e-10
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 68 3e-10
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 67 5e-10
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl... 64 3e-09
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 63 7e-09
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 61 3e-08
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 61 3e-08
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 61 4e-08
gi|39581447|emb|CAE74729.1| Hypothetical protein CBG22547 [Caeno... 60 5e-08
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 59 1e-07
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 59 1e-07
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 57 4e-07
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 56 9e-07
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 56 1e-06
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 55 2e-06
gi|17542460|ref|NP_499889.1| COLlagen structural gene (col-100) ... 54 4e-06
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 53 7e-06
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 52 1e-05
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 52 1e-05
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 52 2e-05
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ... 52 2e-05
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 52 2e-05
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 52 2e-05
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 52 2e-05
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 51 3e-05
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 51 3e-05
gi|37619779|emb|CAA90258.2| C. elegans COL-76 protein (correspon... 51 4e-05
gi|17535207|ref|NP_495726.1| COLlagen structural gene (col-76) [... 51 4e-05
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 50 6e-05
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 50 6e-05
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 50 8e-05
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 50 8e-05
gi|39587241|emb|CAE57709.1| Hypothetical protein CBG00716 [Caeno... 49 1e-04
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 49 2e-04
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 49 2e-04
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 49 2e-04
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 48 3e-04
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 48 3e-04
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 48 3e-04
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 48 3e-04
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 47 4e-04
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 47 5e-04
gi|1222642|emb|CAA63070.1| collagen [Brugia pahangi] 47 5e-04
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 47 7e-04
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 46 9e-04
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 46 9e-04
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 46 0.001
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 46 0.001
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 45 0.002
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 45 0.002
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 45 0.002
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 45 0.002
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 45 0.003
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 45 0.003
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 44 0.003
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 44 0.003
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 44 0.004
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 44 0.006
gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD) ... 44 0.006
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 43 0.008
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 43 0.008
gi|39583745|emb|CAE63849.1| Hypothetical protein CBG08408 [Caeno... 43 0.008
gi|39596084|emb|CAE69720.1| Hypothetical protein CBG15991 [Caeno... 43 0.008
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 43 0.010
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 43 0.010
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 43 0.010
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 42 0.013
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [... 42 0.013
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 42 0.013
gi|1589837|gb|AAC48358.1| cuticle preprocollagen [Meloidogyne in... 42 0.013
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 42 0.013
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ... 42 0.013
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 42 0.013
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 42 0.013
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 42 0.013
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 42 0.013
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT... 42 0.017
gi|23483514|gb|EAA19159.1| hypothetical protein [Plasmodium yoel... 42 0.017
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 42 0.017
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 42 0.022
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 42 0.022
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 42 0.022
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 42 0.022
gi|1184072|gb|AAC47437.1| COL-1 41 0.029
gi|39588941|emb|CAE69571.1| Hypothetical protein CBG15783 [Caeno... 41 0.029
gi|17539916|ref|NP_500598.1| COLlagen structural gene (col-110) ... 41 0.038
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ... 40 0.049
gi|17557099|ref|NP_499700.1| COLlagen structural gene (30.3 kD) ... 40 0.049
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 40 0.064
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno... 40 0.064
gi|32567349|ref|NP_872207.1| COLlagen structural gene (col-42) [... 40 0.064
gi|50405259|ref|YP_054351.1| Guanylate nucleotide binding protei... 40 0.084
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 40 0.084
gi|39579438|emb|CAE56766.1| Hypothetical protein CBG24569 [Caeno... 40 0.084
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ... 40 0.084
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-... 40 0.084
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 39 0.11
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno... 39 0.11
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno... 39 0.11
gi|23822071|sp|Q28298|RRB1_CANFA Ribosome-binding protein 1 (180... 39 0.14
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 39 0.14
gi|39598361|emb|CAE69054.1| Hypothetical protein CBG15063 [Caeno... 39 0.14
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 39 0.19
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 39 0.19
gi|33589142|emb|CAE45096.1| Hypothetical protein Y51H4A.28 [Caen... 39 0.19
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno... 38 0.24
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 38 0.24
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 38 0.24
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-... 38 0.24
gi|17551374|ref|NP_510617.1| COLlagen structural gene (col-186) ... 38 0.24
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 38 0.32
gi|9633185|ref|NP_050290.1| hexon assembly-associated protein [F... 38 0.32
gi|39595279|emb|CAE60316.1| Hypothetical protein CBG03907 [Caeno... 38 0.32
gi|320995|pir||A44982 collagen UCOL1 - pig roundworm (fragment) ... 38 0.32
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno... 37 0.42
gi|17561476|ref|NP_505888.1| COLlagen structural gene (col-155) ... 37 0.42
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder... 37 0.42
gi|18976707|ref|NP_578064.1| flagella-related protein d, putativ... 37 0.42
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 37 0.54
gi|39588428|emb|CAE72779.1| Hypothetical protein CBG20034 [Caeno... 37 0.54
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo... 37 0.54
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ... 37 0.54
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 37 0.54
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 33 0.65
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 37 0.71
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [... 37 0.71
gi|50548039|ref|XP_501489.1| hypothetical protein [Yarrowia lipo... 37 0.71
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno... 37 0.71
gi|39591554|emb|CAE71130.1| Hypothetical protein CBG17984 [Caeno... 37 0.71
gi|42780042|ref|NP_977289.1| collagen adhesin domain protein [Ba... 36 0.93
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno... 36 0.93
gi|17507553|ref|NP_490679.1| COLlagen structural gene (col-45) [... 36 0.93
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [... 36 1.2
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 36 1.2
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida] 36 1.2
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder... 36 1.2
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 35 1.6
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 35 1.6
gi|47215799|emb|CAG02853.1| unnamed protein product [Tetraodon n... 35 1.6
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 35 1.6
gi|47217757|emb|CAG05979.1| unnamed protein product [Tetraodon n... 35 1.6
gi|39588000|emb|CAE57231.1| Hypothetical protein CBG00101 [Caeno... 35 1.6
gi|17540820|ref|NP_500070.1| COLlagen structural gene (28.0 kD) ... 35 1.6
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 35 2.1
gi|23508158|ref|NP_700828.1| hypothetical protein [Plasmodium fa... 35 2.1
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 35 2.1
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 35 2.1
gi|39585885|emb|CAE61299.1| Hypothetical protein CBG05125 [Caeno... 35 2.7
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno... 35 2.7
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno... 35 2.7
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 35 2.7
gi|49085782|ref|XP_404986.1| hypothetical protein AN0849.2 [Aspe... 35 2.7
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 35 2.7
gi|39598007|emb|CAE68699.1| Hypothetical protein CBG14618 [Caeno... 34 3.5
gi|17554934|ref|NP_499807.1| major sperm protein domain contain... 34 3.5
gi|34878300|ref|XP_237924.2| similar to RIKEN cDNA 5730509K17 ge... 34 3.5
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 34 3.5
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 34 3.5
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 34 3.5
gi|4249701|gb|AAD13772.1| myosin heavy chain [Rana catesbeiana] 34 3.5
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 34 3.5
gi|9910552|ref|NP_064475.1| sodium/calcium/potassium exchanger [... 34 4.6
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (... 34 4.6
gi|17552906|ref|NP_498266.1| FYVE type zinc finger containing pr... 34 4.6
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita] 34 4.6
gi|23479921|gb|EAA16622.1| Arabidopsis thaliana At3g58560/F14P22... 34 4.6
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 34 4.6
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno... 33 6.0
gi|39590294|emb|CAE66032.1| Hypothetical protein CBG11227 [Caeno... 33 6.0
gi|17568063|ref|NP_509479.1| troponin T (tnt-2) [Caenorhabditis ... 33 6.0
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 33 6.0
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 33 6.0
gi|17539078|ref|NP_502507.1| COLlagen structural gene (col-131) ... 33 6.0
gi|31746635|gb|AAP68941.1| Troponin t protein 2, isoform a [Caen... 33 6.0
gi|20521978|dbj|BAB21823.2| KIAA1732 protein [Homo sapiens] 33 6.0
gi|30410777|ref|NP_036403.1| huntingtin interacting protein B is... 33 7.9
gi|17536751|ref|NP_495952.1| predicted CDS, COLlagen structural ... 33 7.9
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 33 7.9
gi|23509680|ref|NP_702347.1| hypothetical protein [Plasmodium fa... 33 7.9
gi|34869674|ref|XP_341308.1| similar to 3632451O06Rik protein [R... 33 7.9
gi|12697196|emb|CAC28349.1| huntingtin interacting protein 1 [Ho... 33 7.9
gi|30410779|ref|NP_054878.3| huntingtin interacting protein B is... 33 7.9
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 33 7.9
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 33 7.9
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 33 7.9
gi|47222289|emb|CAG05038.1| unnamed protein product [Tetraodon n... 33 7.9
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno... 33 7.9
gi|19484221|gb|AAH23359.1| 3632451O06Rik protein [Mus musculus] 33 7.9
gi|15077111|gb|AAK83075.1| collagen [Meloidogyne javanica] 33 7.9
gi|39592202|emb|CAE75423.1| Hypothetical protein CBG23416 [Caeno... 33 7.9
>gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179)
[Caenorhabditis elegans]
gi|7497040|pir||T19732 hypothetical protein C34F6.3 -
Caenorhabditis elegans
gi|3874798|emb|CAB03942.1| Hypothetical protein C34F6.3
[Caenorhabditis elegans]
Length = 283
Score = 252 bits (643), Expect = 8e-66
Identities = 124/139 (89%), Positives = 124/139 (89%)
Frame = +1
Query: 1 MEDKAKFAYAADLKKFAFFGVAVSTVATLIAIIAIPLFCVHMQSVTSGLSEELLFCKSKN 180
MEDKAKFAYAADLKKFAFFGVAVSTVATLIAIIAIPLFCVHMQSVTSGLSEELLFCKSKN
Sbjct: 1 MEDKAKFAYAADLKKFAFFGVAVSTVATLIAIIAIPLFCVHMQSVTSGLSEELLFCKSKN 60
Query: 181 VYIKGEIEQLSVTREAGRQKRQTPQTCCSCGIGETGPAGVPGQEGAPGNXXXXXXXXXXX 360
VYIKGEIEQLSVTREAGRQKRQTPQTCCSCGIGETGPAGVPGQEGAPGN
Sbjct: 61 VYIKGEIEQLSVTREAGRQKRQTPQTCCSCGIGETGPAGVPGQEGAPGNDGKAGQPGAPG 120
Query: 361 XXXXEQGFHYKAPEFCFDC 417
EQGFHYKAPEFCFDC
Sbjct: 121 ADADEQGFHYKAPEFCFDC 139
Score = 39.7 bits (91), Expect = 0.084
Identities = 14/14 (100%), Positives = 14/14 (100%)
Frame = +1
Query: 808 SCDHCPPPRTAPGY 849
SCDHCPPPRTAPGY
Sbjct: 270 SCDHCPPPRTAPGY 283