Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C37A5_1
(576 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17505945|ref|NP_493469.1| putative protein (21.3 kD) (1O746) ... 308 6e-83
gi|17505943|ref|NP_493470.1| putative protein (1O749) [Caenorhab... 295 5e-79
gi|17505949|ref|NP_493471.1| predicted CDS, putative secreted or... 48 1e-04
gi|46142430|ref|ZP_00149113.2| hypothetical protein Mbur020115 [... 43 0.004
gi|7108938|gb|AAF36549.1| 87-kDa surface lipoprotein precursor [... 42 0.010
gi|15239193|ref|NP_199130.1| expressed protein [Arabidopsis thal... 42 0.010
gi|7108933|gb|AAF36546.1| 87-kDa surface lipoprotein precursor [... 42 0.010
gi|24286587|gb|AAN46652.1| M protein precursor [Streptococcus py... 40 0.023
gi|486711|pir||S34978 M1.1 protein precursor - Streptococcus pyo... 39 0.051
gi|48838681|ref|ZP_00295621.1| hypothetical protein Meth02003245... 39 0.067
gi|32414727|ref|XP_327843.1| predicted protein [Neurospora crass... 39 0.088
gi|19909186|gb|AAM03151.1| translocated promoter region protein ... 38 0.11
gi|23486190|gb|EAA20743.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [... 38 0.11
gi|27477057|ref|NP_598541.2| translocated promoter region protei... 38 0.11
gi|24650843|ref|NP_651624.2| CG10011-PA [Drosophila melanogaster... 38 0.15
gi|17862878|gb|AAL39916.1| SD01389p [Drosophila melanogaster] 38 0.15
gi|7108927|gb|AAF36543.1| 46-kDa surface lipoprotein precursor [... 38 0.15
gi|7108931|gb|AAF36545.1| 57-kDa surface lipoprotein precursor [... 37 0.20
gi|23508973|ref|NP_701641.1| hypothetical protein [Plasmodium fa... 37 0.20
gi|9631305|ref|NP_048116.1| ORF MSV045 hypothetical protein [Mel... 37 0.26
gi|3746909|gb|AAC64112.1| M protein [Streptococcus pyogenes] 37 0.33
gi|20809892|gb|AAH29127.1| LOC214368 protein [Mus musculus] 37 0.33
gi|24286597|gb|AAN46657.1| M protein precursor [Streptococcus py... 36 0.43
gi|48101374|ref|XP_395113.1| similar to CG18076-PH [Apis mellifera] 36 0.43
gi|38088420|ref|XP_142533.2| similar to DKFZP572C163 protein [Mu... 36 0.43
gi|19908277|gb|AAL99243.1| M protein precursor [Streptococcus py... 36 0.43
gi|50548613|ref|XP_501776.1| hypothetical protein [Yarrowia lipo... 36 0.57
gi|47226978|emb|CAG05870.1| unnamed protein product [Tetraodon n... 36 0.57
gi|7485968|pir||T05576 hypothetical protein F22K18.220 - Arabido... 36 0.57
gi|42561518|ref|NP_975969.1| Hypothetical protein MSC_1004 [Myco... 36 0.57
gi|17505296|ref|NP_492804.1| putative nuclear protein family mem... 36 0.57
gi|643548|gb|AAA85108.1| M1.1 protein 36 0.57
gi|9910552|ref|NP_064475.1| sodium/calcium/potassium exchanger [... 35 0.74
gi|643550|gb|AAA85109.1| M1.2 protein with 21-bp insert 35 0.74
gi|19908279|gb|AAL99244.1| M protein precursor [Streptococcus py... 35 0.74
gi|19908269|gb|AAL99239.1| M protein precursor [Streptococcus py... 35 0.74
gi|23335484|ref|ZP_00120719.1| hypothetical protein Blon020592 [... 35 0.97
gi|15788954|gb|AAL08014.1| defective chorion-1 fc177 protein pre... 35 0.97
gi|20987768|gb|AAH29834.1| Tpr protein [Mus musculus] 35 0.97
gi|15788958|gb|AAL08016.1| defective chorion-1 fc125 protein pre... 35 0.97
gi|34873655|ref|XP_220938.2| similar to RIKEN cDNA 4631426H08 [R... 35 0.97
gi|15788956|gb|AAL08015.1| defective chorion-1 fc106 protein pre... 35 0.97
gi|23466357|ref|NP_696960.1| hypothetical protein BL1813 [Bifido... 35 0.97
gi|11024712|ref|NP_060003.1| myosin, heavy polypeptide 4, skelet... 35 1.3
gi|23023431|ref|ZP_00062667.1| COG0552: Signal recognition parti... 35 1.3
gi|34762922|ref|ZP_00143903.1| Hemolysin [Fusobacterium nucleatu... 35 1.3
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc... 35 1.3
gi|34877946|ref|XP_237588.2| similar to KIAA0874 protein [Rattus... 35 1.3
gi|28828350|gb|AAL93017.2| hypothetical protein [Dictyostelium d... 35 1.3
gi|46485052|tpg|DAA04463.1| TPA: type I keratin KA39 [Rattus nor... 35 1.3
gi|30525885|gb|AAP32473.1| M protein [Streptococcus pyogenes] 35 1.3
gi|19908275|gb|AAL99240.1| M protein precursor [Streptococcus py... 35 1.3
gi|19908273|gb|AAL99242.1| M protein precursor [Streptococcus py... 35 1.3
gi|98063|pir||S01260 M protein precursor - Streptococcus pyogene... 34 1.7
gi|49479806|ref|YP_035315.1| conserved hypothetical protein [Bac... 34 1.7
gi|1084196|pir||S46489 M1 protein precursor - Streptococcus pyog... 34 1.7
gi|24286607|gb|AAN46662.1| M protein precursor [Streptococcus py... 34 1.7
gi|421440|pir||S35401 M1 protein precursor - Streptococcus pyoge... 34 1.7
gi|17554190|ref|NP_498069.1| kinesin-like protein (103.5 kD) (kl... 34 1.7
gi|42520218|ref|NP_966133.1| hypothetical protein WD0335 [Wolbac... 34 1.7
gi|13376818|ref|NP_079490.1| CTCL tumor antigen se57-1 [Homo sap... 34 1.7
gi|34485640|gb|AAQ73205.1| M protein [Streptococcus pyogenes] 34 1.7
gi|33598982|gb|AAQ23116.1| M1 protein [Streptococcus pyogenes] 34 1.7
gi|22087668|gb|AAM90997.1| hemolysin [Fusobacterium nucleatum] 34 1.7
gi|46114692|ref|XP_383364.1| hypothetical protein FG03188.1 [Gib... 34 1.7
gi|48120927|ref|XP_396472.1| similar to CG33103-PA [Apis mellifera] 34 1.7
gi|7512088|pir||T30282 calcium-binding protein - sea urchin (Str... 34 1.7
gi|125086|sp|P08728|K1CS_BOVIN Keratin, type I cytoskeletal 19 (... 34 1.7
gi|37595296|gb|AAQ94533.1| M protein [Streptococcus pyogenes] 34 1.7
gi|19908271|gb|AAL99241.1| M protein precursor [Streptococcus py... 34 1.7
gi|19705122|ref|NP_602617.1| Hemolysin [Fusobacterium nucleatum ... 34 2.2
gi|50755208|ref|XP_414653.1| PREDICTED: similar to ALL1 fused ge... 34 2.2
gi|6320129|ref|NP_010209.1| E3 ubiquitin ligase for Rad6p, requi... 34 2.2
gi|15675799|ref|NP_269973.1| M protein type 1 [Streptococcus py... 34 2.2
gi|23099946|ref|NP_693412.1| hypothetical protein OB2491 [Oceano... 34 2.2
gi|45185278|ref|NP_982995.1| ABR049Cp [Eremothecium gossypii] >g... 34 2.2
gi|34878121|ref|XP_223443.2| similar to bM573K1.5 (novel Ulp1 pr... 34 2.2
gi|17568943|ref|NP_509481.1| putative protein, with 2 coiled coi... 34 2.2
gi|41235752|ref|NP_958750.1| similar to CTCL tumor antigen se57-... 34 2.2
gi|19703477|ref|NP_603039.1| Hemolysin [Fusobacterium nucleatum ... 34 2.2
gi|48095516|ref|XP_392311.1| similar to Short stop/Kakapo long i... 34 2.2
gi|39587457|emb|CAE75111.1| Hypothetical protein CBG23036 [Caeno... 33 2.8
gi|28829317|gb|AAO51859.1| similar to Homo sapiens (Human). Muci... 33 2.8
gi|39580550|emb|CAE74682.1| Hypothetical protein CBG22492 [Caeno... 33 2.8
gi|39104485|dbj|BAC65567.3| mKIAA0445 protein [Mus musculus] 33 2.8
gi|49115756|gb|AAH73078.1| Unknown (protein for IMAGE:5156195) [... 33 2.8
gi|47226837|emb|CAG06679.1| unnamed protein product [Tetraodon n... 33 2.8
gi|25056305|ref|XP_203344.1| RIKEN cDNA 4733401L19 [Mus musculus... 33 2.8
gi|28514322|ref|XP_109734.2| RIKEN cDNA 4732407F15 gene [Mus mus... 33 2.8
gi|24415404|ref|NP_055426.1| MDN1, midasin homolog [Homo sapiens... 33 2.8
gi|34194138|gb|AAH14882.1| MDN1 protein [Homo sapiens] 33 2.8
gi|34327950|dbj|BAA20761.2| KIAA0301 [Homo sapiens] 33 2.8
gi|23123890|ref|ZP_00105922.1| COG0172: Seryl-tRNA synthetase [N... 33 2.8
gi|46227572|gb|EAK88507.1| hypothetical protein, proline rich C-... 33 2.8
gi|42660863|ref|XP_064152.5| sarcalumenin [Homo sapiens] 33 3.7
gi|7242804|emb|CAB77251.1| accumulation-associated protein [Stap... 33 3.7
gi|34979127|gb|AAQ83699.1| accumulation-associated protein [Stap... 33 3.7
gi|24583487|ref|NP_723605.1| CG17097-PA [Drosophila melanogaster... 33 3.7
gi|50402362|gb|AAT76538.1| CG16707 [Drosophila yakuba] 33 3.7
gi|459931|gb|AAA40971.1| contiguous repeat polypeptide [Rattus n... 33 3.7
gi|50547207|ref|XP_501073.1| hypothetical protein [Yarrowia lipo... 33 3.7
gi|32416682|ref|XP_328819.1| predicted protein [Neurospora crass... 33 3.7
gi|50762325|ref|XP_425012.1| PREDICTED: similar to transcription... 33 3.7
gi|24583485|ref|NP_609429.1| CG17097-PB [Drosophila melanogaster... 33 3.7
gi|34979125|gb|AAQ83698.1| accumulation-associated protein [Stap... 33 3.7
gi|34534585|dbj|BAC87052.1| unnamed protein product [Homo sapiens] 33 3.7
gi|26340320|dbj|BAC33823.1| unnamed protein product [Mus musculus] 33 3.7
gi|2271467|gb|AAC38155.1| fibronectin/fibrinogen binding protein... 33 4.8
gi|15238294|ref|NP_201296.1| expressed protein [Arabidopsis thal... 33 4.8
gi|15131992|emb|CAC49971.1| dJ276E15.1 (DIPB protein) [Homo sapi... 33 4.8
gi|31242639|ref|XP_321750.1| ENSANGP00000016828 [Anopheles gambi... 33 4.8
gi|6688177|emb|CAB65108.1| DIPB protein [Homo sapiens] 33 4.8
gi|21361639|ref|NP_060053.2| DIPB protein [Homo sapiens] >gnl|BL... 33 4.8
gi|46202231|ref|ZP_00053540.2| COG4547: Cobalamin biosynthesis p... 33 4.8
gi|21426789|ref|NP_653358.1| Cys2/His2 zinc finger protein (rKr1... 33 4.8
gi|42795547|gb|AAS46113.1| RNA polymerase beta'' chain; rpoC2 [O... 33 4.8
gi|46437022|gb|EAK96375.1| hypothetical protein CaO19.3091 [Cand... 33 4.8
gi|50760861|ref|XP_418165.1| PREDICTED: similar to keratin 10; c... 33 4.8
gi|47216838|emb|CAG02729.1| unnamed protein product [Tetraodon n... 33 4.8
gi|127237|sp|P24399|Z239_MOUSE Zinc finger protein 239 (Zfp-239)... 33 4.8
gi|6006448|emb|CAB56789.1| IgA1 protease [Haemophilus influenzae] 33 4.8
gi|38344164|emb|CAE03495.2| OSJNBa0053K19.3 [Oryza sativa (japon... 33 4.8
gi|32566156|ref|NP_501620.2| myosin head and M protein repeat (... 32 6.3
gi|46409654|ref|NP_057892.1| zinc finger protein 95 [Mus musculu... 32 6.3
gi|38079996|ref|XP_287445.2| expressed sequence AF013969 [Mus mu... 32 6.3
gi|41946947|gb|AAH66115.1| Zfp180 protein [Mus musculus] 32 6.3
gi|39583635|emb|CAE65739.1| Hypothetical protein CBG10824 [Caeno... 32 6.3
gi|45527333|ref|ZP_00178533.1| hypothetical protein Cwat076501 [... 32 6.3
gi|34873659|ref|XP_340899.1| similar to keratin complex-1, acidi... 32 6.3
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g... 32 6.3
gi|1170022|sp|P08568|GRPA_RAT Submandibular gland secretory Glx-... 32 6.3
gi|49522151|gb|AAH74309.1| Unknown (protein for MGC:84118) [Xeno... 32 6.3
gi|50744910|ref|XP_419932.1| PREDICTED: similar to myelin transc... 32 6.3
gi|50553987|ref|XP_504402.1| hypothetical protein [Yarrowia lipo... 32 6.3
gi|7108925|gb|AAF36542.1| 39-kDa surface lipoprotein precursor [... 32 6.3
gi|92319|pir||A29573 Glx-rich protein - rat (fragment) >gnl|BL_O... 32 6.3
gi|46435639|gb|EAK95016.1| hypothetical protein CaO19.11553 [Can... 32 6.3
gi|11467975|sp|P29228|VLPA_MYCHR Variant surface antigen A precu... 32 6.3
gi|50402364|gb|AAT76539.1| CG16707 [Drosophila teissieri] 32 6.3
gi|24373986|ref|NP_718029.1| srpA-related protein [Shewanella on... 32 6.3
gi|7509394|pir||T26467 hypothetical protein Y11D7A.14 - Caenorha... 32 6.3
gi|27369654|ref|NP_766071.1| zinc finger protein 180 [Mus muscul... 32 6.3
gi|39644983|gb|AAH63741.1| Zfp180 protein [Mus musculus] 32 6.3
gi|6324096|ref|NP_014166.1| Targeting subunit for Glc7p protein ... 32 6.3
gi|30424360|emb|CAD90171.1| Hypothetical protein C18D11.6 [Caeno... 32 6.3
gi|6679000|ref|NP_032692.1| myelin transcription factor 1-like; ... 32 6.3
gi|741022|prf||2006282A keratin 15 32 8.2
gi|6680602|ref|NP_032495.1| keratin complex 1, acidic, gene 15; ... 32 8.2
gi|29374744|ref|NP_813896.1| cell wall surface anchor family pro... 32 8.2
gi|38141772|dbj|BAD00708.1| fibronectin-binding protein [Strepto... 32 8.2
gi|49072684|ref|XP_400631.1| hypothetical protein UM03016.1 [Ust... 32 8.2
gi|23619364|ref|NP_705326.1| hypothetical protein [Plasmodium fa... 32 8.2
gi|50259654|gb|EAL22324.1| hypothetical protein CNBB4990 [Crypto... 32 8.2
gi|24430190|ref|NP_002266.2| keratin 15; keratin-15, basic; kera... 32 8.2
gi|125081|sp|P19012|K1CO_HUMAN Keratin, type I cytoskeletal 15 (... 32 8.2
gi|39582082|emb|CAE63725.1| Hypothetical protein CBG08250 [Caeno... 32 8.2
gi|19112957|ref|NP_596165.1| uv-endonuclease. [Schizosaccharomyc... 32 8.2
gi|45527127|ref|ZP_00178328.1| COG0172: Seryl-tRNA synthetase [C... 32 8.2
gi|6680606|ref|NP_032497.1| keratin complex 1, acidic, gene 19; ... 32 8.2
gi|3550539|emb|CAA06944.1| K15 intermediate filament type I kera... 32 8.2
gi|39939179|ref|NP_950945.1| chromosome segregation ATPase homol... 32 8.2
gi|34873691|ref|XP_213482.2| similar to cytokeratin 15 [Rattus n... 32 8.2
gi|38100404|gb|EAA47536.1| hypothetical protein MG02779.4 [Magna... 32 8.2
gi|50260839|gb|EAL23489.1| hypothetical protein CNBA1360 [Crypto... 32 8.2
gi|3252880|gb|AAC24207.1| myosin heavy chain isoform A [Loligo p... 32 8.2
gi|22002966|emb|CAD43075.1| putative CENP-E like kinetochore pro... 32 8.2
gi|643552|gb|AAA85110.1| M1.3 protein 32 8.2
>gi|17505945|ref|NP_493469.1| putative protein (21.3 kD) (1O746)
[Caenorhabditis elegans]
gi|7497144|pir||T19803 hypothetical protein C37A5.4 -
Caenorhabditis elegans
gi|3874809|emb|CAB07333.1| Hypothetical protein C37A5.4
[Caenorhabditis elegans]
Length = 191
Score = 308 bits (788), Expect = 6e-83
Identities = 154/154 (100%), Positives = 154/154 (100%)
Frame = -1
Query: 576 MKFISVFLVAILAIGAFCATETESKMKMGGSGSDVKTEMNMNSQTPHTLERRSETQSSMK 397
MKFISVFLVAILAIGAFCATETESKMKMGGSGSDVKTEMNMNSQTPHTLERRSETQSSMK
Sbjct: 1 MKFISVFLVAILAIGAFCATETESKMKMGGSGSDVKTEMNMNSQTPHTLERRSETQSSMK 60
Query: 396 MDGQGSGVKTEMNMNSQTPQIRDTRSETETKMKMEGQGSDMKTEINQQMDTPHTLERRSE 217
MDGQGSGVKTEMNMNSQTPQIRDTRSETETKMKMEGQGSDMKTEINQQMDTPHTLERRSE
Sbjct: 61 MDGQGSGVKTEMNMNSQTPQIRDTRSETETKMKMEGQGSDMKTEINQQMDTPHTLERRSE 120
Query: 216 TESQIKMEGQGSGVKTEMNQQMDAEAPHIRDRRW 115
TESQIKMEGQGSGVKTEMNQQMDAEAPHIRDRRW
Sbjct: 121 TESQIKMEGQGSGVKTEMNQQMDAEAPHIRDRRW 154
Score = 43.5 bits (101), Expect = 0.003
Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 2/51 (3%)
Frame = -1
Query: 519 TETESKMKMGGSGSDVKTEMN--MNSQTPHTLERRSETQSSMKMDGQGSGV 373
+ETES++KM G GS VKTEMN M+++ PH +RR M G G G+
Sbjct: 119 SETESQIKMEGQGSGVKTEMNQQMDAEAPHIRDRRWGYYGGMGGYGMGYGM 169