Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C35B8_3
         (864 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD) ...   296   3e-79
gi|39596219|emb|CAE69856.1| Hypothetical protein CBG16184 [Caeno...   269   5e-71
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans]            126   5e-28
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C...   106   6e-22
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl...   106   6e-22
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno...   103   4e-21
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno...   103   5e-21
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-...   103   5e-21
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >...   101   2e-20
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ...   100   4e-20
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [...   100   7e-20
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno...    99   9e-20
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ...    99   9e-20
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno...    99   2e-19
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [...    73   2e-19
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ...    97   5e-19
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno...    95   2e-18
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [...    95   2e-18
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno...    93   7e-18
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno...    93   7e-18
gi|687634|gb|AAA62504.1| collagen                                      92   2e-17
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno...    91   2e-17
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno...    91   2e-17
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [...    90   6e-17
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno...    88   3e-16
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno...    88   3e-16
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ...    87   5e-16
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ...    87   6e-16
gi|32566102|ref|NP_508100.2| COLlagen structural gene (col-19) [...    87   6e-16
gi|84432|pir||JS0170 collagen col-19 - Caenorhabditis elegans >g...    87   6e-16
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno...    84   4e-15
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno...    84   5e-15
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ...    83   7e-15
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ...    82   1e-14
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ...    82   2e-14
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ...    82   2e-14
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno...    80   6e-14
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno...    79   2e-13
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno...    78   3e-13
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno...    77   4e-13
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno...    77   5e-13
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno...    77   6e-13
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ...    76   1e-12
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [...    75   2e-12
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ...    75   2e-12
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ...    75   2e-12
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C...    74   3e-12
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [...    74   3e-12
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ...    74   3e-12
gi|17508175|ref|NP_491106.1| COLlagen structural gene (col-49) [...    74   3e-12
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ...    58   4e-12
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno...    74   5e-12
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno...    73   7e-12
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno...    73   9e-12
gi|39595517|emb|CAE60555.1| Hypothetical protein CBG04182 [Caeno...    73   9e-12
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno...    72   1e-11
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ...    72   1e-11
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [...    72   1e-11
gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [...    72   1e-11
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [...    72   2e-11
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno...    72   2e-11
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [...    72   2e-11
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [...    72   2e-11
gi|39593522|emb|CAE61814.1| Hypothetical protein CBG05782 [Caeno...    71   3e-11
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno...    70   5e-11
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel...    70   5e-11
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno...    70   5e-11
gi|17557828|ref|NP_505635.1| COLlagen structural gene (col-148) ...    70   6e-11
gi|39594543|emb|CAE72121.1| Hypothetical protein CBG19217 [Caeno...    70   8e-11
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ...    70   8e-11
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno...    69   1e-10
gi|17557278|ref|NP_505375.1| COLlagen structural gene (28.8 kD) ...    69   1e-10
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno...    69   1e-10
gi|17539040|ref|NP_501123.1| COLlagen structural gene (35.6 kD) ...    69   1e-10
gi|17540622|ref|NP_502116.1| predicted CDS, COLlagen structural ...    69   2e-10
gi|17540620|ref|NP_502115.1| COLlagen structural gene (col-126) ...    69   2e-10
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ...    69   2e-10
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno...    69   2e-10
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp...    68   2e-10
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [...    68   3e-10
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ...    67   4e-10
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno...    67   4e-10
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ...    67   5e-10
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ...    67   5e-10
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno...    65   1e-09
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno...    65   1e-09
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita]    65   2e-09
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc...    65   2e-09
gi|84434|pir||PS0036 collagen col-7 - Caenorhabditis elegans (fr...    65   2e-09
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno...    65   2e-09
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd...    65   2e-09
gi|47229450|emb|CAF99438.1| unnamed protein product [Tetraodon n...    45   3e-09
gi|39593742|emb|CAE62035.1| Hypothetical protein CBG06051 [Caeno...    64   3e-09
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder...    64   4e-09
gi|39582634|emb|CAE73738.1| Hypothetical protein CBG21264 [Caeno...    64   4e-09
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ...    64   4e-09
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno...    64   6e-09
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno...    64   6e-09
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ...    63   7e-09
gi|17539090|ref|NP_502514.1| COLlagen structural gene (col-132) ...    63   7e-09
gi|39593314|emb|CAE64784.1| Hypothetical protein CBG09577 [Caeno...    63   9e-09
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa]                    62   1e-08
gi|39582788|emb|CAE74251.1| Hypothetical protein CBG21938 [Caeno...    62   2e-08
gi|17557218|ref|NP_505646.1| COLlagen structural gene (30.6 kD) ...    62   2e-08
gi|17557220|ref|NP_505647.1| COLlagen structural gene (col-150) ...    62   2e-08
gi|39587723|emb|CAE58661.1| Hypothetical protein CBG01830 [Caeno...    62   2e-08
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ...    62   2e-08
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno...    61   4e-08
gi|25385147|pir||A88640 protein C34H4.4 [imported] - Caenorhabdi...    60   5e-08
gi|39586931|emb|CAE62866.1| Hypothetical protein CBG07049 [Caeno...    60   5e-08
gi|17559812|ref|NP_505793.1| COLlagen structural gene (35.1 kD) ...    60   6e-08
gi|17570601|ref|NP_509692.1| COLlagen structural gene (28.7 kD) ...    60   6e-08
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno...    60   6e-08
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno...    60   6e-08
gi|39589826|emb|CAE67061.1| Hypothetical protein CBG12469 [Caeno...    60   6e-08
gi|39593313|emb|CAE64783.1| Hypothetical protein CBG09576 [Caeno...    60   8e-08
gi|17505428|ref|NP_492035.1| COLlagen structural gene (col-61) [...    60   8e-08
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno...    60   8e-08
gi|39588000|emb|CAE57231.1| Hypothetical protein CBG00101 [Caeno...    60   8e-08
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa]                    59   1e-07
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD...    59   1e-07
gi|17534799|ref|NP_493702.1| COLlagen structural gene (col-69) [...    59   1e-07
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno...    59   1e-07
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno...    59   1e-07
gi|17540820|ref|NP_500070.1| COLlagen structural gene (28.0 kD) ...    59   2e-07
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa...    58   2e-07
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida]                58   2e-07
gi|17506297|ref|NP_492086.1| COLlagen structural gene (col-35) [...    58   2e-07
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (...    58   3e-07
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ...    58   3e-07
gi|17569345|ref|NP_510110.1| COLlagen structural gene (col-182) ...    58   3e-07
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder...    58   3e-07
gi|17539868|ref|NP_501416.1| predicted CDS, COLlagen structural ...    58   3e-07
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa]                    57   4e-07
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ...    57   4e-07
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno...    57   4e-07
gi|17506643|ref|NP_492948.1| predicted CDS, COLlagen structural ...    57   5e-07
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ...    57   5e-07
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ...    57   7e-07
gi|13235592|emb|CAC33779.1| SclB protein [Streptococcus pyogenes]      57   7e-07
gi|39586155|emb|CAE69231.1| Hypothetical protein CBG15273 [Caeno...    57   7e-07
gi|17557174|ref|NP_505670.1| COLlagen structural gene (col-151) ...    56   9e-07
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [...    56   9e-07
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum]            56   9e-07
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ...    56   9e-07
gi|39595235|emb|CAE60272.1| Hypothetical protein CBG03851 [Caeno...    56   9e-07
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ...    56   9e-07
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n...    52   1e-06
gi|115410|sp|P12114|CCS1_CAEEL Cuticle collagen sqt-1 >gnl|BL_OR...    56   1e-06
gi|17535735|ref|NP_496421.1| SQuaT SQT-1, ROLler: helically twis...    56   1e-06
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [...    56   1e-06
gi|17542298|ref|NP_501532.1| COLlagen structural gene (col-118) ...    55   2e-06
gi|39581950|emb|CAE73812.1| Hypothetical protein CBG21362 [Caeno...    55   2e-06
gi|39591984|emb|CAE75204.1| Hypothetical protein CBG23151 [Caeno...    55   2e-06
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate...    55   2e-06
gi|39590997|emb|CAE58777.1| Hypothetical protein CBG01972 [Caeno...    55   2e-06
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ...    55   2e-06
gi|17569903|ref|NP_508386.1| COLlagen structural gene (38.6 kD) ...    55   2e-06
gi|17536809|ref|NP_494568.1| COLlagen structural gene (col-72) [...    55   3e-06
gi|17542824|ref|NP_501756.1| COLlagen structural gene (col-123) ...    55   3e-06
gi|39583705|emb|CAE63809.1| Hypothetical protein CBG08355 [Caeno...    54   3e-06
gi|39597388|emb|CAE59617.1| Hypothetical protein CBG03026 [Caeno...    54   3e-06
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel...    54   4e-06
gi|39596361|emb|CAE69999.1| Hypothetical protein CBG16406 [Caeno...    54   4e-06
gi|39591910|emb|CAE75130.1| Hypothetical protein CBG23058 [Caeno...    54   4e-06
gi|39597664|emb|CAE68355.1| Hypothetical protein CBG14092 [Caeno...    54   4e-06
gi|7494765|pir||T29837 hypothetical protein B0222.6 - Caenorhabd...    54   4e-06
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para...    54   6e-06
gi|23612220|ref|NP_703800.1| myosin-like protein, putative [Plas...    54   6e-06
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno...    54   6e-06
gi|17550712|ref|NP_510630.1| COLlagen structural gene (col-187) ...    54   6e-06
gi|17540078|ref|NP_500607.1| COLlagen structural gene (col-111) ...    54   6e-06
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno...    54   6e-06
gi|33285196|gb|AAF99925.2| Collagen protein 111 [Caenorhabditis ...    54   6e-06
gi|13560496|gb|AAK30077.1| collagen-like protein B [Streptococcu...    54   6e-06
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre...    53   8e-06
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa]                    53   8e-06
gi|39597300|emb|CAE59528.1| Hypothetical protein CBG02923 [Caeno...    53   8e-06
gi|50737082|ref|XP_419148.1| PREDICTED: similar to collectin sub...    53   1e-05
gi|18640526|ref|NP_570367.1| collagen alpha 1(I) chain precursor...    53   1e-05
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col...    53   1e-05
gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals ...    53   1e-05
gi|17531393|ref|NP_496311.1| nematode cuticle collagen, BLIstere...    53   1e-05
gi|50750043|ref|XP_421847.1| PREDICTED: similar to [Segment 3 of...    53   1e-05
gi|13235596|emb|CAC33780.1| SclB protein [Streptococcus pyogenes]      53   1e-05
gi|37619788|emb|CAA86755.2| Hypothetical protein C09G5.6 [Caenor...    53   1e-05
gi|28850438|gb|AAO53202.1| similar to Plasmodium falciparum. Hyp...    52   1e-05
gi|39596974|emb|CAE59201.1| Hypothetical protein CBG02512 [Caeno...    52   1e-05
gi|39597491|emb|CAE59721.1| Hypothetical protein CBG03154 [Caeno...    52   1e-05
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno...    52   1e-05
gi|47228041|emb|CAF97670.1| unnamed protein product [Tetraodon n...    52   1e-05
gi|31240941|ref|XP_320884.1| ENSANGP00000019179 [Anopheles gambi...    52   1e-05
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc...    52   2e-05
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1                   52   2e-05
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno...    52   2e-05
gi|227522|prf||1705298A collagen alpha1(IV)                            52   2e-05
gi|39589495|emb|CAE74524.1| Hypothetical protein CBG22278 [Caeno...    52   2e-05
gi|17506859|ref|NP_491822.1| predicted CDS, COLlagen structural ...    52   2e-05
gi|482198|pir||S40991 collagen alpha 1(IV) chain precursor - Cae...    52   2e-05
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a...    52   2e-05
gi|42733225|emb|CAA81584.4| Hypothetical protein K04H4.1a [Caeno...    52   2e-05
gi|115309|sp|P17139|CA14_CAEEL Collagen alpha 1(IV) chain precur...    52   2e-05
gi|42733226|emb|CAE52901.2| Hypothetical protein K04H4.1b [Caeno...    52   2e-05
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno...    52   2e-05
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-...    52   2e-05
gi|13235588|emb|CAC33777.1| SclB protein [Streptococcus pyogenes]      52   2e-05
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno...    52   2e-05
gi|13560500|gb|AAK30078.1| collagen-like protein B [Streptococcu...    52   2e-05
gi|17551340|ref|NP_509274.1| DumPY : shorter than wild-type DPY-...    52   2e-05
gi|21431496|sp||P12105_1 [Segment 1 of 3] Collagen alpha 1(III) ...    52   2e-05
gi|17506313|ref|NP_491394.1| predicted CDS, COLlagen structural ...    52   2e-05
gi|20178621|gb|AAL50184.1| collagen-like protein 2 [Streptococcu...    52   2e-05
gi|50730534|ref|XP_416951.1| PREDICTED: similar to collagen IV a...    43   2e-05
gi|39579123|emb|CAE56688.1| Hypothetical protein CBG24466 [Caeno...    51   3e-05
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno...    51   3e-05
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (...    51   3e-05
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel...    51   3e-05
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL...    51   3e-05
gi|31231815|ref|XP_318597.1| ENSANGP00000020852 [Anopheles gambi...    51   3e-05
gi|29466645|dbj|BAC66788.1| collagen like protein ClgA [Streptoc...    51   3e-05
gi|17540734|ref|NP_501655.1| COLlagen structural gene (36.5 kD) ...    51   3e-05
gi|31195073|ref|XP_306484.1| ENSANGP00000014653 [Anopheles gambi...    51   3e-05
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno...    51   3e-05
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ...    51   3e-05
gi|11875612|gb|AAG40729.1| type IV collagen alpha 1 chain precur...    51   3e-05
gi|15675046|ref|NP_269220.1| putative collagen-like protein [Str...    51   3e-05
gi|31231753|ref|XP_318588.1| ENSANGP00000021001 [Anopheles gambi...    51   3e-05
gi|17507511|ref|NP_492619.1| COLlagen structural gene (col-64) [...    51   3e-05
gi|50754752|ref|XP_414488.1| PREDICTED: similar to C1q and tumor...    51   3e-05
gi|109680|pir||A41182 collagen alpha 1(II) chain precursor - mouse     51   4e-05
gi|30410850|gb|AAH51383.1| Col2a1 protein [Mus musculus]               51   4e-05
gi|6978677|ref|NP_037061.1| procollagen, type II, alpha 1; Proco...    51   4e-05
gi|30353888|gb|AAH52326.1| Col2a1 protein [Mus musculus]               51   4e-05
gi|15149479|ref|NP_149162.1| alpha 1 type II collagen isoform 2,...    51   4e-05
gi|115287|sp|P02458|CA12_HUMAN Collagen alpha 1(II) chain precur...    51   4e-05
gi|11276913|pir||T45467 collagen alpha 1(II) chain precursor [im...    51   4e-05
gi|39597161|emb|CAE59388.1| Hypothetical protein CBG02745 [Caeno...    51   4e-05
gi|109679|pir||B41182 collagen alpha 1(II) chain precursor (long...    51   4e-05
gi|13435125|ref|NP_001835.2| alpha 1 type II collagen isoform 1;...    51   4e-05
gi|1070602|pir||CGHU6C collagen alpha 1(II) chain precursor [val...    51   4e-05
gi|10947027|gb|AAC62178.2| type IIA procollagen [Canis familiaris]     51   4e-05
gi|263810|gb|AAB24972.1| collagen alpha chain [Riftia pachyptila...    51   4e-05
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p...    51   4e-05
gi|399170|sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain     51   4e-05
gi|2119156|pir||S28774 collagen alpha chain - tube worm (Riftia ...    51   4e-05
gi|13624305|ref|NP_112440.1| procollagen, type II, alpha 1; disp...    51   4e-05
gi|200216|gb|AAA68102.1| pro-alpha-1 type II collagen                  51   4e-05
gi|30041|emb|CAA34683.1| COL2A1 [Homo sapiens]                         51   4e-05
gi|200217|gb|AAA68101.1| pro-alpha-1 type II collagen                  51   4e-05
gi|115288|sp|P28481|CA12_MOUSE Collagen alpha 1(II) chain precur...    51   4e-05
gi|28380296|sp||P02459_1 [Segment 1 of 2] Collagen alpha 1(II) c...    51   4e-05
gi|2144804|pir||CGBO6C collagen alpha 1(II) chain precursor - bo...    51   4e-05
gi|1222642|emb|CAA63070.1| collagen [Brugia pahangi]                   51   4e-05
gi|39585299|emb|CAE61621.1| Hypothetical protein CBG05547 [Caeno...    51   4e-05
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (...    50   5e-05
gi|39594909|emb|CAE70777.1| Hypothetical protein CBG17531 [Caeno...    50   5e-05
gi|38490686|emb|CAE53096.1| alpha-5 collagen [Paracentrotus livi...    50   5e-05
gi|34879630|ref|XP_225043.2| similar to Collagen alpha 2(IV) cha...    50   5e-05
gi|17568307|ref|NP_509837.1| COLlagen structural gene (col-177) ...    50   5e-05
gi|460246|gb|AAC46611.1| a2 (IV) basement membrane collagen            50   5e-05
gi|50732501|ref|XP_418665.1| PREDICTED: similar to alpha-2 type ...    50   5e-05
gi|4519619|dbj|BAA75669.1| collagen pro alpha-chain [Haliotis di...    50   5e-05
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno...    50   5e-05
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ...    50   5e-05
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ...    50   5e-05
gi|39593739|emb|CAE62032.1| Hypothetical protein CBG06046 [Caeno...    50   5e-05
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec...    50   6e-05
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul...    50   6e-05
gi|9453886|dbj|BAB03287.1| pro-alpha 1 type V/XI collagen [Pagru...    50   6e-05
gi|112628|pir||A41207 collagen 13, nonfibrillar - freshwater spo...    50   6e-05
gi|115659|sp|P18503|CAS4_EPHMU SHORT-CHAIN COLLAGEN C4 >gnl|BL_O...    50   6e-05
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno...    50   6e-05
gi|4538570|emb|CAA40203.2| Non-fibrillar collagen EmC13 [Ephydat...    50   6e-05
gi|1778210|gb|AAC47545.1| fibrillar collagen [Arenicola marina]        50   6e-05
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno...    50   6e-05
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno...    50   6e-05
gi|17535069|ref|NP_496535.1| COLlagen structural gene (col-84) [...    50   6e-05
gi|39588428|emb|CAE72779.1| Hypothetical protein CBG20034 [Caeno...    50   6e-05
gi|17538077|ref|NP_495159.1| COLlagen structural gene (col-74) [...    50   6e-05
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc...    50   8e-05
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet...    50   8e-05
gi|47212865|emb|CAF93222.1| unnamed protein product [Tetraodon n...    50   8e-05
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ...    50   8e-05
gi|17539078|ref|NP_502507.1| COLlagen structural gene (col-131) ...    50   8e-05
gi|50757087|ref|XP_429250.1| PREDICTED: hypothetical protein XP_...    50   8e-05
gi|20380052|gb|AAH28178.1| COL3A1 protein [Homo sapiens]               50   8e-05
gi|17534889|ref|NP_495294.1| COLlagen structural gene (col-75) [...    50   8e-05
gi|19745166|ref|NP_604447.1| collagen, type V, alpha 1 [Rattus n...    50   8e-05
gi|191151|gb|AAA37002.1| pro-alpha-1 type V collagen                   50   8e-05
gi|6165881|gb|AAF04724.1| collagen type XI alpha-1 [Homo sapiens]      50   8e-05
gi|1070603|pir||CGHU7L collagen alpha 1(III) chain precursor - h...    50   8e-05
gi|4502951|ref|NP_000081.1| alpha 1 type III collagen; Collagen ...    50   8e-05
gi|46048885|ref|NP_990121.1| alpha 1 (V) collagen [Gallus gallus...    50   8e-05
gi|50754535|ref|XP_425157.1| PREDICTED: similar to type VII coll...    50   8e-05
gi|6165882|gb|AAF04725.1| collagen type XI alpha-1 isoform A [Ho...    50   8e-05
gi|21542396|sp|P12107|CA1B_HUMAN Collagen alpha 1(XI) chain prec...    50   8e-05
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ...    50   8e-05
gi|115313|sp|P20908|CA15_HUMAN Collagen alpha 1(V) chain precurs...    50   8e-05
gi|1360669|pir||CGHU1V collagen alpha 1(V) chain precursor - hum...    50   8e-05
gi|7656987|ref|NP_056549.1| procollagen, type V, alpha 1; pro-al...    50   8e-05
gi|16554579|ref|NP_000084.2| alpha 1 type V collagen preproprote...    50   8e-05
gi|7441219|pir||S18803 collagen alpha 1(V) chain - hamster             50   8e-05
gi|37589348|gb|AAH59289.1| LOC398739 protein [Xenopus laevis]          50   8e-05
gi|1072000|pir||S18251 collagen alpha 1(XI) chain - bovine (frag...    50   8e-05
gi|283868|pir||S28791 collagen alpha 1(XI) chain - chicken (frag...    50   8e-05
gi|2833342|sp|Q28083|CA1B_BOVIN Collagen alpha 1(XI) chain >gnl|...    50   8e-05
gi|6165883|gb|AAF04726.1| collagen type XI alpha-a isoform B [Ho...    50   8e-05
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno...    49   1e-04
gi|14043093|gb|AAH07530.1| EMILIN1 protein [Homo sapiens]              49   1e-04
gi|7656989|ref|NP_056534.1| collagen, type V, alpha 3 preproprot...    49   1e-04
gi|25395729|pir||H88449 protein F54D8.1 [imported] - Caenorhabdi...    49   1e-04
gi|17553572|ref|NP_498086.1| collagen alpha precursor, DumPY : s...    49   1e-04
gi|48140714|ref|XP_393523.1| similar to ENSANGP00000019179 [Apis...    49   1e-04
gi|930045|emb|CAA33387.1| alpha-1 (III) collagen [Homo sapiens]        49   1e-04
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno...    49   1e-04
gi|180879|gb|AAB59383.1| alpha-1 type III collagen                     49   1e-04
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ...    49   1e-04
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ...    49   1e-04
gi|39583250|emb|CAE60042.1| Hypothetical protein CBG03553 [Caeno...    49   1e-04
gi|47228930|emb|CAG09445.1| unnamed protein product [Tetraodon n...    49   1e-04
gi|47215901|emb|CAG12293.1| unnamed protein product [Tetraodon n...    49   1e-04
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par...    49   1e-04
gi|3044185|gb|AAC13303.1| mature parasite-infected erythrocyte s...    49   1e-04
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy...    49   1e-04
gi|39597098|emb|CAE59325.1| Hypothetical protein CBG02667 [Caeno...    49   1e-04
gi|4502959|ref|NP_000384.1| alpha 2 type V collagen preproprotei...    49   1e-04
gi|47228931|emb|CAG09446.1| unnamed protein product [Tetraodon n...    49   1e-04
gi|467517|dbj|BAA04483.1| collagen [Mus musculus]                      49   1e-04
gi|39595659|emb|CAE67161.1| Hypothetical protein CBG12587 [Caeno...    49   1e-04
gi|1340175|emb|CAA28454.1| unnamed protein product [Homo sapiens]      49   1e-04
gi|1167907|gb|AAC52902.1| alpha-1(XVIII) collagen [Mus musculus]       49   1e-04
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c...    49   1e-04
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno...    49   1e-04
gi|42406343|gb|AAH66080.1| Procollagen, type XVIII, alpha 1 [Mus...    49   1e-04
gi|40789282|ref|NP_034059.2| procollagen, type XVIII, alpha 1 [M...    49   1e-04
gi|1167905|gb|AAC52901.1| alpha-1(XVIII) collagen [Mus musculus]       49   1e-04
gi|7446031|pir||A56101 collagen alpha 1(XVIII) chain precursor, ...    49   1e-04
gi|511298|gb|AAA19787.1| alpha 1(XVIII) collagen                       49   1e-04
gi|7446033|pir||B56101 collagen alpha 1(XVIII) chain precursor, ...    49   1e-04
gi|34978363|sp|P39061|CA1H_MOUSE Collagen alpha 1(XVIII) chain p...    49   1e-04
gi|50732527|ref|XP_418677.1| PREDICTED: similar to matrilin 3 pr...    49   1e-04
gi|26327621|dbj|BAC27554.1| unnamed protein product [Mus musculus]     49   1e-04
gi|553894|gb|AAA37434.1| collagen alpha 1 type XVIII                   49   1e-04
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira...    49   1e-04
gi|47222238|emb|CAG11117.1| unnamed protein product [Tetraodon n...    49   1e-04
gi|71414|pir||CGBO2S collagen alpha 2(I) chain - bovine (fragment)     49   1e-04
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit...    49   2e-04
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano...    49   2e-04
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat...    49   2e-04
gi|21231078|ref|NP_636995.1| unknown acidic aa rich protein [Xan...    49   2e-04
gi|23510253|ref|NP_700442.1| procollagen, type XXIII, alpha 1; c...    49   2e-04
gi|31745150|ref|NP_853667.1| procollagen, type XXIII, alpha 1 [R...    49   2e-04
gi|2119163|pir||S59856 collagen alpha 1(III) chain precursor - m...    49   2e-04
gi|26334217|dbj|BAC30826.1| unnamed protein product [Mus musculus]     49   2e-04
gi|5921190|sp|P08121|CA13_MOUSE Collagen alpha 1(III) chain prec...    49   2e-04
gi|33859526|ref|NP_034060.1| procollagen, type III, alpha 1; min...    49   2e-04
gi|26339398|dbj|BAC33370.1| unnamed protein product [Mus musculus]     49   2e-04
gi|20380522|gb|AAH28248.1| Col3a1 protein [Mus musculus]               49   2e-04
gi|24210303|emb|CAD54661.1| SI:dZ12F11.3 (collagen type XI alpha...    49   2e-04
gi|21105299|gb|AAM34599.1| precollagen-NG [Mytilus galloprovinci...    49   2e-04
gi|34868476|ref|XP_216399.2| similar to type XV collagen [Rattus...    49   2e-04
gi|18375520|ref|NP_542196.1| alpha 1 type XI collagen isoform B ...    49   2e-04
gi|23468285|gb|AAH38308.1| C1qtnf7 protein [Mus musculus]              49   2e-04
gi|30425140|ref|NP_780634.1| C1q and tumor necrosis factor relat...    49   2e-04
gi|18375522|ref|NP_542197.1| alpha 1 type XI collagen isoform C ...    49   2e-04
gi|47222135|emb|CAG11561.1| unnamed protein product [Tetraodon n...    49   2e-04
gi|115290|sp|P04258|CA13_BOVIN Collagen alpha 1(III) chain >gnl|...    49   2e-04
gi|15021422|gb|AAK77699.1| ORF30, putative collagen [shrimp whit...    49   2e-04
gi|17158634|ref|NP_477523.1| wsv001 [shrimp white spot syndrome ...    49   2e-04
gi|4379341|emb|CAA08789.1| fibrillar collagen [Podocoryne carnea]      49   2e-04
gi|13937349|ref|NP_034058.1| procollagen, type XV [Mus musculus]...    49   2e-04
gi|11037306|gb|AAG27545.1| type XV collagen [Mus musculus]             49   2e-04
gi|34878304|ref|XP_223507.2| similar to C1qtnf7 protein [Rattus ...    49   2e-04
gi|22832760|gb|AAH13626.1| Col3a1 protein [Mus musculus]               49   2e-04
gi|18375518|ref|NP_001845.2| alpha 1 type XI collagen isoform A ...    49   2e-04
gi|1360670|pir||CGHU1E collagen alpha 1(XI) chain precursor - hu...    49   2e-04
gi|39590860|emb|CAE65233.1| Hypothetical protein CBG10116 [Caeno...    49   2e-04
gi|105709|pir||S20375 collagen alpha 3(V) chain - human (fragments)    49   2e-04
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno...    49   2e-04
gi|47217757|emb|CAG05979.1| unnamed protein product [Tetraodon n...    49   2e-04
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ...    49   2e-04
gi|47216869|emb|CAG11676.1| unnamed protein product [Tetraodon n...    47   2e-04
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (...    48   2e-04
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ...    48   2e-04
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno...    48   2e-04
gi|46228936|gb|EAK89785.1| hypothetical protein with signal pept...    48   2e-04
gi|7512848|pir||T14782 hypothetical protein DKFZp586B0621.1 - hu...    48   2e-04
gi|47221067|emb|CAG12761.1| unnamed protein product [Tetraodon n...    48   2e-04
gi|13620168|emb|CAC36389.1| hypothetical protein [Capsella rubella]    48   2e-04
gi|39583246|emb|CAE60038.1| Hypothetical protein CBG03549 [Caeno...    48   2e-04
gi|32398688|emb|CAD98648.1| retinitis pigmentosa GTPase regulato...    48   2e-04
gi|20810469|gb|AAH29485.1| C1q and tumor necrosis factor related...    48   2e-04
gi|14149712|ref|NP_056460.1| C1q and tumor necrosis factor relat...    48   2e-04
gi|47226324|emb|CAG09292.1| unnamed protein product [Tetraodon n...    48   2e-04
gi|4502961|ref|NP_000085.1| alpha 1 type VII collagen precursor;...    48   2e-04
gi|627406|pir||A54849 collagen alpha 1(VII) chain precursor - human    48   2e-04
gi|16758080|ref|NP_445808.1| procollagen, type I, alpha 2 [Rattu...    48   2e-04
gi|17865659|sp|Q01149|CA21_MOUSE Collagen alpha 2(I) chain precu...    48   2e-04
gi|17508941|ref|NP_491800.1| COLlagen structural gene (col-56) [...    48   2e-04
gi|13235584|emb|CAC33775.1| SclB protein [Streptococcus pyogenes]      48   2e-04
gi|3242649|dbj|BAA29028.1| alpha 1 type I collagen [Rana catesbe...    48   2e-04
gi|27924402|gb|AAH44962.1| LOC397739 protein [Xenopus laevis]          48   2e-04
gi|214044|gb|AAA49679.1| alpha-1 type II' collagen                     48   2e-04
gi|29725624|ref|NP_775736.2| collagen, type XXIII, alpha 1; proc...    48   2e-04
gi|30023|emb|CAA68709.1| unnamed protein product [Homo sapiens]        48   2e-04
gi|85719|pir||A40333 collagen alpha 1'(II) chain precursor - Afr...    48   2e-04
gi|2388555|gb|AAB69977.1| alpha2(I) collagen [Homo sapiens]            48   2e-04
gi|28556885|dbj|BAC57521.1| collagen XVIII homologue [Ciona inte...    48   2e-04
gi|1071999|pir||A55047 collagen alpha 1(V) - chicken (fragment)        48   2e-04
gi|39594122|emb|CAE70232.1| Hypothetical protein CBG16719 [Caeno...    48   2e-04
gi|551558|gb|AAA62386.1| type V collagen                               48   2e-04
gi|47220653|emb|CAG06575.1| unnamed protein product [Tetraodon n...    48   2e-04
gi|115347|sp|P27393|CA24_ASCSU Collagen alpha 2(IV) chain precur...    48   2e-04
gi|33468851|ref|NP_031762.1| procollagen, type IV, alpha 5 [Mus ...    48   2e-04
gi|38014150|gb|AAH08760.3| COL5A1 protein [Homo sapiens]               48   2e-04
gi|29387355|gb|AAH48221.1| COL2A1 protein [Xenopus laevis]             48   2e-04
gi|214042|gb|AAA49678.1| alpha-1 type II collagen                      48   2e-04
gi|104010|pir||B40333 collagen alpha 1(II) chain precursor - Afr...    48   2e-04
gi|27806257|ref|NP_776945.1| collagen, type I, alpha 2 [Bos taur...    48   2e-04
gi|6680980|ref|NP_031769.1| procollagen, type I, alpha 2; osteog...    48   2e-04
gi|27696597|gb|AAH43317.1| Col4a5 protein [Mus musculus]               48   2e-04
gi|728997|sp|Q07092|CA1F_HUMAN Collagen alpha 1(XVI) chain precu...    48   2e-04
gi|18641352|ref|NP_001847.2| alpha 1 type XVI collagen precursor...    48   2e-04
gi|26348681|dbj|BAC37980.1| unnamed protein product [Mus musculus]     48   2e-04
gi|48098607|ref|XP_392097.1| similar to ENSANGP00000016783 [Apis...    48   2e-04
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno...    48   2e-04
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-...    48   2e-04
gi|1070605|pir||CGHU2S collagen alpha 2(I) chain precursor - human     48   2e-04
gi|1418930|emb|CAA98969.1| prepro-alpha2(I) collagen [Homo sapiens]    48   2e-04
gi|32451581|gb|AAH54498.1| Alpha 2 type I collagen [Homo sapiens...    48   2e-04
gi|2735715|gb|AAB93981.1| pro-alpha 2(I) collagen [Homo sapiens]       48   2e-04
gi|179596|gb|AAB59374.1| pre-pro-alpha-2 type I collagen [Homo s...    48   2e-04
gi|8134352|sp|O46392|CA21_CANFA Collagen alpha 2(I) chain precur...    48   2e-04
gi|48762934|ref|NP_000080.2| alpha 2 type I collagen; Collagen I...    48   2e-04
gi|19855162|sp|P08123|CA21_HUMAN Collagen alpha 2(I) chain precu...    48   2e-04
gi|13994280|ref|NP_114117.1| C1q and tumor necrosis factor relat...    48   2e-04
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p...    48   3e-04
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi...    48   3e-04
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal...    48   3e-04
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno...    48   3e-04
gi|38173761|gb|AAH60753.1| MGC69046 protein [Xenopus laevis]           48   3e-04
gi|543912|sp|P13941|CA13_RAT Collagen alpha 1(III) chain >gnl|BL...    48   3e-04
gi|5360532|dbj|BAA82043.1| alpha1 type II collagen [Cynops pyrrh...    48   3e-04
gi|14164347|dbj|BAB55661.1| collagen a1(I) [Oncorhynchus mykiss]       48   3e-04
gi|2493785|sp|Q28247|CA54_CANFA Collagen alpha 5(IV) chain >gnl|...    48   3e-04
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [...    48   3e-04
gi|34875810|ref|XP_343564.1| procollagen, type III, alpha 1 [Rat...    48   3e-04
gi|45361285|ref|NP_989220.1| hypothetical protein MGC75588 [Xeno...    48   3e-04
gi|90387|pir||A27353 collagen alpha 1(III) chain precursor - mou...    48   3e-04
gi|27461187|gb|AAL83712.1| type IV collagen alpha 5 chain [Canis...    48   3e-04
gi|4519617|dbj|BAA75668.1| collagen pro alpha-chain [Haliotis di...    48   3e-04
gi|46372001|gb|AAO33458.2| type IV collagen alpha 5 [Canis famil...    48   3e-04
gi|3513512|gb|AAC33847.1| nongradient byssal precursor [Mytilus ...    48   3e-04
gi|45383309|ref|NP_989757.1| alpha 1 type IIA collagen precursor...    48   3e-04
gi|115268|sp|P02457|CA11_CHICK Collagen alpha 1(I) chain precursor     48   3e-04
gi|39595279|emb|CAE60316.1| Hypothetical protein CBG03907 [Caeno...    48   3e-04
gi|15777923|dbj|BAB68504.1| adipocyte-specific protein 6 [Mus mu...    48   3e-04
gi|71405|pir||CGCH1S collagen alpha 1(I) chain - chicken (tentat...    48   3e-04
gi|12859657|dbj|BAB31724.1| unnamed protein product [Mus musculus]     48   3e-04
gi|31340542|gb|AAO33039.2| alpha 1 type II procollagen [Gallus g...    48   3e-04
gi|47086095|ref|NP_998429.1| zgc:85892 [Danio rerio] >gnl|BL_ORD...    48   3e-04
gi|8393173|ref|NP_058615.1| procollagen, type V, alpha 3; Pro-al...    48   3e-04
gi|3171998|emb|CAA06510.1| collagen alpha 1 (III) [Rattus norveg...    48   3e-04
gi|34864831|ref|XP_217647.2| similar to nongradient byssal precu...    43   3e-04
gi|23510031|ref|NP_702697.1| hypothetical protein [Plasmodium fa...    47   4e-04
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8]                  47   4e-04
gi|532764|gb|AAA21146.1| type XIX collagen                             47   4e-04
gi|21745458|gb|AAM77398.1| fibrillar collagen precursor [Hydra v...    47   4e-04
gi|2119161|pir||I50696 collagen alpha 1(III) chain - chicken (fr...    47   4e-04
gi|50511151|dbj|BAD32561.1| mKIAA1870 protein [Mus musculus]           47   4e-04
gi|975685|emb|CAA62496.1| alpha 1 type XI collagen [Mus musculus]      47   4e-04
gi|34866982|ref|XP_235410.2| similar to alpha 1 type XXII collag...    47   4e-04
gi|28172191|emb|CAD62259.1| bM340H1.1 (novel collagen triple hel...    47   4e-04
gi|11096153|gb|AAG30216.1| collagen-like surface protein [Strept...    47   4e-04
gi|47217441|emb|CAG10210.1| unnamed protein product [Tetraodon n...    47   4e-04
gi|30354436|gb|AAH52161.1| Procollagen, type XI, alpha 1 [Mus mu...    47   4e-04
gi|6680958|ref|NP_031755.1| procollagen, type XI, alpha 1; pro-a...    47   4e-04
gi|13560506|gb|AAK30079.1| collagen-like protein B [Streptococcu...    47   4e-04
gi|10696999|emb|CAC12699.1| dJ376F14.1 (collagen type XIX alpha ...    47   4e-04
gi|11120710|ref|NP_068528.1| collagen, type V, alpha 3; procolla...    47   4e-04
gi|39587623|emb|CAE58561.1| Hypothetical protein CBG01723 [Caeno...    47   4e-04
gi|47778921|ref|NP_001849.2| alpha 1 type XIX collagen precursor...    47   4e-04
gi|34871687|ref|XP_345585.1| similar to alpha 1 type XVI collage...    47   4e-04
gi|624871|dbj|BAA07368.1| a1(XIX) collagen chain precursor [Homo...    47   4e-04
gi|23272263|gb|AAH23940.1| Col16a1 protein [Mus musculus]              47   4e-04
gi|47229954|emb|CAG10368.1| unnamed protein product [Tetraodon n...    47   4e-04
gi|39595642|emb|CAE67144.1| Hypothetical protein CBG12567 [Caeno...    47   4e-04
gi|18157524|dbj|BAB83839.1| collagen type XI alpha 2~partially s...    47   4e-04
gi|17366476|sp|Q14993|CA1I_HUMAN Collagen alpha 1(XIX) chain pre...    47   4e-04
gi|30410760|ref|NP_082542.2| procollagen, type XVI, alpha 1; [a]...    47   4e-04
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno...    47   4e-04
gi|39591344|emb|CAE73397.1| Hypothetical protein CBG20838 [Caeno...    47   4e-04
gi|37202117|ref|NP_079961.2| procollagen, type XXVII, alpha 1 [M...    47   4e-04
gi|50744820|ref|XP_419890.1| PREDICTED: similar to collagen alph...    47   4e-04
gi|28703819|gb|AAH47255.1| Col6a1-prov protein [Xenopus laevis]        47   4e-04
gi|13235586|emb|CAC33776.1| SclB protein [Streptococcus pyogenes]      47   4e-04
gi|47222475|emb|CAG12995.1| unnamed protein product [Tetraodon n...    47   5e-04
gi|34869750|ref|XP_223980.2| similar to RPGR-interacting protein...    47   5e-04
gi|23478621|gb|EAA15657.1| TAP1 protein [Plasmodium yoelii yoelii]     47   5e-04
gi|27661900|ref|XP_236180.1| similar to complement-c1q tumor nec...    47   5e-04


>gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD)
           (col-175) [Caenorhabditis elegans]
 gi|7446022|pir||T15779 hypothetical protein C35B8.1 -
           Caenorhabditis elegans
 gi|746533|gb|AAC46553.1| Collagen protein 175 [Caenorhabditis
           elegans]
          Length = 287

 Score =  296 bits (759), Expect = 3e-79
 Identities = 145/145 (100%), Positives = 145/145 (100%)
 Frame = -1

Query: 864 MTFALTVSCATSAVVITASLCSVLVIMNDINKLSEDISIGMENFKDVSDVAWGNIMVLHG 685
           MTFALTVSCATSAVVITASLCSVLVIMNDINKLSEDISIGMENFKDVSDVAWGNIMVLHG
Sbjct: 1   MTFALTVSCATSAVVITASLCSVLVIMNDINKLSEDISIGMENFKDVSDVAWGNIMVLHG 60

Query: 684 GVRQQSASVHRDVKKLMGINLRNKRNSDSCQCESRAAACPAGSPGEKGEPGLAGLPGPDG 505
           GVRQQSASVHRDVKKLMGINLRNKRNSDSCQCESRAAACPAGSPGEKGEPGLAGLPGPDG
Sbjct: 61  GVRQQSASVHRDVKKLMGINLRNKRNSDSCQCESRAAACPAGSPGEKGEPGLAGLPGPDG 120

Query: 504 EDGKDGAPGVALLVTHDIPGGCIKC 430
           EDGKDGAPGVALLVTHDIPGGCIKC
Sbjct: 121 EDGKDGAPGVALLVTHDIPGGCIKC 145



 Score =  128 bits (322), Expect = 1e-28
 Identities = 55/55 (100%), Positives = 55/55 (100%)
 Frame = -1

Query: 168 KDGSKGNPGDEGRQGHPGKNGRTGAHGKDGAPGKCGKEGPIGPDAGYCQCPSRSN 4
           KDGSKGNPGDEGRQGHPGKNGRTGAHGKDGAPGKCGKEGPIGPDAGYCQCPSRSN
Sbjct: 233 KDGSKGNPGDEGRQGHPGKNGRTGAHGKDGAPGKCGKEGPIGPDAGYCQCPSRSN 287



 Score = 42.4 bits (98), Expect = 0.013
 Identities = 17/28 (60%), Positives = 20/28 (70%)
 Frame = -1

Query: 561 GSPGEKGEPGLAGLPGPDGEDGKDGAPG 478
           G PG++G PG AG PGP GE G+ G PG
Sbjct: 166 GRPGQRGTPGEAGTPGPVGEPGETGGPG 193



 Score = 40.0 bits (92), Expect = 0.066
 Identities = 17/29 (58%), Positives = 19/29 (64%)
 Frame = -1

Query: 564 AGSPGEKGEPGLAGLPGPDGEDGKDGAPG 478
           AG+PG  GEPG  G PGP G  G+ G PG
Sbjct: 177 AGTPGPVGEPGETGGPGPQGRPGQRGEPG 205



 Score = 38.1 bits (87), Expect = 0.25
 Identities = 18/40 (45%), Positives = 21/40 (52%)
 Frame = -1

Query: 162 GSKGNPGDEGRQGHPGKNGRTGAHGKDGAPGKCGKEGPIG 43
           G +G  GD G  G PG  GR G  G    PG+ G  GP+G
Sbjct: 148 GPRGPRGDAGPPGPPGNGGRPGQRG---TPGEAGTPGPVG 184



 Score = 37.7 bits (86), Expect = 0.33
 Identities = 18/40 (45%), Positives = 20/40 (50%)
 Frame = -1

Query: 162 GSKGNPGDEGRQGHPGKNGRTGAHGKDGAPGKCGKEGPIG 43
           G  G PG+ GR G  G  G  G  G  G PG+ G  GP G
Sbjct: 157 GPPGPPGNGGRPGQRGTPGEAGTPGPVGEPGETGGPGPQG 196



 Score = 36.2 bits (82), Expect = 0.95
 Identities = 17/39 (43%), Positives = 20/39 (50%), Gaps = 9/39 (23%)
 Frame = -1

Query: 567 PAGSPGEKGEPGLAGL---------PGPDGEDGKDGAPG 478
           P G PG++GEPG  G          PGP G  G+ G PG
Sbjct: 194 PQGRPGQRGEPGQPGTVHTPGNPGRPGPQGPRGQQGEPG 232



 Score = 36.2 bits (82), Expect = 0.95
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = -1

Query: 162 GSKGNPGDEGRQGHPGKNGRTGAHGKDGAPGKCGKEGPIGP 40
           G  G PG  G  G PG+ G  G  G  G  G+ G+ G  GP
Sbjct: 154 GDAGPPGPPGNGGRPGQRGTPGEAGTPGPVGEPGETGGPGP 194



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 24/57 (42%), Positives = 27/57 (47%), Gaps = 16/57 (28%)
 Frame = -1

Query: 153 GNPGDEGRQGHPGKNGRTGAHGKDGAPG--------------KC--GKEGPIGPDAG 31
           G+PG++G  G  G  G  G  GKDGAPG              KC  G  GP G DAG
Sbjct: 102 GSPGEKGEPGLAGLPGPDGEDGKDGAPGVALLVTHDIPGGCIKCPAGPRGPRG-DAG 157



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 15/28 (53%), Positives = 16/28 (56%)
 Frame = -1

Query: 561 GSPGEKGEPGLAGLPGPDGEDGKDGAPG 478
           G+PGE G PG  G PG  G  G  G PG
Sbjct: 172 GTPGEAGTPGPVGEPGETGGPGPQGRPG 199



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 16/40 (40%), Positives = 19/40 (47%)
 Frame = -1

Query: 162 GSKGNPGDEGRQGHPGKNGRTGAHGKDGAPGKCGKEGPIG 43
           G+ G PG  G  G  G  G  G  G+ G PG  G+ G  G
Sbjct: 163 GNGGRPGQRGTPGEAGTPGPVGEPGETGGPGPQGRPGQRG 202



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 15/28 (53%), Positives = 18/28 (63%)
 Frame = -1

Query: 561 GSPGEKGEPGLAGLPGPDGEDGKDGAPG 478
           G+PG++G  G  G  G  G  GKDGAPG
Sbjct: 238 GNPGDEGRQGHPGKNGRTGAHGKDGAPG 265



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 14/30 (46%), Positives = 19/30 (62%)
 Frame = -1

Query: 567 PAGSPGEKGEPGLAGLPGPDGEDGKDGAPG 478
           P G  G++GEPG  G  G  G++G+ G PG
Sbjct: 221 PQGPRGQQGEPGKDGSKGNPGDEGRQGHPG 250



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 15/27 (55%), Positives = 16/27 (58%)
 Frame = -1

Query: 567 PAGSPGEKGEPGLAGLPGPDGEDGKDG 487
           P G PGE G PG  G PG  GE G+ G
Sbjct: 182 PVGEPGETGGPGPQGRPGQRGEPGQPG 208




[DB home][top]