Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C35D10_9
(330 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17540424|ref|NP_501808.1| MSP-domain protein like family memb... 174 5e-43
gi|39596794|emb|CAE59021.1| Hypothetical protein CBG02298 [Caeno... 166 8e-41
gi|39591169|emb|CAE73222.1| Hypothetical protein CBG20628 [Caeno... 164 4e-40
gi|39582951|emb|CAE73016.1| Hypothetical protein CBG20377 [Caeno... 164 4e-40
gi|39594026|emb|CAE70136.1| Hypothetical protein CBG16598 [Caeno... 164 5e-40
gi|17542088|ref|NP_501767.1| MSP-domain protein like family memb... 164 5e-40
gi|39591164|emb|CAE73217.1| Hypothetical protein CBG20623 [Caeno... 164 5e-40
gi|17508749|ref|NP_491762.1| Sperm-Specific family, class P SSP-... 163 7e-40
gi|17542086|ref|NP_500697.1| Sperm-Specific family, class P SSP-... 162 1e-39
gi|17508751|ref|NP_491000.1| Sperm-Specific family, class P SSP-... 160 5e-39
gi|39592311|emb|CAE63388.1| Hypothetical protein CBG07809 [Caeno... 122 1e-27
gi|39595357|emb|CAE60394.1| Hypothetical protein CBG03996 [Caeno... 112 1e-24
gi|50511753|gb|AAT77426.1| MSP-domain protein 1 variant [Ascaris... 103 1e-21
gi|50511751|gb|AAT77425.1| MSP-domain protein 1 variant [Ascaris... 103 1e-21
gi|50511755|gb|AAT77427.1| MSP-domain protein 1 variant [Ascaris... 103 1e-21
gi|50511745|gb|AAT77422.1| MSP-domain protein 1 variant [Ascaris... 103 1e-21
gi|49121580|gb|AAN08879.2| MSP-domain protein 1 [Ascaris suum] 103 1e-21
gi|50511749|gb|AAT77424.1| MSP-domain protein 1 variant [Ascaris... 102 1e-21
gi|33114622|gb|AAP94884.1| MFP1-alpha [Ascaris suum] 101 3e-21
gi|33114624|gb|AAP94885.1| MFP1-beta [Ascaris suum] 100 1e-20
gi|17562962|ref|NP_506630.1| MSP-domain protein like family memb... 89 2e-17
gi|39591509|emb|CAE73563.1| Hypothetical protein CBG21033 [Caeno... 89 3e-17
gi|17560900|ref|NP_506264.1| predicted CDS, MSP-domain protein 1... 86 1e-16
gi|17509493|ref|NP_493185.1| MSP-domain protein 1 like precursor... 85 3e-16
gi|17561434|ref|NP_506076.1| major sperm protein, member of a la... 85 4e-16
gi|17508753|ref|NP_493318.1| Sperm-Specific family, class P SSP-... 84 7e-16
gi|17544490|ref|NP_501989.1| MSP-domain protein like family memb... 82 2e-15
gi|34810947|pdb|1M1S|A Chain A, Structure Of Wr4, A C.Elegans Ms... 82 2e-15
gi|17542418|ref|NP_501739.1| MSP-domain protein like family memb... 82 3e-15
gi|39592211|emb|CAE75432.1| Hypothetical protein CBG23425 [Caeno... 81 6e-15
gi|17542092|ref|NP_501782.1| Sperm-Specific family, class P SSP-... 80 1e-14
gi|17539024|ref|NP_501124.1| major sperm protein with N myristoy... 77 1e-13
gi|39581884|emb|CAE60778.1| Hypothetical protein CBG04467 [Caeno... 75 2e-13
gi|17542720|ref|NP_501825.1| putative protein family member (4K8... 75 3e-13
gi|39589662|emb|CAE66897.1| Hypothetical protein CBG12279 [Caeno... 74 9e-13
gi|39593130|emb|CAE64599.1| Hypothetical protein CBG09354 [Caeno... 72 2e-12
gi|17538127|ref|NP_496078.1| predicted CDS, MSP-domain protein l... 72 4e-12
gi|17538125|ref|NP_496079.1| predicted CDS, MSP-domain protein l... 71 6e-12
gi|17562648|ref|NP_504485.1| MSP-domain protein like family memb... 67 7e-11
gi|23169000|gb|AAN08881.1| MSP-domain protein 3 [Ascaris suum] >... 64 8e-10
gi|39586995|emb|CAE62930.1| Hypothetical protein CBG07136 [Caeno... 60 8e-09
gi|39594899|emb|CAE70767.1| Hypothetical protein CBG17518 [Caeno... 60 1e-08
gi|17560600|ref|NP_507182.1| MSP-domain protein like family memb... 58 4e-08
gi|17568285|ref|NP_509840.1| predicted CDS, MSP-domain protein l... 57 1e-07
gi|17560040|ref|NP_507098.1| MSP-domain protein like family memb... 57 1e-07
gi|39589763|emb|CAE66998.1| Hypothetical protein CBG12397 [Caeno... 56 2e-07
gi|17558194|ref|NP_506702.1| MSP-domain protein like family memb... 56 2e-07
gi|17558208|ref|NP_506700.1| MSP-domain protein like family memb... 56 2e-07
gi|39595447|emb|CAE60485.1| Hypothetical protein CBG04099 [Caeno... 55 3e-07
gi|39586114|emb|CAE69190.1| Hypothetical protein CBG15225 [Caeno... 55 3e-07
gi|17505881|ref|NP_492824.1| vamp-associated protein like family... 55 3e-07
gi|17507523|ref|NP_492407.1| MSP-domain protein like family memb... 55 3e-07
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 54 6e-07
gi|39591787|emb|CAE71365.1| Hypothetical protein CBG18269 [Caeno... 54 8e-07
gi|17554100|ref|NP_499837.1| predicted CDS, major sperm protein ... 54 8e-07
gi|23169006|gb|AAN08882.1| MSP-domain protein 4 [Ascaris suum] >... 52 2e-06
gi|39594090|emb|CAE70200.1| Hypothetical protein CBG16675 [Caeno... 52 2e-06
gi|17552806|ref|NP_498780.1| MSP-domain protein like family memb... 52 3e-06
gi|17557470|ref|NP_506723.1| MSP-domain protein like family memb... 52 4e-06
gi|17558192|ref|NP_506701.1| MSP-domain protein like family memb... 50 1e-05
gi|7496307|pir||T15562 hypothetical protein C18F10.2 - Caenorhab... 49 2e-05
gi|25152845|ref|NP_741183.1| predicted CDS, major sperm protein ... 49 2e-05
gi|17563008|ref|NP_506815.1| predicted CDS, major sperm protein ... 48 4e-05
gi|17540380|ref|NP_501472.1| MSP-domain protein like family memb... 47 9e-05
gi|17509511|ref|NP_491051.1| MSP-domain protein like family memb... 47 1e-04
gi|23169009|gb|AAN08883.1| MSP-domain protein 5 [Ascaris suum] >... 46 2e-04
gi|39582189|emb|CAE71521.1| Hypothetical protein CBG18456 [Caeno... 46 2e-04
gi|17559594|ref|NP_507136.1| MSP-domain protein like (32.2 kD) (... 45 3e-04
gi|39579370|emb|CAE56171.1| Hypothetical protein CBG23791 [Caeno... 45 4e-04
gi|17541248|ref|NP_501765.1| predicted CDS, MSP-domain protein l... 44 6e-04
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno... 43 0.002
gi|39589204|emb|CAE57937.1| Hypothetical protein CBG00991 [Caeno... 41 0.005
gi|7503488|pir||T22235 hypothetical protein F45G2.3 - Caenorhabd... 40 0.009
gi|39582088|emb|CAE63731.1| Hypothetical protein CBG08258 [Caeno... 39 0.034
gi|39593527|emb|CAE61819.1| Hypothetical protein CBG05789 [Caeno... 37 0.13
gi|38083597|ref|XP_128948.2| RIKEN cDNA 2010013H21 [Mus musculus] 36 0.17
gi|26345712|dbj|BAC36507.1| unnamed protein product [Mus musculus] 36 0.17
gi|12842294|dbj|BAB25547.1| unnamed protein product [Mus musculus] 36 0.17
gi|39583643|emb|CAE65747.1| Hypothetical protein CBG10833 [Caeno... 36 0.22
gi|23168994|gb|AAN08880.1| MSP-domain protein 2 [Ascaris suum] >... 36 0.22
gi|7510976|pir||T27729 hypothetical protein ZK1307.4 - Caenorhab... 35 0.37
gi|17505564|ref|NP_491434.1| MSP-domain protein like (19.5 kD) (... 35 0.49
gi|37805977|dbj|BAC99391.1| putative 27k vesicle-associated memb... 33 1.1
gi|38345482|emb|CAE01696.2| OSJNBa0010H02.20 [Oryza sativa (japo... 33 1.4
gi|29246839|gb|EAA38421.1| GLP_510_31960_31247 [Giardia lamblia ... 33 1.4
gi|23483569|gb|EAA19198.1| hypothetical protein [Plasmodium yoel... 33 1.9
gi|39583249|emb|CAE60041.1| Hypothetical protein CBG03552 [Caeno... 33 1.9
gi|34907216|ref|NP_914955.1| P0504E02.2 [Oryza sativa (japonica ... 32 2.4
gi|17544558|ref|NP_500774.1| MSP-domain protein 2 like family me... 32 2.4
gi|17542484|ref|NP_502216.1| MSP-domain protein 2 like family me... 32 2.4
gi|47226997|emb|CAG05889.1| unnamed protein product [Tetraodon n... 32 2.4
gi|29841172|gb|AAP06185.1| similar to GenBank Accession Number U... 32 2.4
gi|33300172|emb|CAE17819.1| Hypothetical protein F52F12.8 [Caeno... 32 2.4
gi|15224067|ref|NP_179963.1| vesicle-associated membrane protein... 32 2.4
gi|45510745|ref|ZP_00163077.1| COG0178: Excinuclease ATPase subu... 32 4.1
gi|39595110|emb|CAE60147.1| Hypothetical protein CBG03696 [Caeno... 32 4.1
gi|17231208|ref|NP_487756.1| excinuclease ABC subunit A [Nostoc ... 32 4.1
gi|39595208|emb|CAE60245.1| Hypothetical protein CBG03818 [Caeno... 32 4.1
gi|39597437|emb|CAE59667.1| Hypothetical protein CBG03087 [Caeno... 32 4.1
gi|27674169|ref|XP_228394.1| similar to vessicle-associated memb... 32 4.1
gi|23509599|ref|NP_702266.1| vesicle-associated membrane protein... 32 4.1
gi|33864534|ref|NP_896094.1| Excinuclease ABC, A subunit, ATP/GT... 31 5.4
gi|50540158|ref|NP_001002546.1| zgc:92788 [Danio rerio] >gnl|BL_... 31 5.4
gi|1373355|gb|AAB02249.1| major sperm protein 31 5.4
gi|46138433|ref|XP_390907.1| hypothetical protein FG10731.1 [Gib... 31 5.4
gi|23126424|ref|ZP_00108320.1| COG0178: Excinuclease ATPase subu... 31 5.4
gi|32265917|ref|NP_859949.1| conserved hypothetical protein [Hel... 31 7.0
gi|22297728|ref|NP_680975.1| excinuclease ABC subunit A [Thermos... 31 7.0
gi|39595562|emb|CAE60600.1| Hypothetical protein CBG04237 [Caeno... 31 7.0
gi|39591543|emb|CAE71119.1| Hypothetical protein CBG17972 [Caeno... 31 7.0
gi|12055893|emb|CAC20716.1| major sperm protein [Mansonella ozza... 31 7.0
gi|46441797|gb|EAL01091.1| hypothetical protein CaO19.252 [Candi... 31 7.0
gi|14140121|emb|CAC39038.1| putative vesicle-associated membrane... 30 9.2
gi|49387510|dbj|BAD24975.1| putative vesicle-associated membrane... 30 9.2
gi|23473577|ref|ZP_00128873.1| hypothetical protein [Desulfovibr... 30 9.2
gi|1373359|gb|AAB02251.1| major sperm protein 30 9.2
gi|1373357|gb|AAB02250.1| major sperm protein 30 9.2
gi|6959522|gb|AAF33139.1| putative acyl-CoA dehydrogenase [Pseud... 30 9.2
>gi|17540424|ref|NP_501808.1| MSP-domain protein like family member
(11.1 kD) (4K786) [Caenorhabditis elegans]
gi|17540428|ref|NP_501811.1| MSP-domain protein like family member
(11.1 kD) (4K795) [Caenorhabditis elegans]
gi|17540432|ref|NP_501813.1| MSP-domain protein like family member
(4K799) [Caenorhabditis elegans]
gi|17552502|ref|NP_498015.1| MSP-domain protein like family member
(3F958) [Caenorhabditis elegans]
gi|7503373|pir||T22158 hypothetical protein F44D12.3 -
Caenorhabditis elegans
gi|687890|gb|AAA62567.1| Hypothetical protein C35D10.11
[Caenorhabditis elegans]
gi|3877150|emb|CAA92599.1| Hypothetical protein F44D12.3
[Caenorhabditis elegans]
gi|3877152|emb|CAA92601.1| Hypothetical protein F44D12.5
[Caenorhabditis elegans]
gi|3877154|emb|CAA92603.1| Hypothetical protein F44D12.7
[Caenorhabditis elegans]
Length = 109
Score = 174 bits (440), Expect = 5e-43
Identities = 89/109 (81%), Positives = 89/109 (81%)
Frame = -1
Query: 330 MSLTADPPACTVPAAGGASTHKLVNAGAEKMIFKIKSSNNNEYRITPVFGFVDPSGSKDI 151
MSLTADPPACTVPAAGGASTHKLVNAGAEKMIFKIKSSNNNEYRITPVFGFVDPSGSKDI
Sbjct: 1 MSLTADPPACTVPAAGGASTHKLVNAGAEKMIFKIKSSNNNEYRITPVFGFVDPSGSKDI 60
Query: 150 TITRTAGAPKEDKLVVHXXXXXXXXXXXXXXXXXXXXAGTITIPMSATA 4
TITRTAGAPKEDKLVVH AGTITIPMSATA
Sbjct: 61 TITRTAGAPKEDKLVVHFAAAPADATDAQAAFAAITPAGTITIPMSATA 109