Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C37A5_2
(576 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17505943|ref|NP_493470.1| putative protein (1O749) [Caenorhab... 305 3e-82
gi|17505945|ref|NP_493469.1| putative protein (21.3 kD) (1O746) ... 295 5e-79
gi|17505949|ref|NP_493471.1| predicted CDS, putative secreted or... 48 1e-04
gi|7108938|gb|AAF36549.1| 87-kDa surface lipoprotein precursor [... 39 0.088
gi|7108933|gb|AAF36546.1| 87-kDa surface lipoprotein precursor [... 39 0.088
gi|47226837|emb|CAG06679.1| unnamed protein product [Tetraodon n... 37 0.20
gi|48838681|ref|ZP_00295621.1| hypothetical protein Meth02003245... 37 0.26
gi|23023431|ref|ZP_00062667.1| COG0552: Signal recognition parti... 37 0.33
gi|46142430|ref|ZP_00149113.2| hypothetical protein Mbur020115 [... 37 0.33
gi|23956166|ref|NP_080589.1| cisplatin resistance-associated ove... 36 0.43
gi|50288373|ref|XP_446615.1| unnamed protein product [Candida gl... 36 0.43
gi|24286587|gb|AAN46652.1| M protein precursor [Streptococcus py... 36 0.43
gi|3746909|gb|AAC64112.1| M protein [Streptococcus pyogenes] 36 0.43
gi|23486190|gb|EAA20743.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [... 36 0.43
gi|50755208|ref|XP_414653.1| PREDICTED: similar to ALL1 fused ge... 36 0.57
gi|11024712|ref|NP_060003.1| myosin, heavy polypeptide 4, skelet... 36 0.57
gi|50548613|ref|XP_501776.1| hypothetical protein [Yarrowia lipo... 36 0.57
gi|23508973|ref|NP_701641.1| hypothetical protein [Plasmodium fa... 36 0.57
gi|23335484|ref|ZP_00120719.1| hypothetical protein Blon020592 [... 35 0.74
gi|47226978|emb|CAG05870.1| unnamed protein product [Tetraodon n... 35 0.74
gi|28828350|gb|AAL93017.2| hypothetical protein [Dictyostelium d... 35 0.74
gi|459931|gb|AAA40971.1| contiguous repeat polypeptide [Rattus n... 35 0.74
gi|6708502|gb|AAD09454.2| superfast myosin heavy chain [Felis ca... 35 0.74
gi|23466357|ref|NP_696960.1| hypothetical protein BL1813 [Bifido... 35 0.74
gi|19908277|gb|AAL99243.1| M protein precursor [Streptococcus py... 35 0.74
gi|6478794|gb|AAF14005.1| SUP35 homolog [Pichia pastoris] 35 0.97
gi|8132107|gb|AAF73220.1| glutamine/glutamic acid-rich protein B... 35 1.3
gi|34877946|ref|XP_237588.2| similar to KIAA0874 protein [Rattus... 35 1.3
gi|24650843|ref|NP_651624.2| CG10011-PA [Drosophila melanogaster... 35 1.3
gi|17862878|gb|AAL39916.1| SD01389p [Drosophila melanogaster] 35 1.3
gi|1170022|sp|P08568|GRPA_RAT Submandibular gland secretory Glx-... 35 1.3
gi|92319|pir||A29573 Glx-rich protein - rat (fragment) >gnl|BL_O... 35 1.3
gi|15239193|ref|NP_199130.1| expressed protein [Arabidopsis thal... 35 1.3
gi|7108927|gb|AAF36543.1| 46-kDa surface lipoprotein precursor [... 35 1.3
gi|19908279|gb|AAL99244.1| M protein precursor [Streptococcus py... 35 1.3
gi|19908269|gb|AAL99239.1| M protein precursor [Streptococcus py... 35 1.3
gi|19908273|gb|AAL99242.1| M protein precursor [Streptococcus py... 35 1.3
gi|32364687|gb|AAP80383.1| EH domain protein [Xenopus laevis] 34 1.7
gi|486711|pir||S34978 M1.1 protein precursor - Streptococcus pyo... 34 1.7
gi|49119498|gb|AAH73619.1| Eps15R protein [Xenopus laevis] 34 1.7
gi|26351249|dbj|BAC39261.1| unnamed protein product [Mus musculus] 34 1.7
gi|24583487|ref|NP_723605.1| CG17097-PA [Drosophila melanogaster... 34 2.2
gi|30681973|ref|NP_187801.2| UbiA prenyltransferase family prote... 34 2.2
gi|23488160|gb|EAA21247.1| Formin Homology 2 Domain, putative [P... 34 2.2
gi|31126963|ref|NP_852105.1| glutamine/glutamic acid-rich protei... 34 2.2
gi|24286597|gb|AAN46657.1| M protein precursor [Streptococcus py... 34 2.2
gi|6671951|gb|AAF23211.1| hypothetical protein [Arabidopsis thal... 34 2.2
gi|24583485|ref|NP_609429.1| CG17097-PB [Drosophila melanogaster... 34 2.2
gi|34873078|ref|XP_340881.1| similar to cisplatin resistance-ass... 34 2.2
gi|6005948|ref|NP_009118.1| WW domain-containing binding protein... 34 2.2
gi|30525885|gb|AAP32473.1| M protein [Streptococcus pyogenes] 34 2.2
gi|38343906|emb|CAE51961.2| M protein [Streptococcus pyogenes] 34 2.2
gi|19908275|gb|AAL99240.1| M protein precursor [Streptococcus py... 34 2.2
gi|9910552|ref|NP_064475.1| sodium/calcium/potassium exchanger [... 33 2.8
gi|98063|pir||S01260 M protein precursor - Streptococcus pyogene... 33 2.8
gi|1084196|pir||S46489 M1 protein precursor - Streptococcus pyog... 33 2.8
gi|421440|pir||S35401 M1 protein precursor - Streptococcus pyoge... 33 2.8
gi|50306055|ref|XP_452989.1| unnamed protein product [Kluyveromy... 33 2.8
gi|41235752|ref|NP_958750.1| similar to CTCL tumor antigen se57-... 33 2.8
gi|34485640|gb|AAQ73205.1| M protein [Streptococcus pyogenes] 33 2.8
gi|33598982|gb|AAQ23116.1| M1 protein [Streptococcus pyogenes] 33 2.8
gi|38344164|emb|CAE03495.2| OSJNBa0053K19.3 [Oryza sativa (japon... 33 2.8
gi|37595296|gb|AAQ94533.1| M protein [Streptococcus pyogenes] 33 2.8
gi|19908271|gb|AAL99241.1| M protein precursor [Streptococcus py... 33 2.8
gi|15675799|ref|NP_269973.1| M protein type 1 [Streptococcus py... 33 3.7
gi|34878121|ref|XP_223443.2| similar to bM573K1.5 (novel Ulp1 pr... 33 3.7
gi|17505296|ref|NP_492804.1| putative nuclear protein family mem... 33 3.7
gi|19923485|ref|NP_057508.2| cisplatin resistance-associated ove... 33 4.8
gi|7023491|dbj|BAA91981.1| unnamed protein product [Homo sapiens] 33 4.8
gi|23099946|ref|NP_693412.1| hypothetical protein OB2491 [Oceano... 33 4.8
gi|17137804|ref|NP_477509.1| CG5595-PA [Drosophila melanogaster]... 33 4.8
gi|49479806|ref|YP_035315.1| conserved hypothetical protein [Bac... 33 4.8
gi|23016160|ref|ZP_00055919.1| COG1196: Chromosome segregation A... 33 4.8
gi|19704348|ref|NP_603910.1| Hypothetical protein [Fusobacterium... 33 4.8
gi|50259654|gb|EAL22324.1| hypothetical protein CNBB4990 [Crypto... 33 4.8
gi|50419727|ref|XP_458392.1| unnamed protein product [Debaryomyc... 33 4.8
gi|50762325|ref|XP_425012.1| PREDICTED: similar to transcription... 33 4.8
gi|41386691|ref|NP_776542.1| myosin, heavy polypeptide 1, skelet... 33 4.8
gi|48839595|ref|ZP_00296526.1| COG0711: F0F1-type ATP synthase, ... 33 4.8
gi|50546505|ref|XP_500722.1| hypothetical protein [Yarrowia lipo... 33 4.8
gi|34979127|gb|AAQ83699.1| accumulation-associated protein [Stap... 32 6.3
gi|7242804|emb|CAB77251.1| accumulation-associated protein [Stap... 32 6.3
gi|30913071|sp||Q23933_2 [Segment 2 of 2] Defective chorion-1 pr... 32 6.3
gi|6320129|ref|NP_010209.1| E3 ubiquitin ligase for Rad6p, requi... 32 6.3
gi|31242639|ref|XP_321750.1| ENSANGP00000016828 [Anopheles gambi... 32 6.3
gi|7669506|ref|NP_005954.2| myosin, heavy polypeptide 1, skeleta... 32 6.3
gi|34762922|ref|ZP_00143903.1| Hemolysin [Fusobacterium nucleatu... 32 6.3
gi|9631305|ref|NP_048116.1| ORF MSV045 hypothetical protein [Mel... 32 6.3
gi|24286607|gb|AAN46662.1| M protein precursor [Streptococcus py... 32 6.3
gi|17554190|ref|NP_498069.1| kinesin-like protein (103.5 kD) (kl... 32 6.3
gi|49072684|ref|XP_400631.1| hypothetical protein UM03016.1 [Ust... 32 6.3
gi|49071164|ref|XP_399871.1| hypothetical protein UM02256.1 [Ust... 32 6.3
gi|19114077|ref|NP_593165.1| serine/threonine-protein kinase orb... 32 6.3
gi|46048571|ref|NP_976077.1| hypothetical gene supported by M310... 32 6.3
gi|24640994|ref|NP_572618.1| CG15306-PA [Drosophila melanogaster... 32 6.3
gi|34979125|gb|AAQ83698.1| accumulation-associated protein [Stap... 32 6.3
gi|50731279|ref|XP_417214.1| PREDICTED: similar to Pre-mRNA clea... 32 6.3
gi|39939179|ref|NP_950945.1| chromosome segregation ATPase homol... 32 6.3
gi|30248051|ref|NP_840121.1| possible sugar kinase [Nitrosomonas... 32 8.2
gi|34867110|ref|XP_342817.1| similar to Midasin (MIDAS-containin... 32 8.2
gi|21753039|dbj|BAC04274.1| unnamed protein product [Homo sapiens] 32 8.2
gi|47566162|ref|ZP_00237190.1| erpL protein [Bacillus cereus G92... 32 8.2
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp... 32 8.2
gi|34763487|ref|ZP_00144430.1| hypothetical protein [Fusobacteri... 32 8.2
gi|49482636|ref|YP_039860.1| putative DNA-binding protein [Staph... 32 8.2
gi|39592146|emb|CAE75366.1| Hypothetical protein CBG23350 [Caeno... 32 8.2
gi|45384404|ref|NP_990273.1| restin [Gallus gallus] >gnl|BL_ORD_... 32 8.2
gi|45198828|ref|NP_985857.1| AFR310Cp [Eremothecium gossypii] >g... 32 8.2
gi|48120927|ref|XP_396472.1| similar to CG33103-PA [Apis mellifera] 32 8.2
gi|22087668|gb|AAM90997.1| hemolysin [Fusobacterium nucleatum] 32 8.2
gi|2905649|gb|AAC03547.1| cytoplasmic linker protein CLIP-170 [G... 32 8.2
gi|38100404|gb|EAA47536.1| hypothetical protein MG02779.4 [Magna... 32 8.2
gi|16122354|ref|NP_405667.1| putative phage tail protein [Yersin... 32 8.2
>gi|17505943|ref|NP_493470.1| putative protein (1O749)
[Caenorhabditis elegans]
gi|7497143|pir||T19804 hypothetical protein C37A5.2 -
Caenorhabditis elegans
gi|3874810|emb|CAB07334.1| Hypothetical protein C37A5.2
[Caenorhabditis elegans]
Length = 191
Score = 305 bits (782), Expect = 3e-82
Identities = 154/154 (100%), Positives = 154/154 (100%)
Frame = +1
Query: 1 MKFISVFLVAILAIGAFCATETESKMKMGGSGSDVKTQMNMNSQAPHTLERRSEAQSSMK 180
MKFISVFLVAILAIGAFCATETESKMKMGGSGSDVKTQMNMNSQAPHTLERRSEAQSSMK
Sbjct: 1 MKFISVFLVAILAIGAFCATETESKMKMGGSGSDVKTQMNMNSQAPHTLERRSEAQSSMK 60
Query: 181 LDGQKSGVKTEMSMDSQTPQIRDTRSETETKMKMEGQGSDMKTEINQQMDTPHTLERRSE 360
LDGQKSGVKTEMSMDSQTPQIRDTRSETETKMKMEGQGSDMKTEINQQMDTPHTLERRSE
Sbjct: 61 LDGQKSGVKTEMSMDSQTPQIRDTRSETETKMKMEGQGSDMKTEINQQMDTPHTLERRSE 120
Query: 361 TESQIKMEGQGSGVKTEMNQQMDAEAPHIRDRRW 462
TESQIKMEGQGSGVKTEMNQQMDAEAPHIRDRRW
Sbjct: 121 TESQIKMEGQGSGVKTEMNQQMDAEAPHIRDRRW 154