Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C35D10_9
         (330 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17540424|ref|NP_501808.1| MSP-domain protein like family memb...   174   5e-43
gi|39596794|emb|CAE59021.1| Hypothetical protein CBG02298 [Caeno...   166   8e-41
gi|39591169|emb|CAE73222.1| Hypothetical protein CBG20628 [Caeno...   164   4e-40
gi|39582951|emb|CAE73016.1| Hypothetical protein CBG20377 [Caeno...   164   4e-40
gi|39594026|emb|CAE70136.1| Hypothetical protein CBG16598 [Caeno...   164   5e-40
gi|17542088|ref|NP_501767.1| MSP-domain protein like family memb...   164   5e-40
gi|39591164|emb|CAE73217.1| Hypothetical protein CBG20623 [Caeno...   164   5e-40
gi|17508749|ref|NP_491762.1| Sperm-Specific family, class P SSP-...   163   7e-40
gi|17542086|ref|NP_500697.1| Sperm-Specific family, class P SSP-...   162   1e-39
gi|17508751|ref|NP_491000.1| Sperm-Specific family, class P SSP-...   160   5e-39
gi|39592311|emb|CAE63388.1| Hypothetical protein CBG07809 [Caeno...   122   1e-27
gi|39595357|emb|CAE60394.1| Hypothetical protein CBG03996 [Caeno...   112   1e-24
gi|50511753|gb|AAT77426.1| MSP-domain protein 1 variant [Ascaris...   103   1e-21
gi|50511751|gb|AAT77425.1| MSP-domain protein 1 variant [Ascaris...   103   1e-21
gi|50511755|gb|AAT77427.1| MSP-domain protein 1 variant [Ascaris...   103   1e-21
gi|50511745|gb|AAT77422.1| MSP-domain protein 1 variant [Ascaris...   103   1e-21
gi|49121580|gb|AAN08879.2| MSP-domain protein 1 [Ascaris suum]        103   1e-21
gi|50511749|gb|AAT77424.1| MSP-domain protein 1 variant [Ascaris...   102   1e-21
gi|33114622|gb|AAP94884.1| MFP1-alpha [Ascaris suum]                  101   3e-21
gi|33114624|gb|AAP94885.1| MFP1-beta [Ascaris suum]                   100   1e-20
gi|17562962|ref|NP_506630.1| MSP-domain protein like family memb...    89   2e-17
gi|39591509|emb|CAE73563.1| Hypothetical protein CBG21033 [Caeno...    89   3e-17
gi|17560900|ref|NP_506264.1| predicted CDS, MSP-domain protein 1...    86   1e-16
gi|17509493|ref|NP_493185.1| MSP-domain protein 1 like precursor...    85   3e-16
gi|17561434|ref|NP_506076.1| major sperm protein, member of a la...    85   4e-16
gi|17508753|ref|NP_493318.1| Sperm-Specific family, class P SSP-...    84   7e-16
gi|17544490|ref|NP_501989.1| MSP-domain protein like family memb...    82   2e-15
gi|34810947|pdb|1M1S|A Chain A, Structure Of Wr4, A C.Elegans Ms...    82   2e-15
gi|17542418|ref|NP_501739.1| MSP-domain protein like family memb...    82   3e-15
gi|39592211|emb|CAE75432.1| Hypothetical protein CBG23425 [Caeno...    81   6e-15
gi|17542092|ref|NP_501782.1| Sperm-Specific family, class P SSP-...    80   1e-14
gi|17539024|ref|NP_501124.1| major sperm protein with N myristoy...    77   1e-13
gi|39581884|emb|CAE60778.1| Hypothetical protein CBG04467 [Caeno...    75   2e-13
gi|17542720|ref|NP_501825.1| putative protein family member (4K8...    75   3e-13
gi|39589662|emb|CAE66897.1| Hypothetical protein CBG12279 [Caeno...    74   9e-13
gi|39593130|emb|CAE64599.1| Hypothetical protein CBG09354 [Caeno...    72   2e-12
gi|17538127|ref|NP_496078.1| predicted CDS, MSP-domain protein l...    72   4e-12
gi|17538125|ref|NP_496079.1| predicted CDS, MSP-domain protein l...    71   6e-12
gi|17562648|ref|NP_504485.1| MSP-domain protein like family memb...    67   7e-11
gi|23169000|gb|AAN08881.1| MSP-domain protein 3 [Ascaris suum] >...    64   8e-10
gi|39586995|emb|CAE62930.1| Hypothetical protein CBG07136 [Caeno...    60   8e-09
gi|39594899|emb|CAE70767.1| Hypothetical protein CBG17518 [Caeno...    60   1e-08
gi|17560600|ref|NP_507182.1| MSP-domain protein like family memb...    58   4e-08
gi|17568285|ref|NP_509840.1| predicted CDS, MSP-domain protein l...    57   1e-07
gi|17560040|ref|NP_507098.1| MSP-domain protein like family memb...    57   1e-07
gi|39589763|emb|CAE66998.1| Hypothetical protein CBG12397 [Caeno...    56   2e-07
gi|17558194|ref|NP_506702.1| MSP-domain protein like family memb...    56   2e-07
gi|17558208|ref|NP_506700.1| MSP-domain protein like family memb...    56   2e-07
gi|39595447|emb|CAE60485.1| Hypothetical protein CBG04099 [Caeno...    55   3e-07
gi|39586114|emb|CAE69190.1| Hypothetical protein CBG15225 [Caeno...    55   3e-07
gi|17505881|ref|NP_492824.1| vamp-associated protein like family...    55   3e-07
gi|17507523|ref|NP_492407.1| MSP-domain protein like family memb...    55   3e-07
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb...    54   6e-07
gi|39591787|emb|CAE71365.1| Hypothetical protein CBG18269 [Caeno...    54   8e-07
gi|17554100|ref|NP_499837.1| predicted CDS, major sperm protein ...    54   8e-07
gi|23169006|gb|AAN08882.1| MSP-domain protein 4 [Ascaris suum] >...    52   2e-06
gi|39594090|emb|CAE70200.1| Hypothetical protein CBG16675 [Caeno...    52   2e-06
gi|17552806|ref|NP_498780.1| MSP-domain protein like family memb...    52   3e-06
gi|17557470|ref|NP_506723.1| MSP-domain protein like family memb...    52   4e-06
gi|17558192|ref|NP_506701.1| MSP-domain protein like family memb...    50   1e-05
gi|7496307|pir||T15562 hypothetical protein C18F10.2 - Caenorhab...    49   2e-05
gi|25152845|ref|NP_741183.1| predicted CDS, major sperm protein ...    49   2e-05
gi|17563008|ref|NP_506815.1| predicted CDS, major sperm protein ...    48   4e-05
gi|17540380|ref|NP_501472.1| MSP-domain protein like family memb...    47   9e-05
gi|17509511|ref|NP_491051.1| MSP-domain protein like family memb...    47   1e-04
gi|23169009|gb|AAN08883.1| MSP-domain protein 5 [Ascaris suum] >...    46   2e-04
gi|39582189|emb|CAE71521.1| Hypothetical protein CBG18456 [Caeno...    46   2e-04
gi|17559594|ref|NP_507136.1| MSP-domain protein like (32.2 kD) (...    45   3e-04
gi|39579370|emb|CAE56171.1| Hypothetical protein CBG23791 [Caeno...    45   4e-04
gi|17541248|ref|NP_501765.1| predicted CDS, MSP-domain protein l...    44   6e-04
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno...    43   0.002
gi|39589204|emb|CAE57937.1| Hypothetical protein CBG00991 [Caeno...    41   0.005
gi|7503488|pir||T22235 hypothetical protein F45G2.3 - Caenorhabd...    40   0.009
gi|39582088|emb|CAE63731.1| Hypothetical protein CBG08258 [Caeno...    39   0.034
gi|39593527|emb|CAE61819.1| Hypothetical protein CBG05789 [Caeno...    37   0.13
gi|38083597|ref|XP_128948.2| RIKEN cDNA 2010013H21 [Mus musculus]      36   0.17
gi|26345712|dbj|BAC36507.1| unnamed protein product [Mus musculus]     36   0.17
gi|12842294|dbj|BAB25547.1| unnamed protein product [Mus musculus]     36   0.17
gi|39583643|emb|CAE65747.1| Hypothetical protein CBG10833 [Caeno...    36   0.22
gi|23168994|gb|AAN08880.1| MSP-domain protein 2 [Ascaris suum] >...    36   0.22
gi|7510976|pir||T27729 hypothetical protein ZK1307.4 - Caenorhab...    35   0.37
gi|17505564|ref|NP_491434.1| MSP-domain protein like (19.5 kD) (...    35   0.49
gi|37805977|dbj|BAC99391.1| putative 27k vesicle-associated memb...    33   1.1
gi|38345482|emb|CAE01696.2| OSJNBa0010H02.20 [Oryza sativa (japo...    33   1.4
gi|29246839|gb|EAA38421.1| GLP_510_31960_31247 [Giardia lamblia ...    33   1.4
gi|23483569|gb|EAA19198.1| hypothetical protein [Plasmodium yoel...    33   1.9
gi|39583249|emb|CAE60041.1| Hypothetical protein CBG03552 [Caeno...    33   1.9
gi|34907216|ref|NP_914955.1| P0504E02.2 [Oryza sativa (japonica ...    32   2.4
gi|17544558|ref|NP_500774.1| MSP-domain protein 2 like family me...    32   2.4
gi|17542484|ref|NP_502216.1| MSP-domain protein 2 like family me...    32   2.4
gi|47226997|emb|CAG05889.1| unnamed protein product [Tetraodon n...    32   2.4
gi|29841172|gb|AAP06185.1| similar to GenBank Accession Number U...    32   2.4
gi|33300172|emb|CAE17819.1| Hypothetical protein F52F12.8 [Caeno...    32   2.4
gi|15224067|ref|NP_179963.1| vesicle-associated membrane protein...    32   2.4
gi|45510745|ref|ZP_00163077.1| COG0178: Excinuclease ATPase subu...    32   4.1
gi|39595110|emb|CAE60147.1| Hypothetical protein CBG03696 [Caeno...    32   4.1
gi|17231208|ref|NP_487756.1| excinuclease ABC subunit A [Nostoc ...    32   4.1
gi|39595208|emb|CAE60245.1| Hypothetical protein CBG03818 [Caeno...    32   4.1
gi|39597437|emb|CAE59667.1| Hypothetical protein CBG03087 [Caeno...    32   4.1
gi|27674169|ref|XP_228394.1| similar to vessicle-associated memb...    32   4.1
gi|23509599|ref|NP_702266.1| vesicle-associated membrane protein...    32   4.1
gi|33864534|ref|NP_896094.1| Excinuclease ABC, A subunit, ATP/GT...    31   5.4
gi|50540158|ref|NP_001002546.1| zgc:92788 [Danio rerio] >gnl|BL_...    31   5.4
gi|1373355|gb|AAB02249.1| major sperm protein                          31   5.4
gi|46138433|ref|XP_390907.1| hypothetical protein FG10731.1 [Gib...    31   5.4
gi|23126424|ref|ZP_00108320.1| COG0178: Excinuclease ATPase subu...    31   5.4
gi|32265917|ref|NP_859949.1| conserved hypothetical protein [Hel...    31   7.0
gi|22297728|ref|NP_680975.1| excinuclease ABC subunit A [Thermos...    31   7.0
gi|39595562|emb|CAE60600.1| Hypothetical protein CBG04237 [Caeno...    31   7.0
gi|39591543|emb|CAE71119.1| Hypothetical protein CBG17972 [Caeno...    31   7.0
gi|12055893|emb|CAC20716.1| major sperm protein [Mansonella ozza...    31   7.0
gi|46441797|gb|EAL01091.1| hypothetical protein CaO19.252 [Candi...    31   7.0
gi|14140121|emb|CAC39038.1| putative vesicle-associated membrane...    30   9.2
gi|49387510|dbj|BAD24975.1| putative vesicle-associated membrane...    30   9.2
gi|23473577|ref|ZP_00128873.1| hypothetical protein [Desulfovibr...    30   9.2
gi|1373359|gb|AAB02251.1| major sperm protein                          30   9.2
gi|1373357|gb|AAB02250.1| major sperm protein                          30   9.2
gi|6959522|gb|AAF33139.1| putative acyl-CoA dehydrogenase [Pseud...    30   9.2


>gi|17540424|ref|NP_501808.1| MSP-domain protein like family member
           (11.1 kD) (4K786) [Caenorhabditis elegans]
 gi|17540428|ref|NP_501811.1| MSP-domain protein like family member
           (11.1 kD) (4K795) [Caenorhabditis elegans]
 gi|17540432|ref|NP_501813.1| MSP-domain protein like family member
           (4K799) [Caenorhabditis elegans]
 gi|17552502|ref|NP_498015.1| MSP-domain protein like family member
           (3F958) [Caenorhabditis elegans]
 gi|7503373|pir||T22158 hypothetical protein F44D12.3 -
           Caenorhabditis elegans
 gi|687890|gb|AAA62567.1| Hypothetical protein C35D10.11
           [Caenorhabditis elegans]
 gi|3877150|emb|CAA92599.1| Hypothetical protein F44D12.3
           [Caenorhabditis elegans]
 gi|3877152|emb|CAA92601.1| Hypothetical protein F44D12.5
           [Caenorhabditis elegans]
 gi|3877154|emb|CAA92603.1| Hypothetical protein F44D12.7
           [Caenorhabditis elegans]
          Length = 109

 Score =  174 bits (440), Expect = 5e-43
 Identities = 89/109 (81%), Positives = 89/109 (81%)
 Frame = -1

Query: 330 MSLTADPPACTVPAAGGASTHKLVNAGAEKMIFKIKSSNNNEYRITPVFGFVDPSGSKDI 151
           MSLTADPPACTVPAAGGASTHKLVNAGAEKMIFKIKSSNNNEYRITPVFGFVDPSGSKDI
Sbjct: 1   MSLTADPPACTVPAAGGASTHKLVNAGAEKMIFKIKSSNNNEYRITPVFGFVDPSGSKDI 60

Query: 150 TITRTAGAPKEDKLVVHXXXXXXXXXXXXXXXXXXXXAGTITIPMSATA 4
           TITRTAGAPKEDKLVVH                    AGTITIPMSATA
Sbjct: 61  TITRTAGAPKEDKLVVHFAAAPADATDAQAAFAAITPAGTITIPMSATA 109




[DB home][top]