Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C36A4_11
(606 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17553058|ref|NP_497783.1| ribosomal Protein, Large subunit (4... 384 e-106
gi|39583296|emb|CAE60088.1| Hypothetical protein CBG03612 [Caeno... 379 e-104
gi|31340335|sp|Q9NBK4|RL3_CAEBR 60S ribosomal protein L3 >gnl|BL... 379 e-104
gi|1350745|sp|P49149|RL3_TOXCA 60S RIBOSOMAL PROTEIN L3 >gnl|BL_... 319 3e-86
gi|50507483|emb|CAH04729.1| Hypothetical protein F13B10.2c [Caen... 317 1e-85
gi|18253047|gb|AAL62468.1| ribosomal protein L3 [Spodoptera frug... 311 5e-84
gi|27769202|gb|AAH42242.1| Rpl3-prov protein [Xenopus laevis] 306 2e-82
gi|4506649|ref|NP_000958.1| ribosomal protein L3; 60S ribosomal ... 304 1e-81
gi|14250148|gb|AAH08492.1| Ribosomal protein L3 [Homo sapiens] 304 1e-81
gi|347964|gb|AAA91344.1| TARBP-b gene product 303 2e-81
gi|27807287|ref|NP_777140.1| ribosomal protein L3 [Bos taurus] >... 302 3e-81
gi|7159574|emb|CAB76199.1| ribosomal protein L3 [Bos taurus] 302 3e-81
gi|50728722|ref|XP_416252.1| PREDICTED: similar to ribosomal pro... 300 1e-80
gi|38454246|ref|NP_942048.1| ribosomal protein L3 [Rattus norveg... 298 4e-80
gi|16307136|gb|AAH09655.1| Ribosomal protein L3 [Mus musculus] >... 298 4e-80
gi|7305441|ref|NP_038790.1| ribosomal protein L3; ribosomal prot... 298 4e-80
gi|22203712|gb|AAM94270.1| ribosomal protein L3 [Chlamys farreri] 297 9e-80
gi|48597014|ref|NP_001001590.1| ribosomal protein L3 [Danio reri... 296 2e-79
gi|47217938|emb|CAG02221.1| unnamed protein product [Tetraodon n... 295 4e-79
gi|15293867|gb|AAK95126.1| ribosomal protein L3 [Ictalurus punct... 294 8e-79
gi|337580|gb|AAA60291.1| ribosomal protein L3 293 1e-78
gi|17737907|ref|NP_524316.1| CG4863-PA [Drosophila melanogaster]... 293 2e-78
gi|40882439|gb|AAR96131.1| RH62603p [Drosophila melanogaster] 293 2e-78
gi|50755665|ref|XP_414843.1| PREDICTED: similar to 60S ribosomal... 287 9e-77
gi|31208673|ref|XP_313303.1| ENSANGP00000011028 [Anopheles gambi... 286 2e-76
gi|29841161|gb|AAP06174.1| similar to GenBank Accession Number A... 278 7e-74
gi|34870528|ref|XP_213231.2| similar to 60S ribosomal protein L3... 274 8e-73
gi|4826988|ref|NP_005052.1| ribosomal protein L3-like; 60S ribos... 274 1e-72
gi|14336774|gb|AAK61301.1| 60S ribosomal protein L3 like [Homo s... 272 4e-72
gi|24645877|ref|NP_731548.1| CG4863-PB [Drosophila melanogaster]... 267 1e-70
gi|19115692|ref|NP_594780.1| 60s ribosomal protein L3 [Schizosac... 265 4e-70
gi|45188079|ref|NP_984302.1| ADR206Wp [Eremothecium gossypii] >g... 265 4e-70
gi|19114383|ref|NP_593471.1| 60s ribosomal protein L3 [Schizosac... 265 5e-70
gi|50411414|ref|XP_457044.1| unnamed protein product [Debaryomyc... 263 2e-69
gi|46431906|gb|EAK91425.1| hypothetical protein CaO19.9169 [Cand... 263 2e-69
gi|1197059|gb|AAA88732.1| ribosomal protein L3 263 2e-69
gi|6324637|ref|NP_014706.1| Protein component of the large (60S)... 263 2e-69
gi|50288047|ref|XP_446452.1| unnamed protein product [Candida gl... 262 3e-69
gi|49258841|pdb|1S1I|C Chain C, Structure Of The Ribosomal 80s-E... 261 9e-69
gi|37625023|gb|AAQ96335.1| ribosomal protein L3A [Nicotiana taba... 259 3e-68
gi|15220533|ref|NP_176352.1| 60S ribosomal protein L3 (RPL3B) [A... 259 3e-68
gi|81658|pir||JQ0772 ribosomal protein L3.e (clone ARP2), cytoso... 259 3e-68
gi|47218047|emb|CAG11452.1| unnamed protein product [Tetraodon n... 259 3e-68
gi|18606060|gb|AAH22790.1| Unknown (protein for IMAGE:3538792) [... 258 5e-68
gi|6683575|dbj|BAA89259.1| ribosomal protein L3 [Bombyx mori] 258 5e-68
gi|38327504|gb|AAR17783.1| ribosomal protein L3 [Lycopersicon es... 258 8e-68
gi|34933465|ref|XP_228774.2| similar to 60S RIBOSOMAL PROTEIN L3... 258 8e-68
gi|50311593|ref|XP_455822.1| unnamed protein product [Kluyveromy... 257 1e-67
gi|15218306|ref|NP_175009.1| 60S ribosomal protein L3 (RPL3A) [A... 257 1e-67
gi|50549253|ref|XP_502097.1| hypothetical protein [Yarrowia lipo... 256 2e-67
gi|81657|pir||JQ0771 ribosomal protein L3.e (clone ARP1), cytoso... 256 2e-67
gi|50255373|gb|EAL18108.1| hypothetical protein CNBK1290 [Crypto... 256 2e-67
gi|23397228|gb|AAN31896.1| putative ribosomal protein [Arabidops... 255 4e-67
gi|6688812|emb|CAB65281.1| L3 Ribosomal protein [Medicago sativa... 254 7e-67
gi|548770|sp|P35684|RL3_ORYSA 60S RIBOSOMAL PROTEIN L3 >gnl|BL_O... 253 3e-66
gi|33526886|gb|AAQ21397.1| ribosomal protein L3 [Triticum aestiv... 251 1e-65
gi|33526877|gb|AAQ21396.1| ribosomal protein L3 [Triticum aestiv... 250 1e-65
gi|38076882|ref|XP_142485.2| similar to 60S RIBOSOMAL PROTEIN L3... 250 1e-65
gi|37625025|gb|AAQ96336.1| ribosomal protein L3B [Nicotiana taba... 248 5e-65
gi|34105768|gb|AAQ62075.1| ribosomal protein L3 [Triticum aestiv... 248 6e-65
gi|38083508|ref|XP_144157.3| similar to Ribosomal protein L3 [Mu... 248 8e-65
gi|38093432|ref|XP_142323.2| similar to 60S RIBOSOMAL PROTEIN L3... 248 8e-65
gi|6537320|gb|AAF15600.1| 60S ribosomal protein L3 [Emericella n... 248 8e-65
gi|21215170|gb|AAM43909.1| large subunit ribosomal protein L3 [A... 246 3e-64
gi|464637|sp|P34113|RL3_DICDI 60S ribosomal protein L3 >gnl|BL_O... 245 4e-64
gi|49074688|ref|XP_401461.1| hypothetical protein UM03846.1 [Ust... 241 6e-63
gi|38078646|ref|XP_124310.2| similar to Ribosomal protein L3 [Mu... 241 6e-63
gi|30580497|sp|P59671|RL3_NEUCR 60S ribosomal protein L3 >gnl|BL... 241 6e-63
gi|3861468|emb|CAA10068.1| ribosomal protein L3 [Tetrahymena the... 231 1e-59
gi|37909690|gb|AAP23996.1| ribosomal protein L3B; RPL3B [Oryza s... 229 2e-59
gi|49097758|ref|XP_410339.1| RL3_NEUCR 60S ribosomal protein L3 ... 227 1e-58
gi|23508075|ref|NP_700745.1| ribosomal protein L3, putative [Pla... 225 4e-58
gi|46123823|ref|XP_386465.1| RL3_NEUCR 60S ribosomal protein L3 ... 224 1e-57
gi|7417236|gb|AAF62506.1| ribosomal protein L3 [Trypanoplasma bo... 223 2e-57
gi|38089394|ref|XP_146439.2| similar to Ribosomal protein L3 [Mu... 222 4e-57
gi|32413298|ref|XP_327129.1| hypothetical protein ( (AF198447) 6... 220 2e-56
gi|23481819|gb|EAA17982.1| ribosomal protein L3, putative [Plasm... 216 3e-55
gi|7159730|emb|CAB76201.1| ribosomal protein L3 [Homo sapiens] 208 7e-53
gi|24645875|ref|NP_731547.1| CG4863-PD [Drosophila melanogaster]... 204 1e-51
gi|37545947|ref|XP_085138.2| similar to ribosomal protein L3; 60... 197 2e-49
gi|38087061|ref|XP_359338.1| similar to Ribosomal protein L3 [Mu... 189 3e-47
gi|29249038|gb|EAA40558.1| GLP_609_11091_9901 [Giardia lamblia A... 182 4e-45
gi|13812060|ref|NP_113196.1| 60S ribosomal protein L3 [Guillardi... 181 7e-45
gi|24645881|ref|NP_731550.1| CG4863-PC [Drosophila melanogaster]... 174 9e-43
gi|26245428|gb|AAN77574.1| ribosomal protein L3 [Fundulus hetero... 169 4e-41
gi|8572163|gb|AAF77033.1| ribosomal protein L3 [Caenorhabditis r... 158 7e-38
gi|19173079|ref|NP_597630.1| 60S RIBOSOMAL PROTEIN L3 [Encephali... 154 2e-36
gi|50507482|emb|CAH04728.1| Hypothetical protein F13B10.2d [Caen... 137 2e-31
gi|48257062|gb|AAH04323.2| RPL3 protein [Homo sapiens] 122 7e-27
gi|38084948|ref|XP_355796.1| similar to 60S RIBOSOMAL PROTEIN L3... 108 8e-23
gi|38075077|ref|XP_354772.1| similar to 60S RIBOSOMAL PROTEIN L3... 107 1e-22
gi|45359106|ref|NP_988663.1| LSU Ribosomal protein L3P [Methanoc... 103 2e-21
gi|38093440|ref|XP_358035.1| similar to 60S RIBOSOMAL PROTEIN L3... 101 1e-20
gi|14600545|ref|NP_147062.1| 50S ribosomal protein L3 [Aeropyrum... 100 2e-20
gi|9910844|sp|Q9UWG2|RL3_METVA 50S ribosomal protein L3P 100 2e-20
gi|15790632|ref|NP_280456.1| 50S ribosomal protein L13P; Rpl3p [... 99 6e-20
gi|11499509|ref|NP_070750.1| LSU ribosomal protein L3P (rpl3P) [... 97 2e-19
gi|14278035|pdb|1GIY|E Chain E, Crystal Structure Of The Ribosom... 94 2e-18
gi|15668348|ref|NP_247144.1| LSU ribosomal protein L3P (rplC) [M... 93 3e-18
gi|50513471|pdb|1S72|B Chain B, Refined Crystal Structure Of The... 92 6e-18
gi|71097|pir||R5HS3L ribosomal protein L3 [similarity] - Haloarc... 92 6e-18
gi|15825944|pdb|1JJ2|B Chain B, Fully Refined Crystal Structure ... 92 6e-18
gi|13432202|sp|P20279|RL3_HALMA 50S ribosomal protein L3P (Hmal3... 92 6e-18
gi|27066406|pdb|1FFK|B Chain B, Crystal Structure Of The Large R... 91 2e-17
gi|15897623|ref|NP_342228.1| LSU ribosomal protein L3AB (rpl3AB)... 91 2e-17
gi|20093853|ref|NP_613700.1| Ribosomal protein L3 [Methanopyrus ... 91 2e-17
gi|14520558|ref|NP_126033.1| LSU ribosomal protein L3P [Pyrococc... 89 6e-17
gi|15920641|ref|NP_376310.1| 343aa long hypothetical 50S ribosom... 88 1e-16
gi|15678033|ref|NP_275147.1| ribosomal protein L3 (E.coli L3) [M... 87 2e-16
gi|548769|sp|Q06844|RL3_HALSA 50S ribosomal protein L3P >gnl|BL_... 86 5e-16
gi|14591535|ref|NP_143617.1| 50S ribosomal protein L3 [Pyrococcu... 84 3e-15
gi|18978197|ref|NP_579554.1| LSU ribosomal protein L3P [Pyrococc... 80 3e-14
gi|20089942|ref|NP_616017.1| ribosomal protein L3p [Methanosarci... 78 1e-13
gi|21228226|ref|NP_634148.1| LSU ribosomal protein L3P [Methanos... 77 3e-13
gi|48477712|ref|YP_023418.1| large subunit ribosomal protein L3P... 76 6e-13
gi|18313001|ref|NP_559668.1| ribosomal protein L3 [Pyrobaculum a... 75 7e-13
gi|22758910|gb|AAN05614.1| ribosomal protein L3 [Argopecten irra... 75 1e-12
gi|46141875|ref|ZP_00147370.2| COG0087: Ribosomal protein L3 [Me... 74 3e-12
gi|42657310|ref|XP_035299.4| zinc finger, SWIM domain containing... 73 4e-12
gi|41615218|ref|NP_963716.1| NEQ433 [Nanoarchaeum equitans Kin4-... 67 3e-10
gi|48852526|ref|ZP_00306712.1| COG0087: Ribosomal protein L3 [Fe... 60 2e-08
gi|16082270|ref|NP_394728.1| 50S ribosomal protein L3 related pr... 59 7e-08
gi|13541155|ref|NP_110843.1| 50S ribosomal protein L3 [Thermopla... 59 9e-08
gi|48838683|ref|ZP_00295623.1| COG0087: Ribosomal protein L3 [Me... 49 7e-05
gi|13384820|ref|NP_079701.1| ribosomal protein L3-like [Mus musc... 48 1e-04
gi|40641603|emb|CAE54281.1| putative ribosomal protein [Triticum... 48 2e-04
gi|13517923|gb|AAK29057.1| L3 ribosomal protein [Lolium perenne] 42 0.012
gi|5762260|dbj|BAA83471.1| Csf-3 [Cucumis sativus] 41 0.015
gi|3642669|gb|AAC36524.1| ribosomal protein L3 [Mus musculus] 38 0.17
gi|26330570|dbj|BAC29015.1| unnamed protein product [Mus musculu... 37 0.22
gi|48833549|ref|ZP_00290567.1| COG3635: Predicted phosphoglycera... 33 3.2
gi|19715659|gb|AAL91653.1| polymeric immunoglobulin receptor [Ca... 33 4.1
gi|50256812|gb|EAL19530.1| hypothetical protein CNBG1590 [Crypto... 33 5.4
gi|30584537|gb|AAP36521.1| Homo sapiens bridging integrator 1 [s... 32 9.2
gi|21536409|ref|NP_647597.1| bridging integrator 1 isoform 5; am... 32 9.2
gi|21536404|ref|NP_647595.1| bridging integrator 1 isoform 3; am... 32 9.2
gi|21536402|ref|NP_647594.1| bridging integrator 1 isoform 2; am... 32 9.2
gi|3387948|gb|AAC28646.1| amphiphysin II [Homo sapiens] 32 9.2
gi|20808702|ref|NP_623873.1| Ribonucleotide reductase alpha subu... 32 9.2
gi|2160719|gb|AAB63263.1| amphiphysin II [Homo sapiens] 32 9.2
gi|24665977|ref|NP_648992.1| CG6311-PB [Drosophila melanogaster]... 32 9.2
gi|21536400|ref|NP_647593.1| bridging integrator 1 isoform 1; am... 32 9.2
gi|17862480|gb|AAL39717.1| LD31122p [Drosophila melanogaster] 32 9.2
gi|21536417|ref|NP_647601.1| bridging integrator 1 isoform 10; a... 32 9.2
gi|21536413|ref|NP_647599.1| bridging integrator 1 isoform 7; am... 32 9.2
gi|17385936|gb|AAL38509.1| amphiphysin IIb-1 [Homo sapiens] 32 9.2
gi|3249632|gb|AAC24126.1| bridging-integrator protein-1 isoform ... 32 9.2
gi|13278633|gb|AAH04101.1| Bridging integrator 1, isoform 9 [Hom... 32 9.2
gi|21536415|ref|NP_647600.1| bridging integrator 1 isoform 9; am... 32 9.2
gi|49475870|ref|YP_033911.1| hypothetical protein BH11410 [Barto... 32 9.2
gi|16648380|gb|AAL25455.1| LD37618p [Drosophila melanogaster] 32 9.2
gi|3242002|gb|AAC23750.1| bridging-integrator protein-1 isoform ... 32 9.2
gi|21536411|ref|NP_647598.1| bridging integrator 1 isoform 6; am... 32 9.2
>gi|17553058|ref|NP_497783.1| ribosomal Protein, Large subunit (45.7
kD) (rpl-3) [Caenorhabditis elegans]
gi|1710557|sp|P50880|RL3_CAEEL 60S ribosomal protein L3
gi|7498976|pir||T19771 hypothetical protein F13B10.2 -
Caenorhabditis elegans
gi|1181129|emb|CAA93269.1| ribosomal protein L3 [Caenorhabditis
elegans]
gi|1181131|emb|CAA93268.1| ribosomal protein L3 [Caenorhabditis
elegans]
gi|3874745|emb|CAA91277.1| Hypothetical protein F13B10.2a
[Caenorhabditis elegans]
gi|3875827|emb|CAA90183.1| C. elegans RPL-3 protein (corresponding
sequence F13B10.2a) [Caenorhabditis elegans]
Length = 401
Score = 384 bits (986), Expect = e-106
Identities = 188/202 (93%), Positives = 188/202 (93%)
Frame = +1
Query: 1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDV 180
MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDV
Sbjct: 1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDV 60
Query: 181 DKPGSKVNKKEVVEAVTIVETPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYS 360
DKPGSKVNKKEVVEAVTIVETPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYS
Sbjct: 61 DKPGSKVNKKEVVEAVTIVETPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYS 120
Query: 361 NWXXXXXXXXXXXXXXWQDEDGKKLIEADFAKLKKYCSSIRVIAHTQMKILRRRQKKAHL 540
NW WQDEDGKKLIEADFAKLKKYCSSIRVIAHTQMKILRRRQKKAHL
Sbjct: 121 NWAKSKKKAFTKYAKKWQDEDGKKLIEADFAKLKKYCSSIRVIAHTQMKILRRRQKKAHL 180
Query: 541 VEIQVNGGTIEQKVDWAREHLE 606
VEIQVNGGTIEQKVDWAREHLE
Sbjct: 181 VEIQVNGGTIEQKVDWAREHLE 202